(95c) Catalytic Membrane Reactor In the Treatment of Waste Water

Authors: 
Gutiérrez Arzaluz, M. - Presenter, Universidad Autonoma Metropolitana
Aguilar Pliego, J. - Presenter, Universidad Autonoma Metropolitana
Martínez, B. - Presenter, Universidad Autonoma Metropolitana
De la fuente Ascencion, M. - Presenter, Universidad Autonoma Metropolitana
Torres, II, R. M. - Presenter, Universidad Autonoma Metropolitana




v\:* {behavior:url(#default#VML);} o\:* {behavior:url(#default#VML);} w\:* {behavior:url(#default#VML);} .shape {behavior:url(#default#VML);}



Miguel Torres Rodríguez
Miguel Torres Rodríguez
2
1
2010-10-28T18:34:00Z
2010-10-28T18:34:00Z
1
356
1960
16
4
2312
12.00




Clean
Clean
false

21


false
false
false

ES
X-NONE
X-NONE




























DefSemiHidden="true" DefQFormat="false" DefPriority="99"
LatentStyleCount="267">
UnhideWhenUsed="false" QFormat="true" Name="Normal"/>
UnhideWhenUsed="false" QFormat="true" Name="heading 1"/>


















UnhideWhenUsed="false" QFormat="true" Name="Title"/>

UnhideWhenUsed="false" QFormat="true" Name="Subtitle"/>
UnhideWhenUsed="false" QFormat="true" Name="Strong"/>
UnhideWhenUsed="false" QFormat="true" Name="Emphasis"/>
UnhideWhenUsed="false" Name="Table Grid"/>

UnhideWhenUsed="false" QFormat="true" Name="No Spacing"/>
UnhideWhenUsed="false" Name="Light Shading"/>
UnhideWhenUsed="false" Name="Light List"/>
UnhideWhenUsed="false" Name="Light Grid"/>
UnhideWhenUsed="false" Name="Medium Shading 1"/>
UnhideWhenUsed="false" Name="Medium Shading 2"/>
UnhideWhenUsed="false" Name="Medium List 1"/>
UnhideWhenUsed="false" Name="Medium List 2"/>
UnhideWhenUsed="false" Name="Medium Grid 1"/>
UnhideWhenUsed="false" Name="Medium Grid 2"/>
UnhideWhenUsed="false" Name="Medium Grid 3"/>
UnhideWhenUsed="false" Name="Dark List"/>
UnhideWhenUsed="false" Name="Colorful Shading"/>
UnhideWhenUsed="false" Name="Colorful List"/>
UnhideWhenUsed="false" Name="Colorful Grid"/>
UnhideWhenUsed="false" Name="Light Shading Accent 1"/>
UnhideWhenUsed="false" Name="Light List Accent 1"/>
UnhideWhenUsed="false" Name="Light Grid Accent 1"/>
UnhideWhenUsed="false" Name="Medium Shading 1 Accent 1"/>
UnhideWhenUsed="false" Name="Medium Shading 2 Accent 1"/>
UnhideWhenUsed="false" Name="Medium List 1 Accent 1"/>

UnhideWhenUsed="false" QFormat="true" Name="List Paragraph"/>
UnhideWhenUsed="false" QFormat="true" Name="Quote"/>
UnhideWhenUsed="false" QFormat="true" Name="Intense Quote"/>
UnhideWhenUsed="false" Name="Medium List 2 Accent 1"/>
UnhideWhenUsed="false" Name="Medium Grid 1 Accent 1"/>
UnhideWhenUsed="false" Name="Medium Grid 2 Accent 1"/>
UnhideWhenUsed="false" Name="Medium Grid 3 Accent 1"/>
UnhideWhenUsed="false" Name="Dark List Accent 1"/>
UnhideWhenUsed="false" Name="Colorful Shading Accent 1"/>
UnhideWhenUsed="false" Name="Colorful List Accent 1"/>
UnhideWhenUsed="false" Name="Colorful Grid Accent 1"/>
UnhideWhenUsed="false" Name="Light Shading Accent 2"/>
UnhideWhenUsed="false" Name="Light List Accent 2"/>
UnhideWhenUsed="false" Name="Light Grid Accent 2"/>
UnhideWhenUsed="false" Name="Medium Shading 1 Accent 2"/>
UnhideWhenUsed="false" Name="Medium Shading 2 Accent 2"/>
UnhideWhenUsed="false" Name="Medium List 1 Accent 2"/>
UnhideWhenUsed="false" Name="Medium List 2 Accent 2"/>
UnhideWhenUsed="false" Name="Medium Grid 1 Accent 2"/>
UnhideWhenUsed="false" Name="Medium Grid 2 Accent 2"/>
UnhideWhenUsed="false" Name="Medium Grid 3 Accent 2"/>
UnhideWhenUsed="false" Name="Dark List Accent 2"/>
UnhideWhenUsed="false" Name="Colorful Shading Accent 2"/>
UnhideWhenUsed="false" Name="Colorful List Accent 2"/>
UnhideWhenUsed="false" Name="Colorful Grid Accent 2"/>
UnhideWhenUsed="false" Name="Light Shading Accent 3"/>
UnhideWhenUsed="false" Name="Light List Accent 3"/>
UnhideWhenUsed="false" Name="Light Grid Accent 3"/>
UnhideWhenUsed="false" Name="Medium Shading 1 Accent 3"/>
UnhideWhenUsed="false" Name="Medium Shading 2 Accent 3"/>
UnhideWhenUsed="false" Name="Medium List 1 Accent 3"/>
UnhideWhenUsed="false" Name="Medium List 2 Accent 3"/>
UnhideWhenUsed="false" Name="Medium Grid 1 Accent 3"/>
UnhideWhenUsed="false" Name="Medium Grid 2 Accent 3"/>
UnhideWhenUsed="false" Name="Medium Grid 3 Accent 3"/>
UnhideWhenUsed="false" Name="Dark List Accent 3"/>
UnhideWhenUsed="false" Name="Colorful Shading Accent 3"/>
UnhideWhenUsed="false" Name="Colorful List Accent 3"/>
UnhideWhenUsed="false" Name="Colorful Grid Accent 3"/>
UnhideWhenUsed="false" Name="Light Shading Accent 4"/>
UnhideWhenUsed="false" Name="Light List Accent 4"/>
UnhideWhenUsed="false" Name="Light Grid Accent 4"/>
UnhideWhenUsed="false" Name="Medium Shading 1 Accent 4"/>
UnhideWhenUsed="false" Name="Medium Shading 2 Accent 4"/>
UnhideWhenUsed="false" Name="Medium List 1 Accent 4"/>
UnhideWhenUsed="false" Name="Medium List 2 Accent 4"/>
UnhideWhenUsed="false" Name="Medium Grid 1 Accent 4"/>
UnhideWhenUsed="false" Name="Medium Grid 2 Accent 4"/>
UnhideWhenUsed="false" Name="Medium Grid 3 Accent 4"/>
UnhideWhenUsed="false" Name="Dark List Accent 4"/>
UnhideWhenUsed="false" Name="Colorful Shading Accent 4"/>
UnhideWhenUsed="false" Name="Colorful List Accent 4"/>
UnhideWhenUsed="false" Name="Colorful Grid Accent 4"/>
UnhideWhenUsed="false" Name="Light Shading Accent 5"/>
UnhideWhenUsed="false" Name="Light List Accent 5"/>
UnhideWhenUsed="false" Name="Light Grid Accent 5"/>
UnhideWhenUsed="false" Name="Medium Shading 1 Accent 5"/>
UnhideWhenUsed="false" Name="Medium Shading 2 Accent 5"/>
UnhideWhenUsed="false" Name="Medium List 1 Accent 5"/>
UnhideWhenUsed="false" Name="Medium List 2 Accent 5"/>
UnhideWhenUsed="false" Name="Medium Grid 1 Accent 5"/>
UnhideWhenUsed="false" Name="Medium Grid 2 Accent 5"/>
UnhideWhenUsed="false" Name="Medium Grid 3 Accent 5"/>
UnhideWhenUsed="false" Name="Dark List Accent 5"/>
UnhideWhenUsed="false" Name="Colorful Shading Accent 5"/>
UnhideWhenUsed="false" Name="Colorful List Accent 5"/>
UnhideWhenUsed="false" Name="Colorful Grid Accent 5"/>
UnhideWhenUsed="false" Name="Light Shading Accent 6"/>
UnhideWhenUsed="false" Name="Light List Accent 6"/>
UnhideWhenUsed="false" Name="Light Grid Accent 6"/>
UnhideWhenUsed="false" Name="Medium Shading 1 Accent 6"/>
UnhideWhenUsed="false" Name="Medium Shading 2 Accent 6"/>
UnhideWhenUsed="false" Name="Medium List 1 Accent 6"/>
UnhideWhenUsed="false" Name="Medium List 2 Accent 6"/>
UnhideWhenUsed="false" Name="Medium Grid 1 Accent 6"/>
UnhideWhenUsed="false" Name="Medium Grid 2 Accent 6"/>
UnhideWhenUsed="false" Name="Medium Grid 3 Accent 6"/>
UnhideWhenUsed="false" Name="Dark List Accent 6"/>
UnhideWhenUsed="false" Name="Colorful Shading Accent 6"/>
UnhideWhenUsed="false" Name="Colorful List Accent 6"/>
UnhideWhenUsed="false" Name="Colorful Grid Accent 6"/>
UnhideWhenUsed="false" QFormat="true" Name="Subtle Emphasis"/>
UnhideWhenUsed="false" QFormat="true" Name="Intense Emphasis"/>
UnhideWhenUsed="false" QFormat="true" Name="Subtle Reference"/>
UnhideWhenUsed="false" QFormat="true" Name="Intense Reference"/>
UnhideWhenUsed="false" QFormat="true" Name="Book Title"/>



/* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabla normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:10.0pt; font-family:"Calibri","sans-serif";}







text-align:center;line-height:normal"> font-family:"Times New Roman","serif";mso-ansi-language:EN-US'>Catalytic
membrane reactor in the treatment of waste water

Martínez.
B1, Torres. M1*, Montoya. A2, Gutiérrez. M1,
Aguilar. J1

normal">1 font-family:"Times New Roman","serif"'>Departamento de Ciencias Básicas,
Universidad Autónoma Metropolitana-Azcapotzalco, Av.
San Pablo Nº 180, Col. Reynosa Tamaulipas, Azcapotzalco,
02200, México, D.F

normal">2 font-family:"Times New Roman","serif"'>Direccion de Investigación y Posgrado,
Instituto Mexicano del Petróleo, Eje Central Lázaro Cárdenas Norte Nº 152, Col.
San Bartolo Atepehuacán, 07730, México, D. F.

justify;line-height:normal">* font-family:"Times New Roman","serif"'>e-mail trm@correo.azc.uam.mx

justify;line-height:normal"> font-family:"Times New Roman","serif"'>

justify;line-height:normal"> font-family:"Times New Roman","serif";mso-ansi-language:EN-US'>

justify;line-height:normal"> font-family:"Times New Roman","serif";mso-ansi-language:EN-US'>Keyword,
Membrane reactor, "Times New Roman","serif";mso-ansi-language:EN-GB;mso-bidi-font-weight:bold'>Catalytic
wet oxidation, mso-ansi-language:EN-US'> EN-US'>Nanoparticles font-family:"Times New Roman","serif";mso-ansi-language:EN-US'>, Contactor

text-align:center;line-height:normal"> font-family:"Times New Roman","serif";mso-ansi-language:EN-US'>

justify;line-height:normal"> font-family:"Times New Roman","serif";mso-ansi-language:EN-US'>

justify;line-height:normal"> font-family:"Times New Roman","serif";mso-ansi-language:EN-US'>A membrane
reactor with a liquid and gas flowing on different sides of the catalytic
membrane is called catalytic diffuser. The gas diffuses through the macropores membrane layer and dissolves in the waste water
at the interface (figure 1).

justify;line-height:normal"> font-family:"Times New Roman","serif";mso-ansi-language:EN-US'>

text-align:center;line-height:normal">

coordsize="21600,21600" o:spt="75" o:preferrelative="t" path="m@4@5l@4@11@9@11@9@5xe"
filled="f" stroked="f">

















style='position:absolute;left:0;text-align:left;margin-left:0;margin-top:0;
width:233.55pt;height:114.65pt;z-index:251660288;visibility:visible;
mso-position-horizontal:left;mso-position-horizontal-relative:text;
mso-position-vertical:absolute;mso-position-vertical-relative:text' o:gfxdata="UEsDBBQABgAIAAAAIQDAAWJ2BwEAABUCAAATAAAAW0NvbnRlbnRfVHlwZXNdLnhtbJSRS07DMBCG
90jcwfIWxS5dIISSdEHKEhAqB7DscWIRP+Qxob09kxQWILWIpTX6/pfrzd6PbIKMLoaGX4sVZxB0
NC70DX/dPVS3nGFRwagxBmj4AZBv2suLendIgIzogA0fSkl3UqIewCsUMUGgi43Zq0LP3Muk9Jvq
Qa5XqxupYygQSlVmDd7WTxQgOwPsWeXyqDz5SJNRwjp2UQuS4uz+yMy2DVcpjU6rQqHlFIzwWEVr
nQbRZdwu1NVMybbuwKr3sbDtniyPLTOM+IfgzwbVV3pB5GKKg0t4xuF84tPJirP2VzLn59mWA7U5
tZSJHyHD9N+pOsJeYPpuIpdPbT8BAAD//wMAUEsDBBQABgAIAAAAIQA4/SH/1gAAAJQBAAALAAAA
X3JlbHMvLnJlbHOkkMFqwzAMhu+DvYPRfXGawxijTi+j0GvpHsDYimMaW0Yy2fr2M4PBMnrbUb/Q
94l/f/hMi1qRJVI2sOt6UJgd+ZiDgffL8ekFlFSbvV0oo4EbChzGx4f9GRdb25HMsYhqlCwG5lrL
q9biZkxWOiqY22YiTra2kYMu1l1tQD30/bPm3wwYN0x18gb45AdQl1tp5j/sFB2T0FQ7R0nTNEV3
j6o9feQzro1iOWA14Fm+Q8a1a8+Bvu/d/dMb2JY5uiPbhG/ktn4cqGU/er3pcvwCAAD//wMAUEsD
BBQABgAIAAAAIQDEhSXbnQkAAJFhAAAOAAAAZHJzL2Uyb0RvYy54bWzsXFFv2zgSfj/g/oPg10Mb
iZJl2Wiy6LpNboHkLmjaw+GQF0aibKG0pCNpx9l/dL/j/tjNkJRk+ewqmzpbLMCXVrEocvhxZjgf
OeS7n7Yr7m2YkEVVno+Ct/7IY2VaZUW5OB99+Xz5Jhl5UtEyo7wq2fnoicnRTxd//tO7x3rGSLWs
eMaEB5WUcvZYn4+WStWzszOZLtmKyrdVzUp4mVdiRRX8KRZnmaCPUPuKnxHfj88eK5HVokqZlPDr
B/NydKHrz3OWqr/nuWTK4+cjkE3pf4X+9wH/Pbt4R2cLQetlkVox6AukWNGihEbbqj5QRb21KF5Q
Fa/Sryyb03JDJVTJ09nuL1ZGnn5/zXRWbq5EfVffCpQ8/dvmVnhFprEp6QoGy6ADL2wxAOts76tF
V8E2FyusqMpzb6treWoRZlvlpfDjJJhEQQw6kcK7yA/9iT+xrSxhoPC7hEzGSTTyoEBA4mQS20FK
lx8HKgHZjAzwsCOXfkTBjnSXjEee6S+JvCuxrqvv6vcx+X8kBHWRGgBui3R/tAOfxA0A8FqtBfPI
yMuYTMFO5rP7LxLM+/5qrYr//kcI9uv9hypdr1ip5P2X9zfehoqikvd3H2/u/8UKKe8Vk8q7+/zx
hoTTt6rIWzTbxkGca9By6ZXVfEnLBXsva7BUGHAQpPlJiOpxyWgm8WejeaiipgNaDdv6HnhRXxac
Yx/x2RoJiD/sTkBbi5Q1XTI+RTBOFTg0uSxqOfLEjK0eGBiG+CXTotCZFOknkNgDHxJO43Fo+iiV
YCpdohg5iIMljODtC5B7V1gJtuc9PN5UGVgbXatK+5A9QyJhOJ2MYUjAIogf+0mUmOYajYpIEEzB
TLRRBVM/hg8sYk1VtZDqilUrDx+gIyCZbopurqWVsSmiFaVCOLVv5KX3CJ1MAt/XX8iKF1kDthSL
hzkXoAPgXi8v5z4Usj3uikGfeak9B3ZXP4ACYDPptryrdXubOT7+v2o2ijn15jB9pKoSHspegXp6
OWfpkhooQDNsDab5svkTazfNNs6hdVBBEE6C2HgaArCNIzu4Da5BMCYBsc4qGCcadujNEVBhkGmx
WCqQ1IgafAvifVwVLfjHMvPUU426gNpvoeyBB71RT5xht3j5ieXgsMFnmpb0pMna8aBpCkba2I4u
jZ8ZzbQf2jHF2fbYh7Y8fsr0hNq2+oyP2y90y1Wp2o9XRVkJo1H91tW2ETk35Y3qmF4D+q3SSKs6
B/QG/YiewQLfm69pJqrPMKidX8dPPLX9udLYNSrTVHREX3YcOwmjJEnsxNSqSxSE40Zd4gissOnI
EYV5thVCrxuZ1NZYDAqfPSGqD/A/9OYRYpjzUQlWAg5L8XmlAx4sIOv34FkuC2vnpjy+4FLdNcqU
sfzWmB88fYL6OPjl8xGTb27+afWwK8I3PEAEV1Rc64me8gVEfxxnjfwzfbj79Xw0DaIIvAHKoosw
el3+LL5qH4/etbR/QhGcAiB2u12XZg5A2awUEmoKEqznKxMYYELMd8ANHdOgnrPSrWr7ymkKNvaX
VfmGK+M/GN17wah1LHLvRSo7OAAnrZwWD43phpMOmmg8QYE9hw+CYvEJO3waJXH4ICgWn6jDR89Q
ToFmYGCIigVovANQQsAPOwsDgBAVC1DcAURIEmNU5lwQR1QsQJMdgCZR6Hw0BAMbjqhYgJIOIERH
z+TOSSMqFqDpDkDxGBYpnImBBiEqJiLaCS11mI5wGQVKlTChlYZSdKFm+ebLHUSQhVB63ciTKzXn
jELUZwNtdXFd/HtdZF69pJLhUpTSjZkmTTM4PM9uq9DRaNciE7BkANzhQMt5xVc0Y8unrN8wkKIy
u6WC7sTMpiN7lRuSAUKi2G3wvpbsru7WCUx0r8N97EhLdXp0tluoC2BRwPKc4FQE2RMVLBCMweL1
tJHDcspfNSj49A98QsnsGl8YhCQODYWOyJSEPrHxtF2qQ8tAio3Lfa/NoHvBfm9lYko++OMDKxMw
Eo51m8WbU7Dudh01iE7HukkShYkPizCgQRGstAVh3FexIIAJPAZLQB1ztNvRbtATR7txmoEJ2dFu
u9BzZNnG0e5mJewIQI52DwDkaPcAQI52DwDkaPcAQI52DwB0StoNPBV59VWPXtPZC8g6la9G1A8Q
9Gr7tGDlntSvyM2/sfvYplME4xPyoGkySciBvJhm+zGEff9pAG07HuS2H83OrONBZjHS8aB2w/tI
mO940MAU63jQAECOBw0A5HjQAECOBw0A5HjQAECn5EGHNgEhs1NRnYR6AxnBgpbM2yMcAzTJkqtP
v+2rQ6IwLYfsVQRLvi/YBO22Pw+wqjmcY+BPCs5GZEWew26l6LV4fPezrfVV9j0n7b5nfKp9z51d
zRhSfYmlWoT4UQI7mHrkGqrlEoNRC/6IicGwj2g3zCeno+Y9fXGZwV1mjMuJgS04zJRG52J342zS
tKPmjpo/L7PcUfOBqM9R8wGAHDUfAMhR8wGAHDUfAMhR8wGAXpuav3Jm8AFqDJcOZOtU9Sn4cUL8
e6QDT1t2kzybFmNoCtukcHpWn/0nELPrI6VNumx3slYHbL1MZGlDWzzf2M8b3mHTYzKGvE2bIwyZ
mv5079xkHCX+pMnf9MnAocnvO2XrcoQbeH/MyVxUL0vA4Uj3qU7mjvGECpyKdznCyDLd0VxzeLgh
mI6AfzsH1uUIfxsfR8AHYjtHwAcAcgR8ACBHwAcAcgR8ACBHwAcAOiUB/6PmCP/+lP14ljAJGyZE
yOmYUBgFkCds7wqLiA+3FPW3rkkARAmPU7osYZcl7LKE+0zRMSHHhOD6ve56sN96C5hjQgNRiGNC
AwA5JjQAkGNCAwA5JjQA0AmYEFz7C9cEtTmuvQRd3PrqbzP1b6d8WJgrdPh6Bff+mttXprCD0Wy4
tbe46vXrnZog5RJuS8Lq1UWXl7uymci9vNyXZQL/qF79DwAA///MksFqwzAQRH/F6B7suPRQExkS
l95KTUw/YGMttuhaEpKcJn9fSyKk9OZDaS/jnWUZPczY1tY7qHy9n/M97fIwBo3bJK3NCNTAGarN
e8eyE2fbRcEhSYWcbcrHoihYJqT1V86WyU2+IQQVTEh3mqR4kUTR9CNO2JDNzkCcnYZtvKF5etUi
7Z5iYB5B3O08uXtSgLzBlyvA/xDzbQXmv/q/Dz/AUYkWLBxXV+M323CHilUxUf3loMU1PDs77MwR
e5965S9dunDpM1gTF9RXpPsPFA2oM7gYMlgwo+yfwcN3v8yfpsJSj5oE2voLAAD//wMAUEsDBBQA
BgAIAAAAIQBsZlfuugAAACIBAAAZAAAAZHJzL19yZWxzL2Uyb0RvYy54bWwucmVsc4SPywrCMBBF
94L/EGZv07oQkabdiNCt6AcMyaQNNg+SKPbvDbhREFzOvdxzmLZ/2pk9KCbjnYCmqoGRk14ZNwq4
Xk6bPbCU0SmcvSMBCyXou/WqPdOMuYzSZEJiheKSgCnncOA8yYkspsoHcqXRPlrM5YwjDyhvOBLf
1vWOx08GdF9MNigBcVANsMsSivk/22ttJB29vFty+YeCG1vcBYhxpCzAkjL4DpsqG62Bdy3/+qx7
AQAA//8DAFBLAwQUAAYACAAAACEAVTPvMtsAAAAFAQAADwAAAGRycy9kb3ducmV2LnhtbEyPQUvD
QBCF74L/YRnBi9iNQarGbIqUavFmawSP0+yYBLOzIbtp4r939KKXB483vPdNvppdp440hNazgatF
Aoq48rbl2kD5+nh5CypEZIudZzLwRQFWxelJjpn1E+/ouI+1khIOGRpoYuwzrUPVkMOw8D2xZB9+
cBjFDrW2A05S7jqdJslSO2xZFhrsad1Q9bkfnYHN0m7ft+H5Ynx5erPrzVTuGEtjzs/mh3tQkeb4
dww/+IIOhTAd/Mg2qM6APBJ/VbLr5Y3Yg4E0vUtAF7n+T198AwAA//8DAFBLAwQKAAAAAAAAACEA
Kz7k5RJGMAASRjAAFQAAAGRycy9tZWRpYS9pbWFnZTEudGlmZklJKgAIAAAADwD+AAQAAQAAAAAA
AAAAAQMAAQAAAAAIAAABAQMAAQAAAAAGAAACAQMAAQAAAAgAAAADAQMAAQAAAAEAAAAGAQMAAQAA
AAMAAAARAQQAAQAAABJGAAAVAQMAAQAAAAEAAAAWAQQAAQAAAP////8XAQQAAQAAAAAAMAAaAQUA
AQAAAMIAAAAbAQUAAQAAAMoAAAAoAQMAAQAAAAEAAABAAQMAAAMAANIAAABGhQIAQD8AANIGAAAA
AAAAAQAAAAEAAAABAAAAAQAAAAAAAQECAgMDBAQFBQYGBwcICP//CgoLCwwMDQ0ODg8PEBAREQAA
ExMUFBUVFhYXFxgYGRkaGgAAHBwdHR4eHx8gICEhIiIjIwAAJSUmJicnKCgpKSoqKyssLP//Li4v
LzAwMTEyMjMzNDQ1Nf//Nzc4ODk5Ojo7Ozw8PT0+PoCAQEBBQUJCQ0NEREVFRkZHRwAASUlKSktL
TExNTU5OT09QUAAAUlJTU1RUVVVWVldXWFhZWQAAW1tcXF1dXl5fX2BgYWFiYoCAZGRlZWZmZ2do
aGlpampra4CAbW1ubm9vcHBxcXJyc3N0dICAdnZ3d3h4eXl6ent7fHx9fQAAf3+AgIGBgoKDg4SE
hYWGhgAAiIiJiYqKi4uMjI2Njo6Pj4CAkZGSkpOTlJSVlZaWl5eYmP//mpqbm5ycnZ2enp+foKCh
of//o6OkpKWlpqanp6ioqamqqv//rKytra6ur6+wsLGxsrKzs8DAtbW2tre3uLi5ubq6u7u8vAAA
vr6/v8DAwcHCwsPDxMTFxYCAx8fIyMnJysrLy8zMzc3OzgAA0NDR0dLS09PU1NXV1tbX16am2dna
2tvb3Nzd3d7e39/g4EBA4uLj4+Tk5eXm5ufn6Ojp6YCA6+vs7O3t7u7v7/Dw8fHy8v//9PT19fb2
9/f4+Pn5+vr7+/z8/f3+/v//AAABAQICAwMEBAUFBgYHBwgIAAAKCgsLDAwNDQ4ODw8QEBER//8T
ExQUFRUWFhcXGBgZGRoaAAAcHB0dHh4fHyAgISEiIiMj//8lJSYmJycoKCkpKiorKywsAAAuLi8v
MDAxMTIyMzM0NDU1//83Nzg4OTk6Ojs7PDw9PT4+AABAQEFBQkJDQ0RERUVGRkdHgIBJSUpKS0tM
TE1NTk5PT1BQAABSUlNTVFRVVVZWV1dYWFlZgIBbW1xcXV1eXl9fYGBhYWJiAABkZGVlZmZnZ2ho
aWlqamtrgIBtbW5ub29wcHFxcnJzc3R0QEB2dnd3eHh5eXp6e3t8fH19//9/f4CAgYGCgoODhISF
hYaGQECIiImJioqLi4yMjY2Ojo+P//+RkZKSk5OUlJWVlpaXl5iYAACampubnJydnZ6en5+goKGh
//+jo6SkpaWmpqenqKipqaqqgICsrK2trq6vr7CwsbGysrOz3Ny1tba2t7e4uLm5urq7u7y8gIC+
vr+/wMDBwcLCw8PExMXFgIDHx8jIycnKysvLzMzNzc7OQEDQ0NHR0tLT09TU1dXW1tfXysrZ2dra
29vc3N3d3t7f3+DgAADi4uPj5OTl5ebm5+fo6OnpgIDr6+zs7e3u7u/v8PDx8fLy///09PX19vb3
9/j4+fn6+vv7/Pz9/f7+//8AAAEBAgIDAwQEBQUGBgcHCAgAAAoKCwsMDA0NDg4PDxAQEREAABMT
FBQVFRYWFxcYGBkZGhr//xwcHR0eHh8fICAhISIiIyP//yUlJiYnJygoKSkqKisrLCz//y4uLy8w
MDExMjIzMzQ0NTUAADc3ODg5OTo6Ozs8PD09Pj4AAEBAQUFCQkNDRERFRUZGR0cAAElJSkpLS0xM
TU1OTk9PUFCAgFJSU1NUVFVVVlZXV1hYWVmAgFtbXFxdXV5eX19gYGFhYmKAgGRkZWVmZmdnaGhp
aWpqa2sAAG1tbm5vb3BwcXFycnNzdHQAAHZ2d3d4eHl5enp7e3x8fX2AgH9/gICBgYKCg4OEhIWF
hoaAgIiIiYmKiouLjIyNjY6Oj4///5GRkpKTk5SUlZWWlpeXmJiAgJqam5ucnJ2dnp6fn6CgoaGA
gKOjpKSlpaamp6eoqKmpqqpAQKysra2urq+vsLCxsbKys7PAwLW1tra3t7i4ubm6uru7vLz//76+
v7/AwMHBwsLDw8TExcVAQMfHyMjJycrKy8vMzM3Nzs5AQNDQ0dHS0tPT1NTV1dbW19fw8NnZ2trb
29zc3d3e3t/f4OD//+Li4+Pk5OXl5ubn5+jo6en//+vr7Ozt7e7u7+/w8PHx8vL///T09fX29vf3
+Pj5+fr6+/v8/P39/v7//zANCjANCjANCjUuMDQ3NzI0ZS0wMDgNCjIuMjEyMDg4ZSswMDMNCjYN
CjIuMDAwMDAwZSswMDQNCjIuMzcwMDAwZSswMDANCjIuMDAwMDAwZS0wMDcNCjQuNDIxNTAxZS0w
MDMNCjENCjUuMDQ3NzI0ZS0wMDgNCjIuMjEyMDg4ZSswMDMNCjYNCjIuMDAwMDAwZSswMDQNCjIu
MzcwMDAwZSswMDANCjIuMDAwMDAwZS0wMDcNCjQuNDIxNTAxZS0wMDMNCjINCjUuMDQ3NzI0ZS0w
MDgNCjIuMjEyMDg4ZSswMDMNCjYNCjIuMDAwMDAwZSswMDQNCjIuMzcwMDAwZSswMDANCjIuMDAw
MDAwZS0wMDcNCjQuNDIxNTAxZS0wMDMNCjMNCjUuMDQ3NzI0ZS0wMDgNCjIuMjEyMDg4ZSswMDMN
CjYNCjIuMDAwMDAwZSswMDQNCjIuMzcwMDAwZSswMDANCjIuMDAwMDAwZS0wMDcNCjQuNDIxNTAx
ZS0wMDMNCjQyMA0KRFBfRUhUQ09NTVNGQUlMDQpFSFQgQ29tbXMgRmFpbCA9IE5vDQpEUF9ORVdG
SUxBTUVOVA0KTmV3IEZpbGFtZW50ID0gTm8NCkRQX1NUSUdCQUxBTkNFDQpTdGlnIEJhbGFuY2Ug
PSBPZmYNCkRQX1pPT00NClpvb20gPSBPZmYNCkRQX0FQRVJUVVJFDQpBcGVydHVyZSBOby4gPSA2
DQpEUF9EWU5GT0NVUw0KRHluLkZvY3VzID0gT2ZmDQpEUF9CRUFNX0JMQU5LRUQNCkJlYW0gQmxh
bmtlZCA9IFllcw0KRFBfU1RBR0VfSVMNClN0YWdlIElzID0gSWRsZQ0KRFBfU1RBR0VfSU5JVA0K
U3RhZ2UgSW5pdGlhbGlzZWQgPSBZZXMNCkRQX09VVF9ERVYNCk91dHB1dCBkZXYgPSAxOS8yMSBp
bmNoIGRpc3BsYXkNCkRQX01BR19DQUwNCk1hZyBTdGF0ZSA9IGNhbGlicmF0ZWQNCkRQX1BJWEVM
X1NJWkUNClBpeCBTaXplIHN0YXRlID0gY2FsaWJyYXRlZA0KRFBfRUhUX1ZBQ19SRUFEWQ0KRUhU
IFZhYyByZWFkeSA9IFllcw0KRFBfRUhUX1JFU0VUDQpFSFQgc3B1cmlvdXMgcmVzZXQgPSBObw0K
RFBfRUhUX1RSSVBQRUQNCkVIVCB0cmlwcGVkID0gTm8NCkRQX0RJU1BMQVlfQ0hBTk5FTFMNCkNo
YW5uZWxzID0gMQ0KRFBfTElORV9TQ0FODQpMaW5lIFNjYW4gPSBPZmYNCkRQX1NQT1QNClNwb3Qg
PSBPZmYNCkRQX1dJTkRPV0lORw0KV2luZG93aW5nID0gT2ZmDQpEUF9WRU5UX0lOSElCSVRFRA0K
VmVudGluZyBpbmhpYml0ZWQgPSBZZXMNCkRQXzRRQlNEDQpCU0QgPSBQcmVzZW50DQpEUF80UUJT
RF9HQUlODQpCU0QgR2FpbiA9IEhpZ2gNCkRQXzRRQlNEX1ZJU0lCTEUNCkJTRCBGYXN0ID0gTm8N
CkRQXzRRQlNEX1E0DQpRNCA9IE5vcm1hbA0KRFBfNFFCU0RfUTMNClEzID0gTm9ybWFsDQpEUF80
UUJTRF9RMg0KUTIgPSBOb3JtYWwNCkRQXzRRQlNEX1ExDQpRMSA9IE5vcm1hbA0KRFBfQVVUT19W
SURFTw0KQXV0byBCQyA9IE9mZg0KRFBfSU5WRVJUDQpJbnZlcnQgQSA9IE9mZg0KRFBfTUlYSU5H
DQpNaXhpbmcgPSBPZmYNCkRQX0RFVEVDVE9SX0NIQU5ORUwNClNpZ25hbCBBID0gQXNCDQpEUF9a
T05FDQpab25lID0gMA0KRFBfSU1BR0VfU1RPUkUNClN0b3JlIHJlc29sdXRpb24gPSAyMDQ4ICog
MTUzNg0KRFBfU1RBR0VfVElMVEVEDQpTdGFnZSBUaWx0ID0gaW4gWA0KRFBfWjENClpvbmUgMSA9
IEZyb3plbg0KRFBfWjANClpvbmUgMCA9IEZyb3plbg0KRFBfRlJFRVpFX1NUQVRVUw0KRnJlZXpl
ID0gSWRsZQ0KRFBfRlJFRVpFX09ODQpGcmVlemUgb24gPSBDb21tYW5kDQpEUF9DSEFOTkVMDQpE
aXNwbGF5ID0gMA0KRFBfUklHSFRfRlJPWkVODQpSaWdodCBGcm96ZW4gPSBZZXMNCkRQX0NPTFVN
Tl9UWVBFDQpDb2x1bW4gPSAxNTAwVlANCkRQX1RJTFRFRA0KU3RhZ2UgVGlsdGVkID0gTm8NCkRQ
X1ZFTlRfSU5WQUxJRF9SRUFTT04NClZlbnQgaW5oaWJpdCA9IEJlYW0gUHJlc2VudA0KRFBfU0NJ
TlQNClNjaW50LiA9IE9mZg0KRFBfU0NBTl9PUlRIT0cNClNjYW4gT3J0aG9nID0gT24NCkRQX1ND
QU5fUk9UDQpTY2FuIFJvdCA9IE9uDQpEUF9USUxUX0NPUlJFQ1RJT04NClRpbHQgQ29ycm4uID0g
T2ZmDQpEUF9JTVBMSUVEX0lOVkVSVA0KSW52ZXJ0IEIgPSBPZmYNCkRQX0lNUExJRURfREVURUNU
T1INClNpZ25hbCBCID0gU1RFTQ0KRFBfTUFJTl9ERVRFQ1RPUg0KQ29udHJvbCA9IFNpZ25hbCBB
DQpEUF9DT0xVTU5fSVNPTEFURUQNCkNvbHVtbiBJc29sYXRlZCA9IE5vDQpEUF9DM19ST1RfU0lH
Tg0KQzMgUm90biBTaWduID0gKw0KRFBfU0NNX1JBTkdFDQpTQ00gcmFuZ2UgPSAzLT4xMCBwQQ0K
RFBfQ0FMSUJSQVRJT04NCkNhbGlicmF0aW9uID0gRW5hYmxlZA0KRFBfRVhUX1NDQU5fQ09OVFJP
TA0KRXh0LlNjYW4gQ29udHJvbCA9IE9mZg0KRFBfQUxMX1pPTkVTDQpBbGwgWm9uZXMgPSBPZmYN
CkRQX01BR19SQU5HRQ0KTWFnIFJhbmdlID0gMg0KRFBfU1RBR0VfQU5HTEUNClN0YWdlIEFuZ2xl
IGNvcnJuLiA9IE9uDQpEUF9DM19ST1RfQ09SUkVDVElPTg0KQzMgUm90IENvcnJuLiA9IE9uDQpE
UF9MT1dfTUFHDQpMb3cgTWFnID0gT2ZmDQpEUF9NT05JVE9SDQpNb25pdG9yID0gMTkvMjEgaW5j
aA0KRFBfRlJPWkVODQpJbWFnZSA9IEZyb3plbg0KRFBfTFVUX01PREUNCkRpc3BsYXkgTFVUIG1v
ZGUgPSBOb3JtYWwNCkRQX0ZSRUVaRV9CTEFOS1MNCkZyZWV6ZSBCbGFua3MgPSBZZXMNCkRQX09V
VFBVVF9SRURVQ1RJT04NCk91dHB1dCBSZWR1Y3Rpb24gPSAxDQpEUF9JTUFHRV9ERVRFQ1QNCklt
YWdlIERldGVjdCA9IEJsYWNrDQpEUF9FWFRSQUNUT1JfVFJJUA0KRXh0cmFjdG9yIFRyaXAgPSBO
bw0KRFBfQ1JPU1NIQUlSUw0KQ3Jvc3NoYWlycyA9IE9mZg0KRFBfRklYRURfQVBFUlRVUkUNClZQ
IEFwZXJ0dXJlID0gWWVzDQpEUF9UUkFDS19aDQpUcmFjayBaID0gT24NCkRQX1NFTQ0KU2VtID0g
U3VwcmEgNTVWUA0KRFBfU1VQRVJWSVNPUg0KU3VwZXJ2aXNvciA9IEVuYWJsZWQNCkRQX1VTRVJf
TUFHX0NBTA0KVXNlciBDYWxpYnJhdGlvbiA9IE9mZg0KRFBfQ09OREVOU0VSDQpDb25kZW5zZXIg
Tm9ybWFsID0gTm9ybWFsDQpEUF9JTlBVVF9MVVRfTU9ERQ0KSW5wdXQgTFVUIE1vZGUgPSBUcmFu
c3BhcmVudA0KRFBfU0NBTkdFTg0KU2NhbiBHZW4gPSBQcmVzZW50DQpEUF9EV0VMTF9USU1FDQpE
d2VsbCBUaW1lID0gMTAwIG5zDQpEUF9VU0VSDQpVc2VyID0gSWRsZQ0KRFBfU0NNX1NUQVRVUw0K
U0NNIFN0YXR1cyA9IE9mZg0KRFBfRERFX0FDQ0VTUw0KRERFIEFjY2VzcyA9IE5vbmUNCkRQX1BB
UlRJQUxfVkVOVA0KUGFydGlhbCBWZW50IG9uIFN0YW5kYnkgPSBObw0KRFBfQ09NUFVDRU5UUklD
X01PREUNCkNvbXB1Yy4gTW9kZSA9IE9mZg0KRFBfV0FURVJfT0sNCldhdGVyIE9LID0gWWVzDQpE
UF9VU0VfUkVGX01BRw0KUmVmZXJlbmNlIE1hZyA9IFBvbGFyb2lkIDU0NQ0KRFBfU0FNUExFX0hP
TERFUg0KU2FtcGxlIEhvbGRlciA9IENhcm91c2VsIDkgc3R1Yg0KRFBfU0NBTkdFTl9UWVBFDQpT
Y2FuR2VuIFR5cGUgPSBMLVJFTQ0KRFBfRlJBTUVfR1JBQkJFUg0KRnJhbWUgR3JhYmJlciA9IE1h
dHJpeCBUaXRhbg0KRFBfQlNEX0FVVE8NCkJTRCBBdXRvIFJhbmdlID0gT2ZmDQpEUF9FTEVDVFJP
Tl9DT1VOVElORw0KRWxlY3Ryb24gQ291bnRpbmcgPSBPZmYNCkRQX0hJR0hfQ1VSUkVOVA0KSGln
aCBDdXJyZW50ID0gT24NCkRQX0RVQUxfTU9OSVRPUg0KRHVhbCBNb25pdG9yID0gT2ZmDQpEUF9N
QUlOU19TWU5DDQpNYWlucyBTeW5jID0gU2luZ2xlIEVkZ2UNCkRQX0ZBU1RfTU9ERQ0KRmFzdCBN
b2RlID0gT2ZmDQpEUF9DT05ERU5TRVJfUkVWRVJTRUQNCkNvbmRlbnNlciBSZXZlcnNlZCA9IE5v
DQpEUF9QRUxUSUVSDQpQZWx0aWVyID0gT2ZmDQpEUF9GSU5BTF9MRU5TDQpGaW5hbCBMZW5zID0g
MTUwMDogR2VtaW5pDQpEUF9EQ19TRU1fU1RBVEUNClNlbSBkcmlmdCBzdGF0dXMgPSBOb3QgQXZh
aWxhYmxlDQpEUF9JTUFHRV9TQVZFRA0KSW1hZ2Ugc2F2ZWQgPSBObw0KRFBfU1RFTV9BVVRPDQpT
VEVNIEF1dG8gPSBPZmYNCkRQX1NURU1fR0FJTg0KU1RFTSBHYWluID0gTG93DQpEUF9TVEVNX0ZB
U1QNClNURU0gRmFzdCA9IE5vDQpEUF9TVEVNX1EzDQpTVEVNIFEzID0gT2ZmDQpEUF9TVEVNX1Ey
DQpTVEVNIFEyID0gT2ZmDQpEUF9TVEVNX1ExDQpTVEVNIFExID0gTm9ybWFsDQpEUF9MQVJHRV9C
RUFNU0hJRlQNCkxhcmdlIEJlYW0gU2hpZnQgPSBPZmYNCkRQX1VTRVJfTEVWRUwNClVzZXIgTGV2
ZWwgPSBGdWxsDQpEUF9TQUZFX1NURU1fVkFMSUQNClNhZmUgU1RFTSBWYWxpZCA9IFllcw0KRFBf
UVVBVFRST19CQU5EV0lEVEgNCkJTRCBCYW5kd2lkdGggPSBEQw0KRFBfVVNFUl9BTElHTg0KVXNl
ciBBbGlnbiA9IE9uDQpEUF9DVVNUT01fSE9MREVSDQpDdXN0b20gSG9sZGVyID0gTm8NCkRQX0NP
TE9VUl9NT0RFDQpDb2xvdXIgTW9kZSA9IE9mZg0KRFBfUkVDSVBFDQpSZWNpcGUgPSBJZGxlDQpE
UF9TSV9OT0lTRV9SRURVQ1RJT04NClNtYXJ0SW1hZ2UgTm9pc2UgUmVkdWN0aW9uID0gT2ZmDQpE
UF9CU0RfRkFTVF9TQ0FODQpCU0QgRmFzdCBTY2FuID0gT2ZmDQpEUF9QRUxUSUVSX1BIT1RPDQpQ
ZWx0aWVyIFBob3RvID0gT2ZmDQpEUF9DT09MU1RBR0VfVFlQRQ0KQ29vbFN0YWdlIFR5cGUgPSBD
b2xkDQpEUF9TQ0RfQkFORFdJRFRIDQpTQ0QgQmFuZHdpZHRoID0gREMNCkRQX1NDRF9BVVRPDQpT
Q0QgQXV0byBSYW5nZSA9IE9mZg0KRFBfU0NEX0dBSU4NClNDRCBHYWluID0gTG93DQpEUF9PUFRJ
UFJPQkUNCk9wdGlQcm9iZSA9IE9mZg0KRFBfRklCX0NPTFVNTg0KRklCIENvbHVtbiA9IE5vbmUN
CkRQXzRRQlNEX1E1DQpRNSA9IE9mZg0KRFBfSkFaWl9HQUlODQpKYXp6IEdhaW4gPSBMb3cNCkRQ
X1BFTFRJRVJfVFlQRQ0KUGVsdGllciBUeXBlID0gRGViZW4NCkRQX0pBWlpfQkFORFdJRFRIDQpK
YXp6IEJhbmR3aWR0aCA9IExvdw0KRFBfQ0NfVFlQRQ0KQ0MgVHlwZSA9IE5vbmUNCkRQX0NDX09O
X0dJU19DSEFOTkVMDQpHSVMgQ2hhbm5lbCB3aXRoIENDID0gTm9uZQ0KRFBfUlVOVVBTVEFURQ0K
QmVhbSBTdGF0ZSA9IEJlYW0gT24NCkRQX09QRVJBVElOR19NT0RFDQpPcGVyYXRpbmcgTW9kZSA9
IE5vcm1hbA0KRFBfU0NBTlJBVEUNClNjYW4gU3BlZWQgPSA3DQpEUF9DQUxNT0RFDQpDYWwgTW9k
ZSA9IE9mZg0KRFBfU1RFTV9TRUdfTU9ERQ0KU1RFTSBTZWcuIE1vZGUgPSBPZmYNCkRQX1ZBQ1NU
QVRVUw0KVmFjIFN0YXR1cyA9IFJlYWR5DQpEUF9DT0xVTU5fQ0hBTUJFUl9WQUxWRQ0KQ29sdW1u
IENoYW1iZXIgdmFsdmUgPSBPcGVuDQpEUF9DT0xVTU5fUFVNUElORw0KQ29sdW1uIHB1bXBpbmcg
PSBSZWFkeQ0KRFBfTk9JU0VfUkVEVUNUSU9ODQpOb2lzZSBSZWR1Y3Rpb24gPSBGcmFtZSBJbnQu
IERvbmUNCkRQX0xFRlRfRlJPWkVODQpBbGwgRnJvemVuID0gWWVzDQpEUF9DQ19TVEFUVVMNCkND
IFN0YXR1cyA9IE9mZg0KRFBfT1VUX1RZUEUNCk91dHB1dCBUbyA9IERpc3BsYXkvRmlsZQ0KRFBf
VkFDX01PREUNClZhY3V1bSBNb2RlID0gVmFyaWFibGUgUHJlc3N1cmUNCkFQX0MzDQpDMyBMZW5z
IEkgPSAgMS4xMzIgQQ0KQVBfU1RBR0VBTkdMRQ0KU3RhZ2UgQW5nbGUgPSAxNzUuNyCwDQpBUF9T
Q0FOT1JUSE9HDQpTY2FuIE9ydGggY29ycm4gPSAgIDAuOSCwDQpBUF9TQ0FOUk9UQVRJT04NClNj
YW4gUm90YXRpb24gPSAxMjEuMCCwDQpBUF9XRA0KV0QgPSAgNC40IG1tDQpBUF9NQUcNCk1hZyA9
ICAgMi4yMSBLIFgNCkFQX01BR19DT01QX0FNUEwNCk1hZyBDb21wLiBBbXBsaXR1ZGUgPSAgMzcu
MCAlDQpBUF9CUklHSFRORVNTDQpCcmlnaHRuZXNzID0gIDQzLjMgJQ0KQVBfTUFOVUFMQ1VSUkVO
VA0KRmlsIEkgVGFyZ2V0ID0gIDIuMzcwIEENCkFQX01BTlVBTEtWDQpFSFQgVGFyZ2V0ID0gMjAu
MDAga1YNCkFQX1VTRVJNQVhDVVJSRU5UDQpGaWwgSSAoVXNlcm1heCkgPSAgNC4wMDAgQQ0KQVBf
SVBST0JFDQpJIFByb2JlID0gIDIwMC4wIG5BDQpBUF9FTUlTU0lPTlpPT00NCkVtaXNzaW9uIFpv
b20gPSAxMDAgICANCkFQX0ZSQU1FX1RJTUUNCkN5Y2xlIFRpbWUgPSAyMC4zIFNlY3MNCkFQX0xJ
TkVfVElNRQ0KTGluZSBUaW1lID0gMTMuMjEgbXMNCkFQX1RJTFRfQU5HTEUNClRpbHQgQW5nbGUg
PSAgIDAuMCCwDQpBUF9USUxUX0FYSVMNClRpbHQgQXhpcyA9ICA5MC4wILANCkFQX01BR19DT01Q
X09GRlNFVA0KTWFnIENvbXAuIE9mZnNldCA9IDUwOSAgIA0KQVBfU1RJR19YDQpTdGlnbWF0aW9u
IFggPSAgLTIuNSAlDQpBUF9BUEVSVFVSRVNJWkUNCkFwZXJ0dXJlIFNpemUgPSAxMjAuMCC1bQ0K
QVBfWk9PTVBPU19ZDQpab29tIFBvc24gWSA9IDE5MiAgIA0KQVBfWk9PTVBPU19YDQpab29tIFBv
c24gWCA9IDEyOCAgIA0KQVBfQkVBTVNISUZUX1kNCkJlYW0gU2hpZnQgWSA9ICAgMC4wICUNCkFQ
X0JFQU1TSElGVF9YDQpCZWFtIFNoaWZ0IFggPSAgIDAuMCAlDQpBUF9NQUdDQUxIRUlHSFQNCk1h
ZyBDYWwgQWN0dWFsIEhlaWdodCA9IDAuMDAgbm0NCkFQX01BR0NBTFdJRFRIDQpNYWcgQ2FsIEFj
dHVhbCBXaWR0aCA9IDAuMDAgbm0NCkFQX1JFRF9SQVNURVJfSA0KUmVkLlJhc3RlciBIZWlnaHQg
PSAyMzIgICANCkFQX1JFRF9SQVNURVJfVw0KUmVkLlJhc3RlciBXaWR0aCA9IDI1NiAgIA0KQVBf
UkVEX1JBU1RFUl9QT1NOX1kNClJlZC5SYXN0ZXIgUG9zbiBZID0gMjM1ICAgDQpBUF9SRURfUkFT
VEVSX1BPU05fWA0KUmVkLlJhc3RlciBQb3NuIFggPSAzODYgICANCkFQX0RVQUxfTUFHX09GRlNF
VF9ZDQpEdWFsIE1hZyBPZmZzZXQgWSA9IDAgICAgIA0KQVBfRFVBTF9NQUdfT0ZGU0VUX1gNCkR1
YWwgTWFnIE9mZnNldCBYID0gMCAgICAgDQpBUF9TUE9UX1BPU05fWQ0KU3BvdCBhdCBZID0gMTky
ICAgDQpBUF9TUE9UX1BPU05fWA0KU3BvdCBhdCBYID0gMjU2ICAgDQpBUF9aT09NX0ZBQ1RPUg0K
Wm9vbSBmYWN0b3IgPSAgMi4wMDANCkFQX1NUSUdfWQ0KU3RpZ21hdGlvbiBZID0gIC0wLjggJQ0K
QVBfUFBCXzMNClBiIDQgPSAgIDAuMCCwDQpBUF9QUEJfMg0KUGIgMyA9ICAgMC4wILANCkFQX1BQ
Ql8xDQpQYiAyID0gICAwLjAgsA0KQVBfUFBCXzANClBiIDEgPSAgIDAuMCCwDQpBUF9QUEFfMw0K
UGEgNCA9IDAuMDAgbm0NCkFQX1BQQV8yDQpQYSAzID0gMC4wMCBubQ0KQVBfUFBBXzENClBhIDIg
PSAwLjAwIG5tDQpBUF9QUEFfMA0KUGEgMSA9IDAuMDAgbm0NCkFQX1JBRElBTF8zDQpEYSA0ID0g
MC4wMCBubQ0KQVBfUkFESUFMXzINCkRhIDMgPSAwLjAwIG5tDQpBUF9SQURJQUxfMQ0KRGEgMiA9
IDAuMDAgbm0NCkFQX1JBRElBTF8wDQpEYSAxID0gMC4wMCBubQ0KQVBfQU5HVUxBUl8xDQpBYSAy
ID0gICAwLjAgsA0KQVBfQU5HVUxBUl8wDQpBYSAxID0gICAwLjAgsA0KQVBfU1RBR0VfRklFTERT
X1kNClN0YWdlIGZpZWxkcyBZID0gMSAgICAgDQpBUF9TVEFHRV9GSUVMRFNfWA0KU3RhZ2UgZmll
bGRzIFggPSAxICAgICANCkFQX1NUQUdFX1NDQU5fQU5HTEUNClN0YWdlIHNjYW4gYW5nbGUgPSAg
IDAuMCCwDQpBUF9TVEFHRV9WRUNUT1JfWg0KU3RhZ2UgdmVjdG9yIFogPSAgIDAuMCAlDQpBUF9T
VEFHRV9WRUNUT1JfWQ0KU3RhZ2UgdmVjdG9yIFkgPSAgIDAuMCAlDQpBUF9TVEFHRV9WRUNUT1Jf
WA0KU3RhZ2UgdmVjdG9yIFggPSAgIDAuMCAlDQpBUF9TVEFHRV9HT1RPX1oNClN0YWdlIGdvdG8g
WiA9IDQ0LjUyOCBtbQ0KQVBfU1RBR0VfR09UT19ZDQpTdGFnZSBnb3RvIFkgPSA4NC45MzMgbW0N
CkFQX1NUQUdFX0dPVE9fWA0KU3RhZ2UgZ290byBYID0gNjEuODk1IG1tDQpBUF9QUk9GSUxFX1cN
ClByb2ZpbGUgd2lkdGggPSAwLjAwIG5tDQpBUF9FSFRfU0VUX01BWA0KRUhUIHNldCBtYXhpbXVt
ID0gMzAuMDAga1YNCkFQX1BJWEVMX1NJWkUNClBpeGVsIFNpemUgPSA1MC40OCBubQ0KQVBfQ09M
VU1OX1ZBQw0KR3VuIFZhY3V1bSA9IDUuMzZlLTAwOSBtYmFyDQpBUF9TWVNURU1fVkFDDQpTeXN0
ZW0gVmFjdXVtID0gNC4yNmUtMDA0IG1iYXINCkFQX1NUQUdFX0xPV19aDQpTdGFnZSBsb3cgWiA9
ICAwLjAwMCBtbQ0KQVBfU1RBR0VfTE9XX1kNClN0YWdlIGxvdyBZID0gIDAuMDAwIG1tDQpBUF9T
VEFHRV9MT1dfWA0KU3RhZ2UgbG93IFggPSAgMC4wMDAgbW0NCkFQX1NUQUdFX0hJR0hfWg0KU3Rh
Z2UgaGlnaCBaID0gNTAuMDAwIG1tDQpBUF9TVEFHRV9ISUdIX1kNClN0YWdlIGhpZ2ggWSA9IDEz
MC4wMDAgbW0NCkFQX1NUQUdFX0hJR0hfWA0KU3RhZ2UgaGlnaCBYID0gMTMwLjAwMCBtbQ0KQVBf
U1RBR0VfQVRfRklFTERfWQ0KU3RhZ2UgYXQgZmllbGQgWSA9IDEgICAgIA0KQVBfU1RBR0VfQVRf
RklFTERfWA0KU3RhZ2UgYXQgZmllbGQgWCA9IDEgICAgIA0KQVBfU1RBR0VfR09UT19GSUVMRF9Z
DQpTdGFnZSBnb3RvIGZpZWxkIFkgPSAxICAgICANCkFQX1NUQUdFX0dPVE9fRklFTERfWA0KU3Rh
Z2UgZ290byBmaWVsZCBYID0gMSAgICAgDQpBUF9TVEFHRV9GSUVMRF9TSVpFX1kNClN0YWdlIGZp
ZWxkIHNpemUgWSA9ICAwLjAwMCBtbQ0KQVBfU1RBR0VfRklFTERfU0laRV9YDQpTdGFnZSBmaWVs
ZCBzaXplIFggPSAgMC4wMDAgbW0NCkFQX0NPTlRSQVNUDQpDb250cmFzdCA9ICAxNS44ICUNCkFQ
X09GRlNFVA0KT2Zmc2V0IEEgPSAgIDAuMCAlDQpBUF9HQUlODQpHYWluIEEgPSAxMDAuMCAlDQpB
UF9HQU1NQQ0KR2FtbWEgPSAgMS4wMDANCkFQX0xJTkVfSU5UX0NPVU5UDQpMaW5lIGludC4gY291
bnQgPSAxICAgICANCkFQX0ZSQU1FX0lOVF9DT1VOVA0KRnJhbWVzIHRvIEludC4gPSAwICAgICAN
CkFQX0ZSQU1FX0FWRVJBR0VfQ09VTlQNCkZyYW1lcyB0byBhdmVyYWdlID0gMSAgICAgDQpBUF9L
Mg0KTWl4IFNpZ25hbCA9IDAuMDAwMA0KQVBfSzENClNpZ25hbCA9ICAxLjAwMA0KQVBfU0NNDQpT
cGVjaW1lbiBJID0gICAgICAwIGZBDQpBUF9NQUcxDQpNYWcgWjEgPSAgMS4wMDANCkFQX01BRzAN
Ck1hZyBaMCA9ICAxLjAwMA0KQVBfQ09MTEVDVE9SX0JJQVMNCkNvbGxlY3RvciBCaWFzID0gICAg
IDAgVg0KQVBfQVVUT19DT05UUkFTVA0KQXV0byBDIFRhcmdldCA9ICA1MC4wICUNCkFQX0FVVE9f
QlJJR0hUDQpBdXRvIEIgVGFyZ2V0ID0gMTAwLjAgJQ0KQVBfRlJBTUVfQU1QTA0KRnJhbWUgQW1w
bCBDYWwuID0gMCAgICAgDQpBUF9JTVBMSUVEX09GRlNFVA0KT2Zmc2V0IEIgPSAgIDAuMCAlDQpB
UF9JTVBMSUVEX0dBSU4NCkdhaW4gQiA9IDEwMC4wICUNCkFQX0ZJTEFNRU5UX0FHRQ0KRmlsYW1l
bnQgQWdlID0gMTAyNC44NSBIb3Vycw0KQVBfQkVBTV9PRkZTRVRfWQ0KQmVhbSBPZmZzZXQgWSA9
IDAuMDAgbm0NCkFQX0JFQU1fT0ZGU0VUX1gNCkJlYW0gT2Zmc2V0IFggPSAwLjAwIG5tDQpBUF9I
RUlHSFQNCkhlaWdodCA9IDM4Ljc3ILVtDQpBUF9XSURUSA0KV2lkdGggPSA1MS42OSC1bQ0KQVBf
RFVBTF9NQUdfWV9TTE9QRQ0KRHVhbCBNYWcgR2FpbiBZID0gNjcwLjAwDQpBUF9BTElBU19XRA0K
Rm9jdXMgPSAgNC40IG1tDQpBUF9EVUFMX01BR19TTE9QRQ0KRHVhbCBNYWcgR2FpbiBYID0gNjcw
ICAgDQpBUF9NSU5NQUcNCk1pbiBNYWcgPSAgICAgNDMgWA0KQVBfTlJfQ09FRkYNCk4gPSAxICAg
ICANCkFQX0xJTkVfQVZFUkFHRV9DT1VOVA0KTGluZSBBdmcuQ291bnQgPSA2MCAgICANCkFQX1BI
T1RPX05VTUJFUg0KUGhvdG8gTm8uID0gNjE2ICAgDQpBUF9TQ0FOX09GRlNFVF9ZDQpTY2FuIFkg
Y2FsLiA9IDAgICAgIA0KQVBfU0NBTl9PRkZTRVRfWA0KU2NhbiBYIGNhbC4gPSAwICAgICANCkFQ
X0ZJRUxEX09WRVJMQVANCkZpZWxkIE92ZXJsYXAgPSAgIDAuMCAlDQpBUF9NSU5fV0QNCkZvY3Vz
IHNjYW4gbWluID0gICAgMSBtbQ0KQVBfTUFYX1dEDQpGb2N1cyBzY2FuIG1heCA9ICAgNDAgbW0N
CkFQX0FSRUFfRlJBQ1RJT04NCkFyZWEgRnJhY3Rpb24gPSAgIDAuMCAlDQpBUF9XSElURV9ERVRF
Q1QNCldoaXRlIFRocmVzaG9sZCA9IDEwMC4wICUNCkFQX0JMQUNLX0RFVEVDVA0KQmxhY2sgVGhy
ZXNob2xkID0gICAwLjAgJQ0KQVBfRUhUX1NFVF9NSU4NCkVIVCBTZXQgbWluaW11bSA9ICAwLjAx
IGtWDQpBUF9NQUdfU0hJRlRfWQ0KTWFnIFNoaWZ0IENhbCBZID0gMCAgICAgDQpBUF9NQUdfU0hJ
RlRfWA0KTWFnIFNoaWZ0IENhbCBYID0gMCAgICAgDQpBUF9TVEFHRV9WRUNUT1JfVA0KU3RhZ2Ug
dmVjdG9yIFQgPSAgIDAuMCAlDQpBUF9TVEFHRV9WRUNUT1JfUg0KU3RhZ2UgdmVjdG9yIFIgPSAg
IDAuMCAlDQpBUF9TVEFHRV9HT1RPX1QNClN0YWdlIGdvdG8gVCA9ICAgMC4wILANCkFQX1NUQUdF
X0dPVE9fUg0KU3RhZ2UgZ290byBSID0gIDM1LjcgsA0KQVBfQkVBTV9USU1FDQpCZWFtIFRpbWUg
PSAyMjEuNjkgSG91cnMNCkFQX1NQT1QNClNwb3Qgc2lnbmFsID0gMCAgICAgDQpBUF9BQ1RVQUxF
WFQNCkV4dHJhY3RvciBWID0gIDQuMjUga1YNCkFQX0hDU1RBR0VfVEVNUA0KUGVsdGllciBUZW1w
ID0gIDIwLjAgsEMNCkFQX1NUQUdFX0xPV19UDQpTdGFnZSBsb3cgVCA9ICAtNC4wILANCkFQX1NU
QUdFX0hJR0hfVA0KU3RhZ2UgaGlnaCBUID0gIDcwLjAgsA0KQVBfTk9NSU5BTEZJTA0KTm9taW5h
bCBGaWwgSSA9ICAyLjM3MCBBDQpBUF9OT01JTkFMRVhUDQpOb21pbmFsIGV4dHJhY3RvciBWID0g
IDQuMjUga1YNCkFQX0VYVENVUlJFTlQNCkV4dHJhY3RvciBJID0gMTE3LjcwILVBDQpBUF9BQ1RV
QUxMRU5TDQpMaW5lciBUdWJlID0gIDAuMDAga1YNCkFQX0FDVFVBTFNVUFANClN1cHByZXNzb3Ig
ViA9ICAgMzAwIFYNCkFQX01BTlVBTEVYVA0KRXh0cmFjdG9yIFYgVGFyZ2V0ID0gIDQuMjUga1YN
CkFQX1RFU1RfVkFMDQpUZXN0IFZhbCA9IDAuMDAwMA0KQVBfVEVTVF9ODQpUZXN0IE5vLiA9IDAg
ICAgIA0KQVBfR1VOX1kNCkd1biBhdCBZID0gLTMwLjAgJQ0KQVBfR1VOX1gNCkd1biBhdCBYID0g
LTM1LjAgJQ0KQVBfQVBFUlRVUkVfWQ0KQXBlcnR1cmUgYXQgWSA9ICAzMC4wICUNCkFQX0FQRVJU
VVJFX1gNCkFwZXJ0dXJlIGF0IFggPSAgNDUuMCAlDQpBUF9BUEVSVFVSRV9BTElHTl9ZDQpBcGVy
dHVyZSBBbGlnbiBZID0gICA3LjAgJQ0KQVBfQVBFUlRVUkVfQUxJR05fWA0KQXBlcnR1cmUgQWxp
Z24gWCA9ICAgMS44ICUNCkFQX0dVTkFMSUdOX1kNCkd1biBBbGlnbiBZID0gICAwLjAgJQ0KQVBf
R1VOQUxJR05fWA0KR3VuIEFsaWduIFggPSAgIDAuMCAlDQpBUF9DSEFNQkVSX1BSRVNTVVJFDQpD
aGFtYmVyID0gICAgIDQwIFBhDQpBUF9IUF9UQVJHRVQNClZQIFRhcmdldCA9ICAgICA0MCBQYQ0K
QVBfU1RBR0VfR09UT19NDQpTdGFnZSBnb3RvIE0gPSAgMC4wMDAgbW0NCkFQX01BWF9FWFRSQUNU
T1JfVg0KTWF4IEV4dHJhY3RvciBWID0gIDQuOTQga1YNCkFQX0VIVF9DQUxfMzBLVg0KRUhUIENh
bEAzMEtWID0gMzAuMDkga1YNCkFQX0VIVF9DQUxfMjRLVg0KRUhUIENhbEAyNEtWID0gMjQuMDcg
a1YNCkFQX0VIVF9DQUxfMTBLVg0KRUhUIENhbEAxMEtWID0gMTAuMDQga1YNCkFQX0VIVF9DQUxf
MTAwDQpFSFQgQ2FsQDAuMUtWID0gICAxMDggVg0KQVBfQ1VSU09SX0hFSUdIVA0KQ3Vyc29yIEhl
aWdodCA9IDAuMDAgbm0NCkFQX0NVUlNPUl9XSURUSA0KQ3Vyc29yIFdpZHRoID0gMC4wMCBubQ0K
QVBfUFJPRklMRV9UT1ANClByb2ZpbGUgVG9wID0gMzAwICAgDQpBUF9NSU5fRVhUDQpNaW4gRXh0
cmFjdG9yIFYgPSAgMy4wMCBrVg0KQVBfTUFOVUFMTEVOUw0KTGluZXIgVGFyZ2V0ID0gIDAuMDAg
a1YNCkFQX1BQQV81DQpQYSA2ID0gMC4wMCBubQ0KQVBfUFBBXzQNClBhIDUgPSAwLjAwIG5tDQpB
UF9QUk9GSUxFX1cyDQpQcm9maWxlIFdpZHRoIDIgPSAwLjAwIG5tDQpBUF9QUk9GSUxFX1cxDQpQ
cm9maWxlIFdpZHRoIDEgPSAwLjAwIG5tDQpBUF9NQUdfR0FJTl9ZDQpNYWcgR2FpbiBDYWwgWSA9
IDc2MCAgIA0KQVBfTUFHX0dBSU5fWA0KTWFnIEdhaW4gQ2FsIFggPSA3NTAgICANCkFQX1NUQUdF
X1ZFQ1RPUl9NDQpTdGFnZSBWZWN0b3IgTSA9ICAgMC4wICUNCkFQX1NUQUdFX0hJR0hfTQ0KU3Rh
Z2UgaGlnaCBNID0gIDAuMDAwIG1tDQpBUF9TVEFHRV9MT1dfTQ0KU3RhZ2UgbG93IE0gPSAgMC4w
MDAgbW0NCkFQX0hfNQ0KSCA2ID0gMC4wMCBubQ0KQVBfSF80DQpIIDUgPSAwLjAwIG5tDQpBUF9I
XzMNCkggNCA9IDAuMDAgbm0NCkFQX0hfMg0KSCAzID0gMC4wMCBubQ0KQVBfSF8xDQpIIDIgPSAw
LjAwIG5tDQpBUF9IXzANCkggMSA9IDAuMDAgbm0NCkFQX1BQQl82DQpQYiA3ID0gICAwLjAgsA0K
QVBfUFBCXzUNClBiIDYgPSAgIDAuMCCwDQpBUF9QUEJfNA0KUGIgNSA9ICAgMC4wILANCkFQX1BQ
QV85DQpQYSAxMCA9IDAuMDAgbm0NCkFQX1BQQV84DQpQYSA5ID0gMC4wMCBubQ0KQVBfUFBBXzcN
ClBhIDggPSAwLjAwIG5tDQpBUF9QUEFfNg0KUGEgNyA9IDAuMDAgbm0NCkFQX1dBVEVSX1RFTVAN
CkVPIFRlbXAgPSAgMjEuOSCwQw0KQVBfRkNGX1NFVFRJTkcNCkZDRiBTZXR0aW5nID0gICAwLjAg
JQ0KQVBfVl85DQpWIDEwID0gMC4wMCBubQ0KQVBfVl84DQpWIDkgPSAwLjAwIG5tDQpBUF9WXzcN
ClYgOCA9IDAuMDAgbm0NCkFQX1ZfNg0KViA3ID0gMC4wMCBubQ0KQVBfVl81DQpWIDYgPSAwLjAw
IG5tDQpBUF9WXzQNClYgNSA9IDAuMDAgbm0NCkFQX1ZfMw0KViA0ID0gMC4wMCBubQ0KQVBfVl8y
DQpWIDMgPSAwLjAwIG5tDQpBUF9WXzENClYgMiA9IDAuMDAgbm0NCkFQX1ZfMA0KViAxID0gMC4w
MCBubQ0KQVBfSF85DQpIIDEwID0gMC4wMCBubQ0KQVBfSF84DQpIIDkgPSAwLjAwIG5tDQpBUF9I
XzcNCkggOCA9IDAuMDAgbm0NCkFQX0hfNg0KSCA3ID0gMC4wMCBubQ0KQVBfU1RBR0VfREVMVEFf
TQ0KU3RhZ2UgRGVsdGEgTSA9ICAwLjAwMCBtbQ0KQVBfU1RBR0VfREVMVEFfUg0KU3RhZ2UgRGVs
dGEgUiA9ICAgMC4wILANCkFQX1NUQUdFX0RFTFRBX1QNClN0YWdlIERlbHRhIFQgPSAgIDAuMCCw
DQpBUF9TVEFHRV9ERUxUQV9aDQpTdGFnZSBEZWx0YSBaID0gIDUuMDAwIG1tDQpBUF9TVEFHRV9E
RUxUQV9ZDQpTdGFnZSBEZWx0YSBZID0gIDAuMDAwIG1tDQpBUF9TVEFHRV9ERUxUQV9YDQpTdGFn
ZSBEZWx0YSBYID0gIDAuMDAwIG1tDQpBUF9TUEFDRVJfVEhJQ0tORVNTDQpTcGFjZXIgVGhpY2tu
ZXNzID0gIDAuMDAwIG1tDQpBUF9TVEFHRV9DRU5UUkVfWQ0KU3RhZ2UgQ2VudHJlIFkgPSA2NC44
ODUgbW0NCkFQX1NUQUdFX0NFTlRSRV9YDQpTdGFnZSBDZW50cmUgWCA9IDYzLjEzNiBtbQ0KQVBf
U0FNUExFX0hFSUdIVA0KQ29tcHUuIEhlaWdodCA9ICAwLjAwMCBtbQ0KQVBfV0FURVJfVEVNUF9M
SU1JVA0KRU8gVGVtcCBMaW1pdCA9ICAzNS4wILBDDQpBUF9JTUFHRV9QSVhFTF9TSVpFDQpJbWFn
ZSBQaXhlbCBTaXplID0gMjUuMjQgbm0NCkFQX1JBRElBTF9BUkVBXzENCkRiIDIgPSAgICAgMC4g
bm2yDQpBUF9SQURJQUxfQVJFQV8wDQpEYiAxID0gICAgIDAuIG5tsg0KQVBfVVNFUl9NQVhfRUhU
DQpVc2VyIE1heCBFSFQgPSAzMC4wMCBrVg0KQVBfUFJPRjJfWDINClByb2ZpbGUgMiBYMiA9IDAg
ICAgIA0KQVBfUFJPRjJfWDENClByb2ZpbGUgMiBYMSA9IDAgICAgIA0KQVBfUFJPRjFfWDINClBy
b2ZpbGUgMSBYMiA9IDAgICAgIA0KQVBfUFJPRjFfWDENClByb2ZpbGUgMSBYMSA9IDAgICAgIA0K
QVBfU1BPVF9YX0NBTA0KU3BvdCBYIENhbCA9IDAgDQpBUF9DQ0RfSUxMVU1JTkFUSU9ODQpDQ0Qg
SWxsdW0uID0gIDQzLjAgJQ0KQVBfUkFESUFMX0FSRUFfMw0KRGIgNCA9ICAgICAwLiBubbINCkFQ
X1JBRElBTF9BUkVBXzINCkRiIDMgPSAgICAgMC4gbm2yDQpBUF9QUklOVF9OVU1CRVINClByaW50
IE5vLiA9IDAgICAgICAgDQpBUF9GSUxFX05VTUJFUg0KRmlsZSBObyA9IDYwMSAgICAgDQpBUF9T
UEVDSU1FTl9IRUlHSFQNClNwZWNpbWVuIEhlaWdodCA9ICAgIDQgbW0NCkFQX0NPTVBVX1RJTFRf
RVJST1INCkNvbXB1LiBUaWx0IEVycm9yID0gMC4wMDAwDQpBUF9FU0RfRVhDSVRBVElPTg0KRVNE
IEV4Y2l0YXRpb24gPSAgIDAuMCAlDQpBUF9FU0RfTE9XRVJfWQ0KRVNEIExvd2VyIFkgPSAgIDAu
MCAlDQpBUF9FU0RfTE9XRVJfWA0KRVNEIExvd2VyIFggPSAgIDAuMCAlDQpBUF9FU0RfVVBQRVJf
WQ0KRVNEIFVwcGVyIFkgPSAgIDAuMCAlDQpBUF9FU0RfVVBQRVJfWA0KRVNEIFVwcGVyIFggPSAg
IDAuMCAlDQpBUF9TVEFHRV9MT1dfUg0KU3RhZ2UgbG93IFIgPSAtMzgwLjAgsA0KQVBfU1RBR0Vf
SElHSF9SDQpTdGFnZSBoaWdoIFIgPSAzODAuMCCwDQpBUF9TVElHX0NBTF9ZDQpTdGlnLiBDYWwg
WSA9ICAgMC4wICUNCkFQX1NUSUdfQ0FMX1gNClN0aWcuIENhbCBYID0gICAwLjAgJQ0KQVBfRlJB
TUVfQ09VTlRFUg0KRnJhbWUgQ291bnRlciA9IDQyMDgzIA0KQVBfUEVMVElFUl9UQVJHRVQNClBl
bHRpZXIgVGFyZ2V0ID0gIDIwLjAgsEMNCkFQX1NFTV9MRVZFTF9BVF9USUxUDQpTRU0gTGV2ZWwg
QCA9ICAgMC4wILANCkFQX0RDX01BWF9BVFRFTVBUUw0KRHJpZnQgTWF4IFRyaWVzID0gMTANCkFQ
X0RDX01JTl9DT05GDQpEcmlmdCBNaW4gQ29uZiA9ICA1MC4wICUNCkFQX0RDX01BWF9QSVhfRVJS
T1INCkRyaWZ0IE1heC5QaXguRXJyb3IgPSAxICAgICANCkFQX1ZBQ19SRUFEWV9BVA0KVmFjIFJl
YWR5IEAgPSAyLjAwZS0wMDUgbWJhcg0KQVBfTElORV9DT1VOVEVSDQpMaW5lIENvdW50ZXIgPSAx
NTM2ICANCkFQX0NPTlRSQVNUWjENCkNvbnRyYXN0IEIgPSAgMjEuMiAlDQpBUF9DT05UUkFTVFow
DQpDb250cmFzdCBBID0gIDE1LjggJQ0KQVBfQlJJR0hUTkVTU1oxDQpCcmlnaHRuZXNzIEIgPSAg
NDkuNyAlDQpBUF9CUklHSFRORVNTWjANCkJyaWdodG5lc3MgQSA9ICA0My4zICUNCkFQX0RFRkVD
VF9JRA0KRGVmZWN0IElEID0gMCAgICAgICANCkFQX0hPTERFUl9IRUlHSFQNCkhvbGRlciBIZWln
aHQgPSAxNi4yMDAgbW0NCkFQX0hPTERFUl9MRU5HVEgNCkhvbGRlciBMZW5ndGggPSAyMC4wMDAg
bW0NCkFQX0hPTERFUl9XSURUSA0KSG9sZGVyIFdpZHRoID0gMjAuMDAwIG1tDQpBUF9IT0xERVJf
RElBTUVURVINCkhvbGRlciBEaWFtZXRlciA9IDUwLjAwMCBtbQ0KQVBfU0lfRkFDVE9SDQpTbWFy
dEltYWdlIFNoYXJwZW5pbmcgPSAgIDAuMCAlDQpBUF9TSV9USFJFU0hPTEQNClNtYXJ0SW1hZ2Ug
VGhyZXNob2xkID0gICAwLjAgJQ0KQVBfU0lfRU5IQU5DRU1FTlQNClNtYXJ0SW1hZ2UgQ29udHJh
c3QgPSAgIDAuMCAlDQpBUF9DT01QVV9USUxUX09GRlNFVA0KQ29tcHUuIFRpbHQgT2Zmc2V0ID0g
IDAuMDAwIG1tDQpBUF9MQVNFUl9GSU5ERVJfSUxMVU0NCkxhc2VyIElsbHVtaW5hdGlvbiA9ICAg
MC4wICUNCkFQX0xJTkVSX0NBTF9BVF8xMEtWDQpMaW5lciBDYWwgQCAxMEtWID0gIDk5MDYgVg0K
QVBfTElORVJfQ0FMX0FUXzEwMFYNCkxpbmVyIGNhbCBAIDEwMFYgPSAgICA5OSBWDQpBUF9TSV9U
T1BPR1JBUEhZDQpTbWFydEltYWdlIFRvcG9ncmFwaHkgPSAgIDAuMCAlDQpBUF9TUEVDSU1FTl9E
SUFNRVRFUg0KU3BlY2ltZW4gRGlhbWV0ZXIgPSAgIDEwIG1tDQpBUF9DQ19QUkVTU1VSRQ0KQ0Mg
UHJlc3N1cmUgPSAgIDAuMCAlDQpBUF9QSVJBTklfUFJFU1NVUkUNClBpcmFuaSBQcmVzc3VyZSA9
IDMuOThlLTAwMSBtYmFyDQpBUF9KQVpaX0JBQ0tfR1JJRA0KQmFjayBHcmlkID0gICAgIDAgVg0K
QVBfSkFaWl9GUk9OVF9HUklEDQpGcm9udCBHcmlkID0gICAgIDAgVg0KQVBfU1RBR0VfQVRfWg0K
U3RhZ2UgYXQgWiA9IDQxLjgwNyBtbQ0KQVBfU1RBR0VfQVRfWQ0KU3RhZ2UgYXQgWSA9IDg0Ljkz
OTIgbW0NCkFQX1NUQUdFX0FUX1gNClN0YWdlIGF0IFggPSA2MS44OTk5IG1tDQpBUF9TQU1QTEVf
QVRfWQ0KU2FtcGxlIGF0IFkgPSAwLjAwMDANCkFQX1NBTVBMRV9BVF9YDQpTYW1wbGUgYXQgWCA9
IDAuMDAwMA0KQVBfU1RBR0VfQVRfVA0KU3RhZ2UgYXQgVCA9ICAgMC4wILANCkFQX1NUQUdFX0FU
X1INClN0YWdlIGF0IFIgPSAgMzUuNyCwDQpBUF9BQ1RVQUxDVVJSRU5UDQpGaWwgSSA9ICAyLjM3
MCBBDQpBUF9BQ1RVQUxLVg0KRUhUID0gMjAuMDAga1YNCkFQX1NUQUdFX0FUX00NClN0YWdlIGF0
IE0gPSAgMC4wMDAgbW0NCkFQX0RBVEUNCkRhdGUgOjE5IE9jdCAyMDEwDQpBUF9USU1FDQpUaW1l
IDoxNzoyNzoxOA0KU1ZfU0FNUExFX0lEDQpTYW1wbGUgSUQgPSANClNWX0lNQUdFX1BBVEgNCklt
YWdlcyA9IEM6XERvY3VtZW50cyBhbmQgU2V0dGluZ3NcQWRtaW5pc3RyYXRvclxNeSBEb2N1bWVu
dHNcTXkgUGljdHVyZXNcDQpTVl9WRVJTSU9ODQpWZXJzaW9uID0gVjA1LjA0LjAzLjAwIDogMTYt
QXByLTEwDQpTVl9TRVJJQUxfTlVNQkVSDQpTZXJpYWwgTm8uID0gU1VQUkEgNTVWUC0zMi0yNg0K
U1ZfVVNFUl9URVhUDQpVc2VyIFRleHQgPSANClNWX09QRVJBVE9SDQpPcGVyYXRvciA9IA0KU1Zf
VVNFUl9OQU1FDQpVc2VyIE5hbWUgPSBTRVJWSUNFDQpTVl9GSUxFX05BTUUNCkZpbGUgTmFtZSA9
IHRlc3QgU1RFTTIzOS50aWYNCgAyMjU1NTUyMzEwMTI1MTAvMTEyMTUxMjUyLjAwMjAuLjAyMjIs
LjExMC4xMzIyMDAyMjEzMjAvLy8zMDIyNDUyMDEyMTM0MDAwMTQzMTM1NTI1MjQ1NTExNTMzMDM1
MjQ1NTAwMDAvMjMyMjQ1MjE0NDQ0LzM3My8sMDQzMCwxMy81NDUzMi8xNDUxMDAwMDM1Mi8wMjUx
MTEwLi8xMjIvMTI1MTEwMS8xMjI0MS8uMDAwMTI0NDMyMTExMjAxMC8wMzEvLDIwLjMvMTIxNDAw
MzIyMTIuNDQ0MDA1MTI0LywvLzAyMzIxMjUwMTI0MzUxMzAwNDQyMjEzMzM1NTEyMDQxLDEvMDAx
MzAwMTM0LzAzMzEzNDUxMTMuLzI0NTEvMTMzMzQ1NS8vMDEyMTEyMC4wMDEyNDU1NTIvMjQyMjU4
MDUzNDUzNTMyNzUxNDMuMDMyMTIzMjQ0MzEzNTEsLy81NDQxNDQyMjMuMDU0NTU0MjM0NDAzMzIy
NDU0MzMyMC4zMzM1MjQzMjQxMDEvLzI0NTA1NS8zMjIwNTc1MzUzNTU1NTc1MzQzNDMzMjM0NDIz
NDM0MTQ0MjI4NTUyMzQ1OTk0LzAyMTUyMzIyMzQ0NTUzNDEzMzU1NTU1NDQvLzQyMzMzMTE0NTQx
NDMxMjU1NTMxMjc5NDEzMDIzMjU1NDIzNTIzMzQyNDU0NTEzNDExMjExMjA0NDMzNTUzNzk1Nzg1
NDMxNDUzNDM0NDgzMDAxMzIxMzUyMTIzNDEzMzQ1MzEyNDUxNDIzMjEvMTQ1NDMyNTUyMzUzNTc1
MzExNDM3NTI3NS4xNTEvMDM3NTo1NTQ0ODkyMjI1NTc1MTE0NTEwNTM1NzQ0MzQ0NTQxMDQzMjUx
MjM1NDQ1NTIyMjIwMzU1NTU1MzUzNTAyMjQ1NDM1NDc1NDU0NTQ3NTU0NTU1NTUyMjQ0NTI3NTMz
NTUwMTAwNTc0NTUzMzU6My81NTU3MzAyNTQ1NDU1NTQzMzQ0ODQ1NDMzNTQ1NTQ0NTQ0NTU4OTQ1
MTQ5NDUyNTMzMjU1NTM1NDg1NzU3OjoyLzAzNDU1NTM0NDQ1NTc1MDAyNTU1NTM4OTM1NzU4OjUz
NTM7OzszMjM1NzU4NTc1MzUzMzU4NDQxMzUzMjM0NTQ1NTU4ODU1NTU0NDEzODMzMzQ3NTUzNTQ0
NTU1NTU1NTg3Nzo9OTU1Nzc0NTg0NTMzMzU1ODc3NTU1NTQzNDU5Nzo4OTg1Nzc1Nzw1ODo5NTg3
NTU4NTg4Nzw9OTU6NzU1Nzc3OjU1Nzo8Ojg4ODU4Ozk7NzU5NTU4NzU4Ojc5ODU4OTs4NTU3Nzk5
ODU5OTQ4OjU0ODg0NT01NTU3Nzc3NTk6ODU4OTM1Nzg1NTU3NTU1MjU1ODc0NTg1NTg1NTg0Nzk1
NzM3OTQzNzI1Nzg3Nzg7NTo5OTM3OTk3Nzc5Ojg1NTc1MzM3ODg1MzU3NzU4ODU1NTU3OTU3NTM1
NTk1MjU1MjI1Ojg4NzU5ODg1Nzc4Nzc0NDU6ODk1NTc3Nzk1NzM1MzQ1NTc4Nzs5Nzc3OTU1Nzk5
NDU0NTM0NTA0Mzc7MzMyMjU5NTg3NTQzMzM1Nzc4ODU1NTU3Ozk1ODUzNzQ1OTM1ODczNTU1NTc1
NTU1NTU5OTc1ODo5ODczNzQ1Mjc3NTc4NTU3NTU5ODg3ODo6NTM4NzU6ODcyNzg1NTs5Nzk5OTg1
ODg5OTU1Nzc1Nzc0NTU4NTM1ODk1NDU1NTQ3ODUzNTc0NTQ1Nzg3NTU1NzU1NTg3NTc3NzQ1NTk4
NDI0Nzc0NDEyNDU1NTQyNDI0MzEzMzM0MzMzNTQ3NTMwNTUxMzQ4ODU1NTQ0MzQ1MjQzNTUzNDU1
NTg5OTU0NTU1NTU3NDg3NDc5Ozk4NDU0NDM0NTk3NTg1NTU4NzU3NzU1NTk1NTk5NTg4NDU5NTg1
Nzc3OTUzNTU1ODc7ODU1Mzg4NTU1NDo6ODU0OTc4NTc4OzU1Ozw5NTU5Nzo5ODk5Nzg7OTo3Ojo9
PDo4NzU1OTo8Ojw7OTo8ODw5ODs8PDo4ODw7Nzs6ODs5Oz49Ozg6PTxBOzs8PTo5ODo6PTw5Nzo5
Nzo6Ojk7Ozs7PDo5OTk6Ojs3PD47Ojg3ODg7Ozg5QDs9Ozw7Ojk5Pjw6Ozo9PTw8ODo5ODU3PDo3
NzU1OD06NT08Oz47PDo4ODk6Oz49PT4+OD0+Ojs7Pjw4ODw3PD49Ojk6OT09PDo4Ojo6Pj45ODU4
ODw+Ozg3OTw6Ozw7ODc1Nzs8ODs7NDU3ODk6Nzw6ODk4OTU4ODg4Ojg1ODk6OTU5Ojg6Ojo5ODk7
Ojk5Ozk7NTk5Nzk9PD06Ojo8Ojg6Ozo7Nzw7OTs5Ozo5NTs8Pjw5PD4+PTs+PTo9Ozk1Nzk4OzU4
Ozw6Nzc6PT44Nzw6Ozo9Ozs8OTs8Pj05PDs4OT47Ojk6OTs5PDw9Ojk8PT05Pjo4Ojg4Ozs+PT5A
Oz1APTw6OzxBPjw6Pj05Ojs5PDw+Pjw7OjU5OT4+Oz09Ojw+Pj07ODs8Oz4+PEA+Ozk3Nzc9Pjo8
PD04Ojs+PTo5Oz4+Ojk+PTw5Nzg4Nz05Ozw4Pj49QDw7OTo8PTo6NTc3PT09Ojo5OTg7Ojs5PDs5
ODs6Ozk+PT07OTo9Ojg8Oj49Nzg6OTw7Nzk6Ojg+PTo6PDk7PDk6PT47PDo8O0A8Nzo9Oj08PD05
ODs5OTs7PDQ1PD45ODk5OzUxMjQxNTMyMTIyLzAwMTU1NDEyLy8xMjAvNTEzMzI5NTMzNTQxMzIz
MzIzMDAvMTI0ODUyNTUwNDQuLDIyMzI0NC8xMDAvLzMzMTI0My4yMjIyMTEzNDQyLzIyNDAwMTEy
LzAzMjQzMDQxMDIzMi4qLzAyMjQzMDQ1NTU0NDUxMzUyLjUxLDExMi8sLjAyMDI0MTU3MSwwMTIy
MDEwLzA1MTAyMzQxLjIyMS43MjIwMzAvMCsvNDUzMzU1NTMyMjAuLzU1NTIvMDU1LzM3MzE0MzU0
NDMzMjc1MjI0MjIyMjEwMzMzMTMzMjExMTMuMTMzNTUyMjU1NDU3NDAzNDEuMzU1NDM0NTEyMzIz
MjIyMjAzMjQxMTMzNDcxMDEzMjM1MTM0Mi4vNTAzLy8zNTQ1NTUxMjUxLzEuLi8yNTIxLy80MTE0
NTM1MjQ0MjM0MjUyMjAxMjQzNDEuNDMxMzUxNTI0NDIxNTM0NDMzMjMyMTIyNDIzNzU1MzM1NTIw
MjU1MTI0NC8wMzQzMzExNTc3MjAzMzM0NDIyMi8zLy4wMzIxMTM1NTQ3NTIuMjM1MjA1MDQ1NTIz
MzQ1NTUzMDQ0NTMzMzU0MjU3NTQ1NTU0NDQyNDEyMzU1MzQ0MTIyNDI0NTUzMzQ1NDIwMzM0NTQ1
NTMxLzAyMzExMTI0NDIvMi4wNTUxNDU5OTU0MzU0NTU1NDUyLzM0MzI1MzMzMzE0NTczNDUxNDI1
MTM3MjUzNTUwMjIzNTUxMzU3NDEvMjU1ODU1MzQ1NDMuMDM1MjMxNDUzNTU1MDQzNDMxMzI0NTQz
NTQ0NTEyNDUxMjQ1NTU0NDU1MTQ5ODQ1Nzc1MTI0MzQyNDc0Nzg1OTIzNTU1NDUzNDM0MTAwNDM1
NTU0NDMzMjU0MzI3NTU3ODUzMTM1NTQ1NTQ1NDIxMzU1MzU1MzIzMDM0MDM0MzIzNDU1NTIxMTQz
MjIwNDU1NzUzNTQ0MTQ0Mzg1NzcxNTQzNTc1ODQ1MzAxNTczNTUzNTQyNTUzMzIuNDMxMjU0MzU0
NTU0MjQ1NTU0NTI1NzM1NTQ1NzU1NTQ1MjAyMzc1NDIzNTQ0OTgzMzExNTUzNTU1NTgzMjQ1NTE0
NTMzMjU0NDQ0MzU0MzQ0MTU0NDU3My8wNTk0NTU0NDQ0MzMyMzQzMDU1NTQzNDE1NDM1NDg4OTc0
NTU1MjQ0NTM0NTQzNzg4MzU1NTg4ODU3Ojg5Nzg3NTU3NzU1NTU6PTo4NzU1NTU1Ozg6PD4+OzU6
OTs5Ojo8NTg9PDw8NzU3OTk4Ozo9QDo5OTg5Ojs3ODg3NTU1Ojk5OTk4ODc6NzU3ODc3NTc6Ojc4
OTw5Ojo6MzU5OTU3OTs9OTo5Nzc0NTc4NTg1NTU4OTM4OTU0MzQ3OTU1NTU1ODc0NTU3NzU0MjM1
NTM3OTU4NTgzMTI1NTU1OTk4NzU1NTo1MzU1NTk7NzU1ODg1NDc4Nzc1NDU4NTo3MzQ1NTQ1NTU4
NzUxNDUzNDU1NzM0Ozg1NTU4ODk0NTQzNzU0MzU7ODc6OTQ1Nzk1NTU1Nzc6NTU5Nzg3NTk6NTU1
OTUzNTM1NTc6NzQ1OTc4NTU1NTc3NzM1OTU4Ojc1MjI1NTUzNDU0NTc0NDc5ODo1Nzo6OTk4NzU4
OTc5Ojg3Nzc4ODw4MjQ1NTk5ODs6Ozc6NTU6PDczNTUyMjg6NTc5Oj07OTc1NTg4NTQ5OT44Nzo4
ODk4Nzk1Ojg5PDs1NTg1MzIyNTg4NTQzNzg6NTc1Nzg1NDk6ODQ1NDU1NDMzOjk1NDUxNDIxNTc1
MjU1MzQyMTU5OTU0NTM0NDA1NTg4NDM1MzQ3NDQyNzQ0NTg5MzQ1NTIzNTU1NTU4NTQ1NTc1OT04
NTM3MzM3NTUzODo3NzU6NTU1NzM5OTQ1NTU6NzQ5OjU1NTc1Mzk6NTo0MjM1Ozs5NTQ4Ozk8OTc1
Nzc5ODc4NTg6Ojk4Ozo3ODs6OTk3ODU6Pjs7Pjg7Ozs6PDk5Ozo5OTk5Nzg6PDo5Ojs7ODg3ODo7
PT43Ozc1Nzo9PTg8Pj07OTg1Nz49Nzg7Ojk7PDs6PDk3OTU3PDk7PDo8OTg6OTc6OTg4Nzg+PDs9
Ozs7Ojo4OT47Pj4+ODc5Nzg7Oz04PTo5Oz4+PD07Ojw8Ozo7PD4+PDw5OTk6OTo8Ozw6PTo5Pjw5
Ojs9OTs5Pjw7Ojs9Ozk5PDw7ODs6Ojg8Ozk8Ozs4OD09Ozs9Ozw+Qjo8PDo6PD06OTg4PEE+Ozk5
Ozs5Ozs4Nzk7PT46NzU7PD03ODw5Ozw4ODk5ODw4PD06Ojw8Oz0+PTk3Ojg6Ojg5OTs7Ojw6Nzk5
Nzg5PDk1NzU1NTQ6OTU3Ojc4Ozc7NTg4NTc5OTc4Ojo7OzU5Ojw5PDo8Oz4+Ozo4Ojg7PD05PTw6
NzU6PDw5Ojk9Ozk6Pjs7Pjw8PTs+QD49PDo9PDc5Pjw8Pj46Ozg5Ozo5PDs8OTk4Oz09Ozc5OTs7
Ozk5NTk+ODg9PDw+OzM5ODg7NTc9QDk7Ojk9OUA8ODk7Ojg1ODg1NTpBPDg6NzU8Pj44NTg7PDg5
PkA9PDw8Pjg6PDs9Ojw8Ozo7PkE8Ojc+Pj0+Ojk5ODo8PDo4OT0+PT08Pj08PDo7PD09PTo4PDc1
Ojo5Ojs7PTs3Oj4+Ozs6ODc5Ozs1PT49Ojk5Pjg5PDs7NTg1ODw5PkE9NTQ3ODU4Ozs8Ozo7Ojg7
Ojk6OTk5Nzk4Nzw7MDI0NTg1MC4xMjE1NDIzMzEzLzAwMDA4NTQxMzMxMy8zNTIxMDExMzUxLiwx
MzQ0MjEwMzIyMjMyMjExNDQyMywwMS8vMC4wMTMyMS8vMzMxMTMzMTE0MjU0NDQ0MjQzMzAvMzIx
MjMzNTU0MzIxMDQ0NTE0MzExNC8wMTI1MzEyMTEzMDQ0NS8zNTM0NzEvMzI0NTExMzIzMS8wMjMw
MDM0NTMxMTEzMTExMTAuLzAyMjIvNDUwMzQ1MDMyMzIvMTEzMS8uMDAvMTIyMzExMjMyMjAzMzM0
MDExMjMzNDU1NzUxMDEvLzA1MDAyNTQ1NTIyMjQ3NzMzNTQ3NzI0MjQ0NDU0MzQ1NTQ1MDA0MzIz
MzM1MjEvMDIyMTIyNDQxMjQwMjIyMzI0Mjc0MTIzNTMzMzQ1NTcxMzE0NTM0LzA0MjEuMzI0MjIz
MDMyMjMzMjUyMTU1MzIzMjU1NDQ0LjQ4NzM1LzAvNDc0MzQvLzEwMjU1MzU1NTUzMTU1MTIxMDIx
MjMyMzU0NzMzNTkxMjI0NTU4MzMyNzk0MTU1NTQ1MjQzNTU1NDM1LzMzNTQyMjM0NDM1NzI1MDUz
MDQ0NDUxMDEyMTQyNzU0MTI1NTMzMjIzNTM0Mzg1MzM1MjUxNDQ0NDEzNTI0NDUzNDU3NzU0MzE0
NzQzNDMzNzMxMjQzNDM0MjI1NTMzNDIzNTQ0NTQxMzU1NDQ1MjEwNTQzNDUzNTU0MjUyNTIyMjU1
MzM0NzU0MjU1MzI3MzI1MDIyMzU1NTMxLzMyMjM1NDM3NTMxMjU1NzM3NTc0LzI3NTc4NTU1Ly80
NDIxNTc5OjUzNTU0MzU4MzIxNTc0NTU1NTMxMjUzMjU0NTg1NDM0MjU5NDUzMDEzNDM1NDM1Nzo0
NDU3NTQyNDU3NTc1MzU5MzU1NDQzOTc1NTU0NTU3ODk3MzI1NDQzNDMzNTcyMjQ1NDU1MjEyMjIy
NDQ4MzU0MDU4NTc1NTU1NDQ0MTAxMzE0NTM1NDU4NTIyNTQ5Ozg3NTU6OTcyMjQ1NTUxMzk4NTg1
ODU0NTE3NTU3NTMzNzIuMjU3NTg1NDU1NTM1OjU1NDU1NzQ1NDEyNzM0Nzc1NTg3ODQ4Nzc1MzQ4
OTgyMzU1MzM0NTE0NDc5NzM1NTo0MDM1NDIzNDQxMTI1NTc1MzEzNzg5NzQ1ODc0MjQ1NTU3NTU1
OTs3ODc1Nzk4NTM1OTQ1MzM4OTg1Nz05MzI3Ozc3PTk3NTI4NzMyODc1Nzk1ODo4OTg6Nzk7OTg3
PDk7Ozk1NTk5Oz04ODs1NTg4OTk0OTs7PDs3NTg1OTc6PDk1ODk1NTU1NTk6Oj07Nzo1Nzk7Pjk8
Ojo4NTU4Ojk4OTk4ODg7Ozo3ODo5Ojw5PDc3ODc1ODU1Oj08ODg7ODU1NzQ3NTU4OTc3OjU5Nzg1
NTU1Nzg3OTc3NTc1NTc1NTk1NTg1NzU3Ojs5ODc3NTU1NTU3NDg1NTU4NTU3NTk1Nzc1ODQzMjc3
NTU1OTk4ODc1NDUzNTU1NTk5OTg6NTo4OTc0ODs9ODU1NzQzNzU1NDo3NTg3NzI4ODg4NzQ1NTU1
NTM1NTc3NTU1Ojc5NzU3OTs8NTU1NTU0NDU6OTc1NTg5NzU1NTs3ODg3ODU1NTg4Nzg4Ozs5Ojk6
Nzc7NTc3ODg1Nzs1NTU6Nzo4ODk1NTc3MzM3OTk4NzQ1NDU4OTU3ODc1NTcyODk3ODczNDo4NTU7
NTM4NTc3NzUzNTo9Ozg3NTk4ODg3Ojk1LzU3NTs8OTMzNzQ0NTc1OTo4OTMyMjM5NzA1NTQ4MzMz
MjU1ODk5NTc0Mzg1MzU1NTU1OTU1NTUyMDEzNTcwMTQzMDIvNDMxODc0NDU1NTQ0NTQxNTUzNTk1
NzU3MzE1OTo1NTc0NTo4NTU1MzMzOjk3NzU1ODg6OTc4NTQ1Nzc5Nzg6NTs7OTg5ODU4ODU4Ojo4
ODk6OT07OTs4ODc3PD43NTo3OTc5Ojc4MzU4Ojc1OTo3OTw5OTk1OTc1NTk7PDw6PTg1Nzs6OTs+
QT0+Ozw5Ozo7Ojs9Pjw8ODo7Ozk3ODs6Ozw5PD09PDg6PTo7Oj47PTw5Ojc7Oj06PDo3OT49ODc5
Ozw6NTg5Nzc6Ojw7Pjo5OTg1Ojo3Ojk7ODs9Ozc1Oj49OTk9Ojw5NTo+Ozw8Ojk5Ozk8Nzs+Pjs5
PDw6Oz04ODk9PDk4PDw5OD09Pjs7Ojs9OTk9PT48Oj07Ojo+PTs5Nzw3ODk5Oz07Pj05Oz06Ojw8
OTU1OTk7Oz09NTU8Pjo6OTo3ODg6OTk5Ojw6ODk6Ozs5NDc4O0E6Ozo3OTo4Nzc7OTo4Ojc6PDo6
Ozs4ODg1Ojk8Pjs5Ozo5Ozs8PDc3Ojg7OTU+PTo9Pjs7Pjs3ODpAOzo8PDw5Ozs9QD07Pjo4PTc6
Ozs6OTo7PDw8Ojo5Ozg9OzU7PUA9PTw6Pj08Pj04ODs7PDk7PDw6ODk9QD4+Pjw7Ozg1NDc6PTo7
Nzs6OTU1Ojg4Ozg5ODk6PDs6Ozk1OTk5Ozg4ODs3NTc6Ozo5OTk7Pjo5Ojg3PDs7PT46PT49NTg6
ODs9Oz08Ojg4OTk1Ojs8ODU5ODc7Ojo6Pjo+Ozc5Nzo5Nzw6Ojo5Oz48Ozs6Nzw8Ozw5NTk8OjtA
Ojc4PTg9Ozg6PTw6PD04NTxAOTo7PDo9PTU8Ojc+Ojk9Oz4+Oj45OTg1ODs7Ozs7PTk6Ojs6Pjo1
OTg4OTo6OzoyLzAwLy8wMDMzLy8sLjIxLjAyMDEyMjM3NTAyMjEyMjMxNTIzMjU0MTExMTI1MTIz
NC4wMTMwMTAzNTE0NDEzODUzMTMwMzUzNDQwMy8zNDAxMDAvMjMzNTMyMS8wMC4yMTQzNTU0MTEy
MTQxLzM1MjU1NDMyLjQwMzUzMTAwMC80MzEvNDE0MzExMTM1MjAwMzU0MDQyMzA0Mi8yMTEzMDAw
NDU1NTMwMjU0MjQyLzEyMy8vMDA1MS8wLzMzMy4wMDMyMTAyMDEwMDA0NTIxMjI0NDIyNzU0MzAz
NDMwMzU1NTA0MzAxMDQyLi8zNTEwMjQyLzA4NTIzNTExMzU1MzE0NDE0NTU4NTAwNTU1MzIwMzEw
NDQzMzQ0My8zMzQ1MzUzLzQzMzI0NzMxMTI1NTIuMTEzMzMvMTE0NDQ1MTI0MjAyMzEvMzUyMDEw
MjI0MzEyMzA0NTc1MzIxLy8uMTU0MTUzLzEyMi8yNzEyMjA0NDQ1MjMxMjc3NTMzNTc0NDQ1MzEy
MzM1NTUxMzUxLzMyNDQzMjIxLzE0NTIxMjM0NDAyMjE0ODU4NTUzMzExMTE1NTM4NTI3ODU1NTc3
NTU3NTczNDQ1NTMzNDQ0MjM1NTQ1NzczMDAzNTMyMzU1NTMyMzU1NTc0MTExMzE1NTI0NzUzMDIu
LzIwMDMxMjUzNTg0MTM0NzU0MzEzNTUyMTE1NTM3MjIvLjMxMjMwNTU1MzU0NDM0NDI0NTc0NTQz
NTE1NTIyNTUxMTMyNTg3MTQyLjEwLzQ1MzQ0NDA1NTQ1NDQuNTU1MzAyMTIzMS8zMzAyNDEvMjAy
NDQ4NTQzNTc1NTQ1MzQ0NDU0NTAyNTUyNDgzLzU5NDg1NDQ3NTEvNDQyNTU1NDQ0MzAuLzUzMjI0
NDU0NTMzMjQzNTQ0NTU1MDI4NzE0Nzc1NTU1MjE1NTc3NDEyMzo1ODU0NTU4NzAzNDMyNTc1NDQ0
NTMyMjU4MzEyNTQzNTU1NDU5MzM0MDMxNDUzMzczNzU1MzU1NDUzNTQ1MTQyODQzMTM4NTM0NTc1
MzI1OjUxNDM1NTQ4NTM1NDQ0NTUyMzU0NTU1ODgyMTUzNTExMzIxNDI3OTg1NTUxMTM1NTU3ODc1
NzUzNzU4ODU6ODU1NzU3MzU1NDU3NTU1NzQzNTMxNDUzMTMxNDUyMzQ0NDU4NTc1NTUzNTc3NTU1
NTU4NTU4OTc0MzIyMTU1OTg1MjQ5OTQ0MjQ1NTc5NTk4OjQ1OTg4ODc5OTg5ODk7OTs5ODs3NzM1
OTU6Ojg7NTk5Nzk6Ozs+Pjw5Ozk6ODs7PT0yODs7ODU1Oj09Nzg6OTc3Nzg4NTU9PDc7PTs7ODg4
NTc7ODk4MzU6PDs1NTc5Ozc4ODo4ODU5OTk4NTg4NTo1ODc3OTc3ODUyMzg1Nzg0MzQxNTg1NDQ4
NDU1MTUzOTo6NTk4NzU3Ojc4ODg3NTU4Ozg1NTc1ODg5NTg4Ozg1MDM3Nzs7NTU1NzM1MTQ5NTM1
NDk6NTU3Nzc4NTU4OTU1NDU3MzMzNzU1Nzc1Nzc3Ozs5NDU6NTc7PDs6NTk3Ojg3Nzo7OzkzNTU3
OTs3Nzc1NzU4ODw7ODc1Oz06OTc4Nzg4NTU0Mjg0MDg1ODczMzQ4Nzo5OTM1Ojs0Nzk1NzgzNTU1
Nzc4ODo6Oz07OTk6NTI5ODo5OjU1ODU3OTo3NTc3NTU3ODo3NTU4OT06NTk1NDk5OTk4Nzc1NTg1
NTUzNTg1MzI1ODU1NDQ3OTs5ODg4NTQ1NTU3ODc3NDU4OTU0OTg0NTk5OTg4ODc4NTU1ODU1NDU5
NTQ3NTUzNDQ1NzUzNTUyNDo5NTU0Mjc0MTIzNDIyNDUzNTc3ODUzMjI3NTg0NDU3NTU1NTgzNTU1
NTU0MzUyMDQ6NzQzNTMzNTQ1NDM1NTU4NDc1NTc7PDg3NzM1ODk4ODo4ODU0NTM1NTo3NTM1OTg5
NzU1NTc5OTg4Nz01NTU1NTU4Ojk4Nzo6Oz44ODU4Pjg5Ozk5Nzs6Nzk5OTk5Ozg7Ozw5ODk6PT47
PD43OTU4Oz49ODs+Pj09OTk5Ozw8ODw5Nzo8Oz07Ojs5Ojk6OT05Pj08Pjs6Pjw8Oj44Nzw6OD47
Ojo8PTs7PTw7PkE8PD4+Pjs6PTs5Ojk5Ojg4Ozk9PT4+PD07Ozs5ODU7Ozo5NTs7Oj09OTw8Ojo5
ODk7Ojk6Oz49PDs6Nzk9PD0+Pj49Ojg8OTw6PDw7OTg5OTo4Ozg8Ozc5PD4+Oz48Oz08OTg3OTs7
Ozw6Ozw9Ojc3OTo7Ozg6Ozo5QDw5Ojs6Ojs4OD09Ojg4PTw7Ozo4Ozo3NTU4PDg7NTU4ODo4Ozk3
Ozo5Ozo6Ozs6Ozc6Oj49ODw7Ojo5OTs6PTw8PT49Ozw4Ozw+Ojw7Pjw9PTk7Oz09PTw5NT0+Ozo9
Ozs5Ojw6Oz49Pj48Ozg6Pj0+Ojg7PTw9PTs9Pjo8OT49Pjo7PTo8PTs8Pjs6Oz08Ojg9Ozs3Ozw8
OTk9ODo6Ozw5NTo4Ojk7PDk6OTk9PT4+Ojc7Oj4+PkE9OTg6Ojs8PD1AOzc3OTo6Ojk8PD47ODs9
Oz44PDo7Ojo6PDw7Pjo+QT47Ojc8Ojk8Pj48Ozo9Pjs8OTw8PDk5ODw6OTU4PT4+PD07Nzo5ODs9
Ozk5Oj4+Ozc6PDw4PD47OTo6OTo8PTw9PDw+PTo4Ozo5OTo5Ozo+PTw5OTc6Oz47Ozw9Ozo5PTw7
PT47OzQxLywvMDAvMjIxMTAyMTI0MjAuMTMwMDI1MTI0MzIzNS8yNTUzNDQzNTE1MzgyMDEzMjAx
Ly4xMjMvMDEwLzAwMzQ1NTU1MjEwNDI0NDEvMjExMDAzMjAxMzM0MzI0MjIyMTExLjIyMjEzMzI0
NDIzMjExMzc3NS8vMDIuMTM0MjAyMjIxMjUyMTMyMjMxMzU1NTU1MTQyNDExNC8yMzMyMTEyMTMx
MTMvMDQyNDUzMjIxMzMvMTAvMDA1MzMxLjQ1NDMxLjExMTM0LzAwNDI3MzM0NTAvMjU1MTI3MTAz
MTM0NDI1MDQ1MzUzMzQzMzI1NzMyNDM1NTczMjUzNDMzMy8yMzIxMzU1MjAyNDQ1MzMzLzM1ODM0
NDIyMzU1NTUzNTQyNDQ0MzMwMjAyMjM1NTU1NTU1NTUyNDE0MDMyMTIzNTIxNDU1NTMxMTAyMTI1
NTIyMDQxLzEzMzIzMDM1MjMyNTQ0MzMxMDEyMzMzMy8yNTUzNTUyMzUzNTUzLzMyNTc1MjEwMjMx
MzMxMTM0NDU1NDMyMTIzMzMzNTMzMjAyMDE1MTQ1NDExMDMzNDQzNTEzMTE0NzUyMTU0NTM0NTU3
NTc1ODU1NTUzMzEzMjAxMjQyMDIyNTc1NDIxMTQ1NzUxMzczNDUzMzIwNDE1MjI1NzIyMjQ3NTQz
MzEyMjIuMzM5OjUyNDU1NDMzMzIyMjExMzM1NTI1NTMwLzI3NzU1MjU1NTM1NTE0MzMzNDc1NTQz
NTU4MzQyNDc1NTc4NDIzMjQ0MDc1MzEyMzIwMjM1LjI1MjUwMTIzNDU1NTU0MjAyMjQ1NTU0NDUy
Mjc0Nzk1ODU3NzU1OTg3NDc0NTk1MzU1NTQ1NTExMzU0NDEzNDM1Mi81NTU3MzE3NTQ0NDU0MjU1
NDQ0NzQvMTU3MjAzMTU3NTc3NDc1MzI1NTIwMzQ0NTQ0NzUyNTM0NTUyMzM3NzMxMzE0NzM1NzU1
MzUzMjMyNTc1NTMzMjE1NTM3NDI1NTU0Mzc1NDI1NC81NTk6NzM3NTM0NzUyMTM1NzU1MzM1Nzg1
NTc1NTU0NzUzNTU1NTU1MzQyMTU0NDMyNTg1NDU0MTEvNTM1NzU1NTc3NzQ1NTI1NTczNTU4NTQ1
NTQxNTc1NDg3LzE3MzM1NTU1NzM1NDQwNDU0NTg4Nzc1NDM4NTU4NTMyNzk6NTQzNDQ3MTUyNDc3
NTU1MjM1MjEyNTk3ODU1NTU4NTg3Ojc3Mzc3NDU3NDg4NTQ0NTQ5Ojk4NTc5Ozo4OTU1Nzk6Ozw6
OjU5Ozo6Ozk6PTo4ODU1Ozg6PTo5Nzk6Ojw4OTk0PD47ODo4Ojk1Ojk3Ojs5ODs4Nzg5NTc5Nzo5
Nzk8Ozk3NTc5ODU4OTs6ODk3Nzg4Nzc4NTU1NTk3NTc6NTM0ODg4ODs6OTk1NTU1ODU0NzU1NTU1
Mzc1NTM0NTg6ODQ4Nzc4NzU3Nzg1NTU3OTc4NTU0NTo3OTc6OjU1Ozs5ODQ1NTU5ODU1NTMzNDU1
Nzg3NTU3ODQ1NDMzMzU1NTU1NTU3MjU1NTMzNTU1NTU1NTQ0ODU1NTc1NTU1NTg4OjUwNDU1NTc4
NzU0MzQ0NTU4NTc5ODk1NTo1NTU0NzU1ODg1OjU1NzU3NTU1NTo3NTc3NzM1Ojg8ODI1OTc0Nzk4
OTU5Pjo7Ozc1Mjg1NTc1Ojw7OTQ1NTc3NzQ1NTs7NTc5NTk6ODk3MzU4Nzg3NDU4OTs4MjU4Ozo4
ODU3Nzg4Ozk5OjQ1NTg5NzU1NDQ5NTc3Nzc3Nzk5Nzc3NDQ3NTU4NTU1NDg1NDM1MzU6NzU1NTE1
NDc0NDUzNDU1OTQ0MzEyMTc1NTU3NDU0NDU6MzAzNTg3NTU1OTU1NTQ1NDQ3MzU1NTU3NTI1NzUz
NDE1Nzc1ODk6PDczNTo4NTMzNTc1NTU3NTE1NDU1ODQ1ODU3Nzg5ODc3ODM1Nzo3Nzc1NTc4Nzo4
Ojg3NTM5OTU1Nzo1OTg3ODk5Nzk6Ojo9Ozc1Nzg7OTU5ODk4NTc4Nzc4Nzs9Nz08Ojs8Oj5AOzg6
PDw+Pj4+Pjo6Ojs7Oz47PTo5PDk7PTo+PDk+PT48PDo8QD46PT0+PDo8Pjw5ODo8Ozs9Ozk7Pj46
Pjw5Oz49PDs7Oz48OD06PD5APjw8Ojk6OTw4PT47OTo8OTw8Ojw3Oj07Ojg8PDw7PD09QD06Ojg5
Ojo6PT48OT49OTo7ODs9PTg7PkA+PD5CPjo8PUA8PD1APj47ODg7Nzk5ODg3ODU6OTc6Ojo7Ojs6
OTs7Ozs7Ojw9Ojs8OTs8Nzg7QDo7OTs5ODg5Ozw9Ozk5Nzo1OT05Ozk7OTQ4OTw8PTw7OTg1OTo7
Ojw9OzU6Ojs6PT08Oz47PDo4ODg7Pj49Oz46PT09OTg4Ozg6PD45ODs+QT48PDw8Pj05PkA7OTs+
Ojw+PkBDPjw7OTk+QTs6PD08PDs7OTo7ODo7PDw5Ojk4PDs6NTg6Ojk7PDg8Pj45Nzo6Ojo9Ojc3
Oz5APjw+Pjs5NzU5Ozk6Ozs4OTk4PTk8PTw+ODk4Pj44PDo4PDc4OD09PDk3NTc9OTk4Ojg7PDs6
PDo4OD06Oz4+Nzk6ODo5OTs7NzxAPUA+Ojs5NTo+Ojg8PDc1OTo8Ozs6PDg3Oj48Ozs6PDo7PDo3
OT09Pj06Ojk7Oz46Ojw6OTs5Oj47Ojs7Ojk4OTU6PDs4ODg5Ozs5Ozw7Ojs+OTo5OzU7NTs4Ojs6
MjI0MTIyMzAxNDIxNDQzMS8sLy8xMzMxLy8vMzAuMjM0NDQyMzUyMC8wLzIzMTI0MDE0MTEzMjAy
LzAzLzAsMzI1MDA1MzEyMTQzLzAxMTMuMS4yMzM0NDUxLzEuMDMzMTMzNDMzMzAyMjAxNDEzNSwx
MjAyMzI0NTEyLzQ1MDM0MDEzNDAxMTExMC4vMi8vNDQxMTA0NzEvMTQzNDQxMjQ0MDEwMjEsLDE0
MTMyMDQyMTAxLzI0MzMzMjEwMTIzMDI0NDAzMTAyMzM1MzM1MDg0MTI0Mzc0NzQvMjU0MjU0NDU1
NDI3MzM0NTIwLjAyMjE0NTEuMDIxMTEwNDMwMzcyMTIyMTU3MzMzMjEzMzMvMjM0OTUxNTQxMDM0
MzM1ODU1NTUzMTI3NTAyMDA0MzAyNTQxMjEvMTAzMDQyNTMxMTAzMzEyMjMyLzI0MTAzNTQ0NDQy
MjI1NTI0MjIzNDMxMDMzMzM1MjU1MDMwNDIzOjg1NDIxMjAzOTg1NTMzNDUwMDMyMTU0NTUzNDMz
MDIwMjIzMTQ1NTQ1NTQyNDU0MjIyMTAzMTQxMTE0NTIzMzIxNTQyNTM0MzIzMjI0NTMzMTQyMTU4
MjAyMzQyMjQ1NS8sLjE1MzU0NDQ3NDMzNDU0NDM0MjM0NDIzMzMyLjAyMTM1NDEvNDU0NTQ0MjMz
MzMwNDMvMzUzMjM1Mzc1Mi4zNTMyNTQ1ODU3ODo0NDQzNDI1MTU1MjQ1NDI0NTU1NTU0ODUxMDI4
MzEwMjQxNTk1NTM0NDQ1NTQzNTc1NDQ3NTM1NTU0NDM3NTIxMjM0MjI0NDU0NC8wMDUzMjQzMDQz
MjU3NzU0MzQ1MjA4NzU1NDM1MzU0MDE0NDc3NzUzMjIzNDQxMzQ0NTg1NzUyNTUzNDQzMzMzMzQ1
MzU0NDU0NTU1NTU1NDQxMTI0MDIyMC8xMTU0NzU1NDAzOTU0NTMzMTQ1NzgzMTQzMzQ0MzMyNDU0
Mzk1MjAzNDEzNzc4NTU1MTU1NTU5OTI1NzU1NTUzNTU3Mjs3MTI0NDIzMjQ1NTc3NTExNDU5ODU1
NTIyMzUyNTU0MjI1MTM3MzU1NTU1NTMzMjI0NTE0MzQxNDU3NTU5OTU0NDU0NDg5NTQzMjg3NTQ1
NzM1NTc1OjU1NTg1NDMzNTQzNzc1NTM4NTU3OTo0MzU1NTg4NTQ1NDc4MTM3Nzc1NTU1NDg3OTU1
ODcyNTIzODUzNTU4OTcyMzQ6OjU5OTg5OTc3NTU4MjM6NzU7NDg1NTU6Ojc5NTg7PDk5OTc5Ozk1
NTQ3OTk6Ojc7Ozs5NzU1ODk4NTQ4PD06NTg5PTo+ODw7PDg3Ozg4OTg1Nzo+Ozc1Nzk1NDU9OTc3
NTs7ODg5ODc1NDc5ODc5NTQ1NTU0NDU6PDc5OTk5NTU1Nzg0NzQ3OTc6Ozk3ODg4NTc3ODk5NTc4
ODc1OTU1NTc3OTUzNDs1NTU0NTU1NTU1NTQ1NzQxNDU5ODU1NTc3NTc3NDg3NTs8NTU3NTc4NTc3
ODo3ODs0NTg1ODc4Ojc6NTg1NTU3NzU3ODQxMzc1Nzg3ODk5ODU4PDg3NTk3MzU6Ojk3NTQ3ODc6
NTU4ODU4Nzc3NTU1ODg0MjQ5NTU3ODk4ODg4NzU3ODczMzU1NTk4OTs6OTk6NTQ0ODo3NTU4ODU1
Mzc1NTo4OTU0Nzc5Ozs7ODU3MzU6NTc3NTQ1Ojo9ODU0Nzc5OjQ5Ojw4PTk4Nzg5Ojc0NTk7OTc5
OTc5Nzg7OTU4OTU4Ojc1ODg5NTc4NzM1NzU0NTU3NDI1ODU0MzU1NTc5NTg1MTQzMTAxNTUyMzU5
NzQyNDM3NTU4NTg1MDEzNTEzNDM3MzIyNDQ1MjU6OTU1NDM0NTg1NDU4NTU1NTU5NzMxMzU5OTk5
Ojs4NTU6Ojg1NTg7NTc7PDk6Ojg5Nzk3NTU4NTU1ODg5Ojc1Ozo9Ojw6NTU0MzU3OTc4ODk8ODU4
Ojg4Ozs4OTg4OTo5Ozg3NTo7Ozg7Ozs4OUA5Nzc3ODc1Ozg4Nzs5ODo8Ozg7PTk4PTs8PTs6Nzk7
PD01OT08PDk7Pjw7PDk3ODw9PDo5PTw5ODo6Nzk7Ojs5OTs8Ojk8Ozk9Ozk5Pj44ODs+Ojs9Ojo+
Ozs+Pj09PTw6ODk6PTs5Ozw+PDo7O0A+Oz4+Pjs5ODg5Ojo4Oz46Pj08ODw+PDs6PTs8Ozs7Oj09
PDo4PD06Oz48PDk7Ozs+QDs4OTs5PDo7Ozg7Ojk8Pjs6PDs9Ozk7PD49PDk4Oz09ODk9PTs7Oz08
PDs7Ozg4Ozk4Ojw7PD06Ozw3Ojo1PDs6OTo9Ozg6OjU4ODU0ODs5NTg3Ojo6Oz07Oj07NTk1OTg5
Pj0+QD49Pjw6ODk9PDs5Ozo7Ozw9PUE7ODk7OTg6PDs9Ojs3OEA+Ojs8Ozs5Nzg7PD09Pjo5PUE+
PkBAQTs6ODs+QD4+Pj4+PT47PD09Ojs5Ojo6PD0+Ojg4Oj48Oj4+Pj49OTU9PTw8Ozs5ODw8Ozw7
Ozo9Pjw9Ozs9PTw5Ojs9PT48PTk6PD05PTs8PDs7PDs5OT07Ozc5OTk8Pj47ODk9PDs7ODk4PUA7
ODs8PDg8ODQ1NTo5ODk6Ozg6PDo5ODU6Ojw6Oz08PTg1Nzg5ODo8PDg4PTw6OTk7Ozs8OTg9NTo6
PD44Ozo6NzQ1Nzc5Nzk4OTg6OTw6PDk3Mzg7Oz07Oj05ODs6Pj46OTw9NzU5OTg7Ojw9OjwyMjEy
NDUwMjMwMjExMDAxMTQ1MjMvLjE1MjIyMDAxMzMyMjMyMDQ1MTU1NTEzNDIyMjIyNTEzMjI0MDEv
MTUwMC8wLy4yMDIxMDUyNDQzNTQyMDExNTM0NDMvMC8zNDUyMTEwMTEzMzIzNDc0NTMwMTI1NTU3
MzI1NDEzMDAxMzQ0MDM1MjQ0MzIyNDM0NDMwMTIyNC8xMTI1NC4wMjMxLjI1NDMxMjU0MjAwMC4u
NDQ1NDU1ODI1NDAyMjUyMTIxMzMyNzg1NDUyLzIxMzIyMjQ0MjQ0MzA1NDIvLDEyMTE1MS4xLi8z
MzExMjExMzIyMDQ1My8sMzU0NDMzMTMyMjQzMjExMTMyNTMzMjE1NTU3NDUyLzAzNTQyNDEwMzAy
NTc5ODAyMTU1MTUzMTQyNTM0NDE3NTMwMTQyMTE1MjAyNDQxMC81NS8vNTc1MzMyMjAzNTIxMjMy
MDQ0MC8vMDU1MzEvMzUzMjEzMTIvMDM0MDEuMTQzMzU1MDAzNDczMDM0NTEzLzQzNDMzNDU3NTQ0
MTIzNDM1NDQvMTQzNDU0NzUvMTE1NTMzNDMyMDIvMTIzNDEzNTI0NDU0NTI1MzI0NDUyMDIzMzIz
MzI0NTEzNS8zNTM1NzAyODMvMjEwMDIzMjI0MzIzMzUuMzMzNDQ1NTQ5NTU1NTIvLjAyNTMyMjAw
MDE0NzU0NDQyNzUvMTU0MDU3NTc1NzUzNDI1NDMzNDMzMzMwLzU1MzEwNDM0MzIyMzM0NTUyMDU1
NTQzMTQ3NTU3NTU1NDM3MzQzMDQ0MzUyNTUzMjA0MjM0NTc3NTQ3NzU4NTU3ODc0Nzg1NTU4NTM0
MjU1NDc5NTQ3Ojg1NTMzNDM1MzIzNTU0MTU1MzU1MDU1NTU4MzIzNTI1NDIxNTk3NTU3OjU0Nzc1
NDQ1OTg0MjQ3NTMxMzUzMzQ1MzMyNDMyNTQ4NTU3MzU0MzMzNTIzMzU4NDQzMjA1NTU0NDI1PDo1
ODUzMzM1ODU1MzM1NzQ0NDIyNTE3ODEuMTk1NTU1NDQzNzg6ODk3MjEzNTU0Nzg0NDQzNTU0NDM0
NDIxMzQ1MjQ1NzUzNDUyMjU4MzQxNDgzNTQ1ODQzMTM4ODUzNTU1NTQ1Mzg4NzU1NTU4MzEyNTQz
NDUyNDU1NDMyNTg3OjczNzU1MjU0Nzk6ODc1Ojg3Nzc1Nzo4NTczNDMzNDQzNTc3NTU3ODU1NTg3
Nzg5NTM1NTI1NTc6NzQ1NDQ5NzU1NTU1NTo6OTk5Ojk6Ojw5NzU1ODc4Nzw5Oz06ODg3Ojo4PTc3
OTU5Nzo7OTg6Ojw3NDc7Oz08Ozg3Ozo7Ojg3Nzo9Nzc7OTg6Ojc1NTc4OTw1Nzk4Ojk6ODk3NTk7
Ojs4NTU1ODo3NTc3Ojw3NTQ0OTU0NDk3NTQ4OTg3MjU3Nzc5Ozs5NTc4NDQ1OTc4NTU3NTo5NzU3
Nzk3NDg1NzU0NTU1ODg7OTU1OTk6OTg5NDU0NTc5NzU4Ojg1NTg1MjU1NTk4ODU0MzU6ODQ1NzU4
NzU3NTQ4ODU3NzU4NTU3NTU1ODg4NTU1NTE1NTc6MjQ1NzM0NDM4OTM0ODUzNDg6NTU1Mjc3NTk4
NDM5OTU0Ojk5NTk1NTo5NTQ4Nzo5PDU1ODU1NTU1NzUyNTo4NDo4Nzg3NTg0NTU4PDg3NTU4NzU0
OTo5NTg1NTg0NTk6Ojg1NTU7Ozg5NTM1Nzc1Ojs3Nzk3NTI0ODw3OTc1MjU1NDc1NTc3Ojg3NzQ1
Ozo7Nzg4NTg7ODcyNTc3Nzg5OTs5NzczOTk7OTk1NzU0ODk6OjU1OjQ1NDU4NDM0Mzc1NTU1NTMz
NTc3NTU1ODg4NzU3ODQzNTU1NDUzNDg4ODg1OTQ1Nzk3MzU1MjUzMzQ1NDg3NTQ1NTU1NTc4NTU1
NDU1Nzo4Nzc1ODg1Mzg1ODg5NTc4NTg8Ozg1Nzg1NzU1NTk4NzQ1Ozg3Nzc5OTk1ODk1NTo4ODU1
ODo1NTk1Ozs8Ojg0OTk6Ojg1Ojk6ODc9Ozk6Ojk4PTo6Pjk6PTw4OTw6ODk6ODw7Pjo8PTs4Ojo+
PDo1NTg4Oj47ODc+PDo5Oz46Ozk6Oj4+OTo+Ojk7PTk7Oj0+PT06Nz5APj5AOTw7PDs8PDs6PkE8
PTw7PTs9PkM9Ojk6Pj08Ozs9Oz07Ozg5Ojo6PUE9Pjk6Nzw+PDo6OTs7Ozs6OTs9PDs6ODs6Ojo5
ODw7Ozs6OTs9Ozo7Pjw+ODw7PDw9Ozs4Ozs7Ojw4PDU5ODk4Nzg9ODc7PDs7Oj06Ojo6Pj48Ozg3
Nzs8Ojk6OTw7Ozc6PTk1NTU5OTo8Oj0+PTs6Ojg1NDo7ODw6Ojk8Ozc5OTw7Oj5AOTs5OTw9PTk7
Ozo7PTs4PTxAOTk7OTg6Ozw4OT48ODk6OzpAQD08Ojo6Oj07PDw4NTw8PDo8PT08PTs6Oz5APTk7
PT49PT06Ozw8Ojw7OTw8Oz09PTw+Pjs8PDk4Ozo8Ozc6PD4+PUA+OTU4OkA9ODk4ODtAQD0+Pj06
Nzg5PDs5PD09Oz05ODxBPDs9ODk6PDo8PTk7PDs1Ojk7Oz07OT5BOjo6PD09Oz06Nzs9ODc9QDo5
OTs6Ozo5OD08PD08OTU6OTlCQT5APTw7PTs6ODU6PDxAOzU7PTc9Pj08NTU5Pjs6OTs6ODk8Ozs5
NT07Ojc8OTk7PDs8Pj08Ojk6NTk5Pjs6NTk7OTo4PTg6PDg9PTw8Ojg8QDw8Ozs7OjU1MTIwNDIz
NTIyOTU0NDU0MzQ1NTEzMjExMDExMjAzNDUzMjQ0MzAzNDU1MzIzMzQyNDQ3NTI0MzUwMjUwLzIz
NDI0MzM1My8xMjExMjQ1MjQ0MzMzLzAyMjAxMDM1NDQ0MzI1NTMwMDA0LzEzMDIzMjIxMDAyMTU0
MjM0NTQyMzUxMjAyNTI0NDUzMjQyLy8zNDQzLzIzNDQzNDMwMTI0Mi8xNDAsMDAzMzMzNTQvLy8x
MzMwMjMwMzEzMTE0NDU1NTUxMTE0NTU0NTMwLzQ1MzMwMDA0MjU3MTAwNDUxMjIvMDQzMzEyMzU0
Mi8xNDM0NTUxLzI1NTMzNDAyMTQzNDMyNTU1MzI1MDE1MzUzMDI1MzI0OTMwNTMvLzQyNTQyMS4y
NDM1MC4xMTEwMzMwLzAxMS4zMzAvMzEvLzEyNDQ0MjEyMzI5NTQzNDQ0MzEuMDQ1NTU0NDMvMjIw
MzQzMS8wMzIwMTQzMzUyMS8vMTI0MzU1NTQ1NTIzNTIyNTIwMDExNTQzNTMzNDIxMTAxMDQ1NDA1
NDM1Mjc0NDgzMjIvMjQyLjEzNTUyMTQzMzQ1NzI0MzQ1NTM1MS80NDU0MzI1MjM0NTQyODQ1NTU4
NTM3NTQzLjc1ODUyMzQ0NDMzMzEyMzMyMTU5MTAwMzQ1NDI0NDE3NTI1MjExNDM0MzEwNTQzMjIx
NDExMjQ1MzQ1MzQ1MzQ1NTQyMjA1NzM1NTU0MjExNTM0NDAxNzQxMzE1NDAzMjUyMTUzOTczMjEz
NTQzMjAxNTQwMzMwNDQzNDU1MTAsLjIyNDUzNTU3NTMwMjQzNTIxNDQ1MTI1MzA0NDc3NTU3ODc4
NTU1OTU1NTM1NTQ0MzIxMzUzNzg1NDM1NTQxMTUyMjE1NTc4NzU0MTQyMzQzMzU4NTM1NTU1NTg3
MzExMjMzOTc0NTQzMTM0NTMyMzI0Ojk4NzM1NTQxOTc1Nzk3NTM1NTM1ODU3NTQ1NDU5NTU3ODU0
NTU0MjM1NTQ0NDM1NTAwMDQ3NDg4NzU4NTc1NS80ODc3NTE0MjU1NTg3OjU3NzM1MTM0NTU1MzQ3
ODU1NDQ4NzU1NzI0MjM0NDU3ODU3NTU1MTAxMTQyNDQyNTUzMjUzNDUzNDQ1NDI0NTU3NzU3NTU4
ODQzLjQyNDUyNTU1NDU1NTk4ODQzMzUxNTc1MjIwLzMzNTUzODU1NTk1NDI0NzU1ODk1OjU1NTU1
NzU5NzU4NzU3NTg3NTg1ODc1NDc1Nzo6OTo7Ojk1NTk1ODk1OTU1ODk8Ojo4NzU4ODg4OTg4NTg6
Ozs1Nzs5OTc8Ojk4Oz48OTc7PDg7Ojk5Nzw6Ojg5OTk6Ojo5Ojc3Oj49Nzc3OTo4NTo4OTk3Ojk1
Ozo3Nzs7OTQ1ODo5Ozg3NTU1NTg5NTQ3NTg5OTc3NDQ3Ojs4ODU0NTI1ODo4NzQ0Mzc1NzU4ODUz
NTM1ODc4NTU4NDU1NDk1NDQ5ODU1OTk4OTg1NzU1NTc4MzQ0Mzg4NTU1NDM4OTc1NDA0NDc6OTMz
ODg6ODc1NTU4NTU3NDU3OTg0ODQyNTc1ODIwNTk5NTQ5ODU1NTI1NTQ0MjU1Ojc4ODM5OTo0Nzs7
ODo5NDU1ODc4NTU5NTc1Nzs4Nzk3ODg1NTUyNDU6OzU3MzM3NC8xNTk3NTQ1Mzg4NTQ3NzU0MzU4
OTk3NDU3NTQ5OjQ5PDg1OTc1NTs1NTU1ODg8OTU4ODk1Nzc4Ozw3Nzc6Ozw5NDU3NTg3NTQ1Nzc3
Nzg8NTc6NDQ3NDQ1NzM3NzUzMzU3NTM1NTU5NzQzNzg1NTQ6ODUxNDU0ODozNDU1NDMyMzU4NzQv
LjEzNDU0MzQ1NTg3MTM1NzU0NDU1MzQ1NTg1NDg3Nzk5ODc3ODUzNTo0NDU5NTUxNTc1NTU1NTU1
OTcyNDU0NTg4OTs3Nzg0MTU5Nzg3NzU1Nzc0ODs4Ojs1Nzk6Nzc4ODQ1Ojg0MjU5ODU1NzU3OTw6
Nzc1OTg6NTQ3PDs7Nzc6Ojk3Nzk5OTk1Ozo9PT03ODo6Ojg6Ojc1Nzk7OTs6PDg3OTk6Ojg7OTw4
Ozw8Ozk6PT07ODU4OTw8PDc4ODs7PD48Ozg6OTg7Pjw3Ojs+PT05Ojo6Ozo+QEI6OTs5PT4+Ojc7
Ozw4OTo7PkE+Ozs6Ozw5ODo6OD4+OTs9PT1APj07ODk6Pjw+Pjs4Ozo5PD45Ojs5Ozo5Ozo8Ozo7
Pj4+PTw8PD09Ozw6Ojs1ODs8Pjo3PDs6Ozs9PDw6PUA5PD48Ojo5Ojo+Ozk7Oj5BOjw8PDo6Pjw5
Ojw7Ozw7Ozk4Ojo1Nzo8Ozc4Nzg5Ozg6PD06OTk5PDw4Ojo6Oz08ODs7Nzk8Pjs+QDs7Ojs+OjtA
Pjs7PDo7OTw+Pjk7PDw7ODg8NTg3OTk7Ozs6ODg4OTo6ODs8PTs6OTg7PD0+PDs3Oz09PTo5PEE9
Ozk6PDo7PDw6NTo+PD46OTg+PDk8PDw+Pjw7PUA+Ozc6PD49Ojo9OjlAPjo3PDw6PDk6ODs6OTs7
Ozw8ODg4NTc4Ozo7Ozc1Ojc6Pjs5Oz48PTk6PTw6NTo5OjQ4OTk8OTs8Oz4+PTs7PDw9ODw8Pjk6
OT46Ojg6Pjo8PD06Pjo1OT04Oz08PDo7Oz06Ojw5NTo6PTs5Ozw5O0A9Ozg8OTU5Oj09Nzg8Ojs7
Pj4+PTw5PDo4N0FBOzw3OTw9ODw6Pj07ODo6OTs+PT03Ozw8Oz4+OTc7Pjk4MzAsMjIxNDEwMC8y
MjQyMTMzLiwzMjE1MzIwLzIxNDUxMDQ0MTQ1MTM1MzUyMzMyMDA0MjEwNDEyMTMxNTU0NDAwMTIz
LzA0NTMxMTQzNDU1MjQ1NDQzMTIzNTQzMzQwMi8uLiw1MjIzNDQzMjM1MjA1NDQxNTEyLzA0NTU1
NzUyNDM1MzUzMzQxMDM1MzE1MjEyLzMzMDEyMTAxMzQ0MC8yNDIvMTI0NzI0NTMyMDAyNTQyMjQz
MzUzMi8vMDQ1MzIzMzEyMjA1MjM1MzE0NTMyMzQzNzcyMDE0MjMyNDMzMTE1MzcyLy8xNzUxMjIx
MzQ3NDMyNDU0MzIwMTM0MjU1Mi8vLzEzMjMyMzU0MzEzNTQ1NDU0My8xMTIxMTMyMjM0MjA0NDMy
MTEzNTI0NzM3MjE1NDIvMjM0NDE0MDIxMjUyNDUyMzU1MTU0NDIxMzMyMjIyNDQzNDc1MzQ1NTUy
NDc0Mi8yMzUzMjI3NTM0NTU1NDIzMTEzNTc1MzExLzE1MzU1MjEyMzQzMjMzMjMvMTUxMTQxNTQy
MDIyMjIzMzExMzU0NTU3MTExMTUyNTQzMzQzNTQ1NTUzNDU0NDUzNTU0MzU5NTIzMzQ4MzEyNDMx
MjI0NDIzNTU0MzMxMTM1OjUyMTMzMS8wNTU1MDE1MzMzMTE0LzMxMzQzNTE0NTMxMTQzMTA1MzEy
LzMzNDMyMjE0NTU1NTM0MjEzMzU3NDMxNzg1MTQ4OTQyNDc1NDc1NTQ1OjMvMjU1MjMxMzMuMzI0
MzU1NzU1ODU1NTI4MzEzMjA0OzQzODQ0MjM1NTQyNTQzMjI0NTU1NTU1ODc1MjU3NDUxNDcyNDQ0
MjE3NTU1NDU1NDM1NTU1NTMxMTU6NTM0NTQzNDU1NTUyNTU1NTUzNTgzLjQ3NTUxMDMzNDU5MjI1
NTU1MzI0MjAzNzU1ODo4MzI1NTQ0MjQ1NTc3NTUzNTExMzk7NzM1NTQwNDc5MjQ1NzU3OzM1OTUy
MzU1NTM1ODk0NTU0MzMyNTQ3NDIzMjEzMjc1NzU1NTM0MjEvMzMzMzU0NDU3NzMzNzc0NTQzNTM0
NzU3NTQ1NzU0MjU1MjUxNTQyMTExMjU1NDM0NTMyMjQ0NzUzNTU0NDUzNTcyNDMxMTUzMzM1NTU1
NTQzMzQxMTQwNDU3Mzc3NTIzNDc1NTM3NTU0MTE1NTM1NTc4NTc0MzU1NzUzNDM1NTg3NTU3ODU3
ODk1MzU1NDk1NzU1NTU1ODs1NTUzNTU4ODk6OTc7Ojc1NTg1NTc4Nzk1NTk5Ozk3Ozo3PDk3NTw7
ODg4OzU6OTc5OTg1ODc3OTU6Ojc4Nzk3Nzk5Ozs5OTg5Ojk4Ojk3ODw7OTk4NTIzNTczNzc5NDc4
NTU5OTo3ODU5ODc5ODI1Nzc6OTc5NzU3NTU4MzU0NTg1MjQ1NzU0ODc1Nzk1Ozo0NDU4NTg4ODc1
Ojc1OjU5PDg5ODc1ODg6MjM1ODU4OTI0NzU0NDU0NTc7ODg1NTM1NTU6ODU0NDQ1NTI4ODU1NDUy
MzIyMzQzNzo6Nzc3MjM1NTM3NTU3NzU1Nzc4NTc0NTc5NzQ0NTk5ODg4NDU1NDU1MzU4ODk3OjU3
ODc0NTE4ODk3NDQ3NzM3NTg0NzQ3Nzc3ODs7NTg3ODc1NTU3NTg1ODU4MzQ1Nzs7OTc1NTc9Ozk5
OTU4Ozs4PDg1NzU3NTU1ODk1NT47ODQ3ODUxNTg4Nzo6NTU6NTUyNTg3MzU4ODU1Nzc5NTc1NTg0
Nzg1Ojo1NTUyNTc0NTU1NTM1MzM1Nzw1ODU1NTU1OTc0MzQ0NTQ1OjU3NTU3NTQ0NDU1NDc4NTQ0
Mzc1MDQ1NTU1NTcxNTU5NzU0NDg1NTQ1Ozs1ODo1NTU4NTo5OTg3ODU1NTc5Ojc1NDQ7ODU1ODU1
NTk1ODU1OTk1NTc3Nzs8OTs5Nzg4Nzk1OTU3OTg1NzU1ODU1OzU3NTg1NDU3ODU5OTk5Ozg5Ojo6
Ojo3Ozo3Ojk1Ojs4Nzc6OTc3ODo4Ojo6OT06Ojw4ODw8PDg1NTo3ODo5OTk5NTo9Ozs5OTo8PTU6
ODo9Ojo7OTg7PTw5NzxAOzc9OzU5PDs1OTo8PDs6PTo6Ozg5PD4+PD5AOzc6PDs1Ojc9PkA+Pj48
PD08PDs8Pjw9Ojk6Ozw5Oz48PD0+Ozw8Pjw+OTw5Ozo9Ojw8QTw5Ozw5OTk5Ojc5Ojo5PD5APjo6
OTw7OjVAPj07PT47ODk5Ozk7Pjs8Ozw7Ozs6Ozs6PDo9PDw4ODU4PkA9Pjw6ODo5PDs1Nzo7Oz48
OTs8ODg6Ozk4PTk5PDk3NTQ1ODs7OjU3OTc9Ojg8Ozw5Ojo6Ojo9Ojo6ODw+OTw8Ojs5OTo5ODs4
Ojk1NT06PTo3ODg5ODk5PTs4ODw3OTo5Ozo8OTs6ODo9OT08PT08PTw+QD48NTc3Ojo5PDs6Pjw5
OTs7Ojk7PDo7PDo6Ojw4Ojw6Ojo8PDo6Oj09Oz08Ojw8PT47Pj08PTs7PT46PT48Oz4+Pj48Ojs+
QTw9OkA9PD4+Ozk+Ozk5Oj07PDw8PTo8Pjs4Nzw8Ozc1PDo7Pjw8PDg7Ojk7PDo8Pjo3Oj07ODo8
Ozc6Ozo6Ozs4Pjs7PDw9OTs5OTw8OT03Ojs8PDk1PDw9Ozs6Nzk8Ozs9OT05Oz09OTo7PDw7ODs7
PUA9Oj48PTk3Ojs7PT09PDw9PT07Pjo1Oj0+Pjo4PD04Ozo5Pj05ODcwMjQxMjAyMDAyMjI1LCww
MDExMjExMjIzMjMvLDEwMi8wMDQ0MTUzNDAvLzIyLjIyMDIyMS8uMjUyNS8xNTMwMDAyNDQ0NTE0
MzI0My4wMjUzMTQxLDIyMTM0MTE1NTEwMzIwLzEwMDEzNDQzMS8zMDAyLy8zMzEvMjU0MDEyNDUz
NDUxLzAsMTEwMTQwMDMzMjU1LzAzNTMzMzIxMjU1MjAuMTIyNDArMDQxMjQwMi8xNTUzLDEzNTU1
NzgzMzUyMjQ0MjMvLzAxNTg0MTI0MjEvLDEuLjM1MS8zNTIuMDAuMTI1Mi8wMzc0MjQyMTEvMzAy
NDMzNDE0MzQyMS8xMzEvLzMyNDExMTMzMzIyLi4sMTMxMDIyLjMyMjIwMzM0MzM0MzIwMS8xMjAx
MTIwMTM3MzAxMDAyMjIyMzM0MDAwMjM0MS4zMzMxMTEwLC8xMzI1MTU0MjM1MjExNDMxMTUzMy4x
MDMxMTMwMTAvMjM0MzQ3MzIzMzM3NTQ1NzMxNDUvLy8zNTUwLy4uMDU0Mi8zMzIyNDQzMzEwMjMz
MjQ0MjMyLzE1NDQ1MS8xLDQ1MzU4OTUyNTQ1NTQyMjUxNDE0MjA1ODM1MjMyMDExNDMxNTQ0NTU1
MTIyMTMyNDI0MDAzNTU1MzUyNDU1NzMwLjE1MzAyMDAzLzIzMzQyNDQ1NTU1MzU0NTIzNzU1NzM0
MjE0NDUyMzEyNTQ1NTUyMTM3NDQyMDQ5ODk1MTIzMjM1NzUzNzIzLzA0MjEzMjI3NDMyMjExNTUz
MDAvMjMzMS81NTQ0NTI0MjUyMzMwMjI0NDU3NzI0NTU0MzMyNTQzNDU1NTg3ODQ0NDU1NTUzMjUy
NTg0NTU0MDExNDczMTUyNDc5NzI0NTU0ODQwNTQ0NzUyMDM0NDQyNTg1MzQ1ODg1MjMyMDEyNTQz
NS8zNTUyLzI5NDEyMjU1NDQzMjI1MS4wNDQxMDMyNTUzODk1NzQvMDQ0NTEzMzU0MzEyNTU1NDM3
MzQzMzQ1MTQ1MjI0MzU4OTc1MTU1Nzc3MzMzNTQ0MjQ0MjU1NDM0NDQyMjU3Mi4wNDM1MjQzMTQ1
NTcyMDE0NDMzNTUyNDQ0NzU3ODc3NTc3ODczMjU0MzU0NTUzNTQyNDU1MjMzNDU4NTU0NDQ3NDAx
MzU5ODUzNTI1MjQ1NTUzNzQ0NTg0NTIyNTQyNTU1MzU1MzUyMTUzMzUyMjEyMzU1NTU1OTUzMzk4
MjU7ODU0NTc1MzQzNTgzNTc1NTc7Nzg1NTQ5ODU4OTg6ODk8OD04MjMzNzg4NTU4OTc5Ojk+PDo8
Pjs5Nzs5PDg1Ojk5ODc7Nzk7OTg7Nzo6OTU5Nzk6Ozk5Nzk6Ozc6ODc8OTU4ODk5NzQ3NzU5Ojs6
ODU3NTgzMzc4OjU4ODU1OTQ5NTc5OjU5NzU0Mjc5ODU4OjUzMzU1NTkzMzc4NTU1Nzo3MjU8Ojg5
ODU5OTgxNTk1NTc4ODc3Nzk1ODg3Nzc3Nzk0NTU4ODo1Nzk5NTQ3ODU1Ojo3OTc3NTg4NTo6NzQ1
OTk1NzU1MzE4OjM1ODg1NzEyNTczNTQ0NzU4ODU3NTU1NTczMDU1MTI1OjMwMTU1NTQ1NzMvNDgz
MzQ1NTU1NTMwMzU0NTc4ODgyNzc4NTg5NTU5Nzk5Ozo4Ojc5OTg5Ojo1NTU4NTM1ODc0NDc1NTc1
NTU4NzU1NTUzNDc3NTU1ODU1Nzc3NTg6ODU4Ozk4NTU6Ozs3ODc1NTQ1OTozNTg1Nzo1NTU4ODc1
NTg1NTU4NTs6NTo7OTc1ODU0NTUzNDU1NDk1NTUzMjUzMzU1MzU1MzU1NTU1MzM0NDUyMzg0NTk1
NTU4ODU4NTMyNTc1MjIwNTo4ODM0NzUyMzU4Nzg4NTIxNTc4NzM0Nzg9OTk3ODw5MzM0NDQ0MzU1
Ojk5ODc5OTo4NzU1MzU5NTM3Nzo4Mzo7ODo6ODc7PDo1NDU5OTc6ODU4NTg3PTg5Nzc7ODk5NTg4
ODc3OT07ODU3ODs7Ozo8OTs4PUFBOzo5Nzg5ODk5Ojw5ODo5Oz09PTk5PDg8OTo1Ozw9PDo4OT47
PDg4PDo8Ozg8OTw5ODk8PTw7Pjk7Oz08PDk4PDc7Pjs8OTs+PD49Ozk9Ozs7Ojc4ODs7Ojc4PkE8
Pj48PT4+QEA+OzU7Ojw6OTo5ODk7ODo7ODw+OTo7Ozw5PDs8Ozw6Ojs6Nzo7ODs8PDs6PD08Ozo7
Ozs7Ozo5Oj07OT07ODo1OT47OTs3Ojk5Ozs8OTo4PDs7OTs6ODw7ODc9OTk4Ojg9PDk4Ozg6PDk4
Ojc4PT04Ojw5Ojo4PDw8Ojc7ODc6Ozg7ODs7Ozw7PDs3ODo5ODk4Nzk5Ozs4PTk5Nz49PTw1OTs7
PDU6Pjg4Ojo+Pjk5Nzg7PDs6ODk8Oz48Pjw7Ojc4OjU5Ojs+PTk9Ozs8Oz0+Pj06PTs5OT0+QD48
Ojs8PDw5PDw8PTs8Oj07OT4+PD07Oz46PTs5Ojs5Ozs7Ozk6PkI7PD5AQT09Pjs8Pjs8Pjs7Oz4+
OTk9Ozs3Oj0+OTk8OD0+OTg8PTo6Pj08OTs6ODw7OTg6PDo6Nzs9PDo4NTk8OTo6ODs6OjU8Ozw7
ODg1PTs1NTk4NTc4PDg5ODo7Ojs7ODo8Oj05OTs4Oz06Nzk7ODg8Ojw7NzM4OTg+PDw6Ozk3PTw8
PUA6OTo1Ojo5Ozo+Pj05Nzw7Nzg6Ojc5Ozk5ODk5ODs+Ozs+PC4zNTUyMSwsMTUyLjA1My4vMy8v
NTU3MjExMjMzNTQzMDA0My8xMTExMjI0MzAwMTA0NDMyMjIyMjUyMDMzMjIyMjM1Mi8zMjMwMTAw
MzMxMzMzNzMvMzExMDIxLy8xNDExLjI0MzIwNC8wMzMzMzEwMDEyMSwvMC80MzA0NDMyMzUvMjE0
MzQwMjQxMSwxLjIzMjEzNDQ0MTMzMDIyMzEzNTQzMzI0LzMzMjE0MDIzMS4sMTQxMC8yMjAxMDIx
MjQzNTIzNDAxMTEwMjAxMzEuMTMzNC4yMjAwMC8sMjAvLzAvMi8wMzIxMzAyNTMzNDU1NzU1NTc1
MzIxMzM3NTU1MzE0NS8zMzEyODo1OTMuMjA1NDU0MzQ1MzMxMTQ3ODQyMzU1NzM0NC8zMjAyNDI0
MzQzMzAvLDEzMzMxNTEzODUyMjUyLzE1NTU1NTU1NDI0NTU0NDM5Nzc1NDQxMzU0NTQ0NDU1My4w
MTA1My8xMjQ0NDU3NTU1NTMxMTIzMy8zNTUyNDk0MjI1NzMyMjE1NzIzNDQyMTQzNTE1MTUzMjIz
MzUyNTUzNTM0MzIzMzQ3NTU1MzM1MzI3MjUzNTMyMTU1NTc0MTExNDQ0NTQzMDEzMjE0MjAwMTQ1
NDcyNDM1NDMzMjQwNTc1NTEwNzQ1NDI1NDIwMzMxMTQ1MzQyLjExMTEyNTU4NDUzNTU0NTQxNDU1
MjU1NDU6NDMyNTMwMTU0NTUxMzI0OTgzMzU1OjQyMDEyNDE1NTQ1MzUxNDQyNTM0MTIzMDI3ODg0
Nzo4NzMzMzI0NDc1NTQ1NzU1OTk3Nzc0Nzg1NDU0NDk1NTU1NDQ1NzU0Nzg1NTU1ODM1NTU3NTc4
NTExMzM1NTU1MzUzMjU0NTQzODo4NDA1NTE1MjMzMDU1MzM5NTIzODcyNTI0Nzc3NTQzMjQ1MjI0
MzM3NTMyMzM0ODs0MzQ1NzU1Nzc4MjE1OTU0MjEyNTMyMzE3OTU1Ozc0MTEzMTU1NTk1MTEzMzEz
NDEvMjUzNDg1NDU1NTU1ODQ1NzQ0Mzc1ODU1NDU3NDA0NDIxMjIyNTc0NTg3ODU1MTAzNTU1NTU0
NDMyNDg1NzQyMzQyMjAzNDU1NTM1NzUzMzM1NDU0NDI0NDU3ODc0MjM0Nzc0MjM1ODgyMzM1NTQ0
MTU1MjA1ODQ1NTc3NzU0NTM1NTM3NTU0NDc1MjM3ODg4MzQ0NzUzNzcyNzU6OjU1NTQ0Nzk3NTU5
NzI3NTM0ODU4Ozs3NTU7OTg5OjU0NDU1ODU4Ojo9PDk5ODo8OTc5PDw5Ojk1OzU3OTc5PDk6Ojs4
Nzc4ODk3NTQ5OTU4PTo8NTU4NTQ3PTc4Nzw9Ojo4NTM1NTU5Ozs4NTc4PTg5Ozc4Ozs6PT46Ozg3
NTU5Nzg3Nzg3OTgyMDU6ODk5Nzk6NTc1NDU6NDU1Mzg3NTIxODc5OTk4NTc1NTM0NDU0OTU1Nzc0
NTU5NzU5ODU1NTU1ODQzNTUzMTQ1NTc0NDI1NTQzNTU1Nzk6Ozc3ODg4Nzc7ODk4NTU1NTIyMzM1
NzU1MzU1OTQ0NTc1NTQ1NTo4ODgzNDU1NTg1NTc4NDU3NzQ0NTU1NDU1Nzk6NzU1NzM3NTs4NTI3
NzUyNDM5OTU3OTU6ODU4NTQ1NzU1Nzc7NTc1NTMzNTU3OTU0NTg7OjU1NzU1ODo7Ojs1NTk5NTU4
ODc0Ojs7NTc3NDU5Nzo6Ojo4OzQ1NTg1OjU6OTs7OTQ1NTQ1Nzc4ODc1NTQ3OTUzNDc6Ozc0Ojk3
NDc1ODU1OTU1OjU1NTM1NDU1NTU1NTU3NTMxNTc1NDIzMzUzNTU0NDQwNTU0OTc0NTc1NDc1NDUz
NTQwNTc4NDI1NTk0MjIxMzU1NzcyNTg1MzM0NTk5NTU3Nzk1Mzc1Nzc3NTk1NDQ3Nzw5NzU1NzQ4
NTc0NTo1ODc3ODs7ODg6OjkzODk3PDk4Ojk1Nzw5Ojg3NTc7ODk5NTk4O0A5Nzo1NDk4OTU5Ozo5
OTw7PT43NTU9Nzk6ODk7ODc1PDs4OTw+Ozo5PkE+Ojs8ODs6Ojc1OT07ODg5PDs5Ojo8Ozs+PTw+
PD06Ojw7PDU1Nzs9Pjw6NTw9PTc4OTk4ODo7Pj4+Pjo7PD08Ozs7Ojo8PDo8PUA+Ojo+PkI9Oz08
NTg7Ozo4Ojw9QDw4Pj07PTk8PDo7OTg+PT06OT06Ojo7Ojw6PDk6PTc6Nzk6Ozw9Pjw9Ozs1Mzg5
PTs1OD49PTg6PDo4OTo6PEA8Ojw9PT07Nzg4PD4+OTs7NzU4Nzw8Oz48Ozs5NTs8PDs6Ozg8Ozg8
Ojk5OTw5OTo5PDo3Ojo6Ojg4Nzo8Ojw8Ojc3Ozo7Ozo7PTs7Ojs7Ojw4OTs+PTk4Ojw+Ojk4OTo5
OTo6PT09PDg5ODk+OTw8Ojg5Ozs6OTo8QDo6Pj04Ojo7ODo7Ozs4NzlAOzw9Pjw5ODw7Oj08Ojc5
PD07PTw8PDo9Pjs8OTw8Ozo+PDo9OTo8PDs6Oz09Oj07OD08PDw7OTk8Ozo6NTg4OTg9ODg7PDo8
PD09Oj06Oz0+OTs9PD08PDo7Ozs+NTg7PDk4Nzk5Ojo8OTk3PDs6PDs7PUE7Ojs8Pjo5OTk6PDg5
Oz06Ojo8Ozw7OTU1NTg3Oz09Ojs5PT06OTw9Ozc6PT08OTU1OT4+Oz09Ozg5OTg9Ozk6Ojg5Pjs5
OTk8OTU3Nzg7OTk8ODo7NTk9PTs3OD09Pj48OTo8Ojw7NDMyMi4wMiwxMTAzMjU0MjQ1NTE1NDQz
MjMyMTMxMTAzMzIwMTE0MzMyMC4yLi8zNDIzMTExLzIxMS4yNTUzLjIwLy8sLjExMzQsMS8uLC4w
Mi8zMzIyNTAyMjMzMTU3NTIwMjUzNDQxMDQ0MzUzMzMwMDMwMTM1MzIyMjIxMS8yMjIyMTAzNTM1
LzU1MzEwMDEzNTMzMTEyNDUzNTMwMjEwMDEyMTQxMjM1NDMzNTMzMTQzLDIyMjEwLzAxMTM0NTE1
MjEzNTQzMTMyMzUzMzM0MTMyMzIxMzMyMTE0MC8yMjU0NDIwMjExNDUzMjI1MzMwMTMyMjIxMzI0
NTExMTQzMjIzMzEyMjMyMTA0MjAxMDMzNDczMjIuMzEyMTQ1NDUzMTU1MzMzMTIyMTIyNDAwMjEx
LjEvMTA0MC4wMDIwMzUxNDEwLzI1NTEwMDQ0MTMzMjUyNTU0NDQ0MzMvMjExMzU1NTUzMjIzMDIv
MTgzNDQzMzExMTU1MzQ1NDM1NTEzPDg1MzU1NTMxNDQzNDI0MzU0MzE0NDU0MzI0NTU0NDQzMzUz
MjUzNTMwMzUzMzA1NDQzMTUyNDU1NTU1MzUzNDczMjQ3MzM1OTUyLzQ1NDEyODU1NTQ1MDE1OTUw
NTc0NTM0NTUzMTExMTIxNDQzNTMzMzE0MzIxMjQzMzQzNTQ3NTU1LzEyMzA0NDUzMjU4NTMxMTUy
NTQ0NTMxNTM1NTQxMzg4NTUzMTI0MzUwMjc3MzUzMjM0NDA1MTIzMTE0NTQ0MjMxNDU1NTgzMTI0
MTU1NTU0NTU1OTU1MDU4NTU0NTc3NDAyOjU3NTU1MzI0MzQ1ODc1Ojc1NTc1ODU3ODU1NTUzNzc4
NTM1NTI1NDU0MjQ1OTUzNTk4NDMzNDU1NTU0NTU1NTU0MzMxMzU1MzU4NTIzMzMzMjIxNDU1NDM0
NDU1NzUzMS81Nzc1NTM0MTA1MzQxNDUyNzU1NTMzMzM0MzI1NTU3NDMwMjQzNTQyMjAwMjU0Nzc1
MTAuMzIzNTUyLzQ3NTc4MzMyMTEzNTM3MzI0NTU0NTQyNTM0NTM1ODU0NDU1NTI0NTQ1NzU0MjIy
MjM1ODI1NTUyNDMzNDM1NDAyMjI3MzQ0NzU1MS80NTc3NTg0MjEwMDI0NTg1MzU1NTc1NzI1NzU0
NzU0NDk3NTk3ODk5NTU3OTU0NzU3ODU1NTU4NDEyNTQ0NTg6NTU3NDM0NTo4ODU1NDk6NTU1Ojw4
OTo8Nzc5Ozk5ODU1ODc4Ojo3OT07Ozg6PTo4ODo7Oz47OTo8OTU0NTw6Ojg4PDo5Nzc1NTo4ODk8
OTo3Ojo4OTs8Ojk5Ozs4Ojk8NTg3NTk3NDs4NTk3OTU5OTc0NTc8Ojo4OTo6ODw7Nzc6Ojg1NTk5
NDU4NTg4NTM0NzU3OTQ0Ojg1NzM1OTU1NTc7OTo5NzM1Nzo5NzU1NTg3MzU3Nzg3NTg1NDc1NzM1
NTc3NTk6PDU0NTU0MTM1NTU4NzM7NzU3Nzc1ODk4MzU1ODk1Nzk6OTU0NTU1NTg4ODU1Nzc1NTMz
NTU4NTQ0MjQ0NTU4NzQ1Ojc4OzczNTUzMzM1NTU1NTM0OTU1NTk4NTg1NTg6OTc3NTU1NzU4ODw5
ODk1NTQ4OTkzOTc1NzU3OTc1Mzg3NTM0NDc6NTU5Ozs0NDg4NTU1NTQyMTQ1NzU5OTk6OTc7Nzw4
NTc3OTk4NTU1Nzc3Ojk6Ojk6Ozw5NTMzNTk6OTk1NTk5Ojo4ODQ1ODU1NTU5NDU6OjU0NTc0NTo4
MzAxNDs4NTUyNDQ4NDU3NDU6PDc3NzQ3OjU0Nzc1ODc1NDM1MzIxODIwNTU3NTIzMjU0MzE1NTM1
OTU5NDExNTc1NTMzMTE3NTQ1MjQzMjIwMzc1OTc0NTg4NTUzMzQzNDc3ODc1NTk1NDMzMzE4ODU5
ODU5Nzc6NzU3OTM1NzE1Nzc0NTo1NTU3NTU4PDg6Ozg6Nzs6Ozk5OTg4NTg1MjQ4ODg4Nzc1Ozg1
Nzs6OjU1Nzk5Ojk3OTo8PD05Nzg7OTk7PTs5Ozo7Ojk3ODc5Ojk5Ojg4Oz05NzU6OTk8OTs9PTg1
PT49OTo7ODk6Ojw7Ojo6Oj05ODs9Ozo6PTw3OTg4Ozw+Pj0+PT47OTw7ODo+OTw9PDs1Oz48Oz01
ODo7Pjs8PkA+Oz0+Pjs6Ojw+Pj49OztAQD09PT49OTo+Pjo9OTU4OTg5Ojo7PT08QDo7PT4+Ozo6
PTo5OTc7Ozo8PD48Nzs7OTk8Ojs7Ojs+Ozk7Ozo7Ozk3OTo9Pjw7NTc7PTs4PDk3Nzk4ODg6OTo5
Nzg5PDw7NTc1PTw5NTo7Ojs4OTo7Ojs6Ozs6Ozo4NTg8Ojw+PDs6Ozk7ODw8OTo6OTU6Pjs6Nzs8
PDk8Ozs5PkA8OTc6Oz5BPDo4Oz4+PTk8Ozw6OD08Ozo+Pj09Ojs+PDs5PEA9PDs7ODs8PD09OzxA
QD4+Pjs8Nz06ODs6PD06Ojk9Pj07Nzo+PTs9PDo9Ozo7PT09PD06PDxAQDw7PT47Pj09PDs6Ojw8
Pj4+Pjk6OTg5PTw6Ojw9Ozs9PTc8Ozs9PTc9PTs6Oj4+OTw9Pjo5Ojs9PDk7PkI7Pj4+Pj04Ozs8
PDw8OTc8Oj03Oj47PTs9Ozo4OTs4ODk4PDs6PD09Ozo6PDs5Nzk9Pjs5OTg7PDo5PT4+Ozc5QD43
NTs6PDk6PDo6ODg5Ojk6Ozk6OTo6OTk8PTw7OjkxNzIyMi8yNTMxNTQxMTAyMTIyLzExMDUyMzQ0
MTIzMzEwMTIyNDQsLC8zMTIyMjExMjEwMjQyMjIyMjExMjAxMTIyNTAuMTMyMjIwMTQ0MzM1MzIz
MDEvODUyMzE0NTMzNDUxMjIyMS8vMjQ0NTIyMTExMzczMS8wLzAyMTUyMTQwMzU1LzMyLyswMC8s
MTAwMTEzMjIxMTMyMzAsKzAxMTEwMTA0MjIxMzIwMTAyMjQyMTQ1MzUvMTIvMjMxMjMzMzMxLjMw
MjUyMDEwMDM0NDIzMTIwMzQ0My8vMDE1NTUzMTIyMTIxMjIzNDIxMDIzMzEzMzQyNC4wNDEzNTMx
LzAyNDAuMTQyMzEyMTIzNTQ1MjIzLjIuMzEyNDExLi8xMTQ0LzEwMTE0My8wMjI0NzQxMzU0NDIy
MzEvMzQ1MjQ0LjAxMjIwNDUyNTU1MjAwMjIzMzIzNDU0LzAvMTQxMDU1MzU0MjE0NTUzNTQzMjM0
MjAyMTA0NzcyNTQ0MjQyLzAvMS8xMjAxMjQzMjg1NDIyMTMyMzQ0MjQxMTM0MjM0MjM1NTc3NTMz
NDU4OjUyNTU1NDMzMzI0NTEzMDQ1NDUzNTU3NTUxNTIwMTQ0NDcxMzEzNDU1MjQxMjczMTEzNDQ0
MjU3Mi4yMTUyMCwyMDA4NTIwNTM1NDg0LjQ1MjIxNTExMzQ1MjM1NDEwMzIvMTMvLzE1NTUwMTU0
MDI1NzcyMTAyMjQ1MzMzNDQ1MjUzNzkyMzUyNTczMjI1NTMzMzU1Nzc1NDUzMDAyNTQ0NTUyMDU1
OTEyMDUwNDUxNTUyMzMzMzc1NTU1NDQ4NTIyMzQzMTM4ODU0NTUwMjIyMzM1NDIyMzc0MjQ1NTUy
LzIzMjQ0NTQ1NTc4NDQ0NTU0NTU3NDU1NzU4NTIxMzQ3ODQzNDg1Mzc5OjUzNDQzMzE0OTcyNDc5
NTc1NTg1NDQyMzc0NDQ1NTU1NzE1MjU1NDQyNTUyNDUxMTI1MzEzNTU1MzU0MzM0MzMuLzQ1MjQ1
NTM0MTQ0NTUzMzU1NDc1NTMxMzM1NTc3NTQ0MTQ1OTg1NDE0NDI1NTU1Mi4zODcyNTQ0NTQ1MzM0
NTczMTE1NTU0NDQ1MzQ1NzU1NTQ1NTc4NTU0MjQ0NDI1NTQ3NDMzNDQ1NTU0NzIzODc1NTQ1MzQ1
MzczMTU0NTAxMDQ3NzU1NTU1NDI1NDQ1NTQzNTg4NTMzNDU4NTI1NzU3Ozo1NTU1Nzg1NTU1NTU1
Nzg4Nzk3OTs6NTc4NzUyNTg3NTU4OTs4NTo5OTo5Pjw3NTs6OTU3OzU4Ojg6Nzc6PDk5ODU5Ojg4
PDs4ODU4ODo7PTk5OTk1NDQ1OT04ODo4ODc4OTk1ODU5NTc1Ojk5NzU1ODs5OTU4OTc3OjU1OTo1
NDI1NTg4NzcyNDg4Ozc1MzE1ODk6Nzk1ODk5ODg1NTc3ODc4ODc1NDo6OTo1Nzc0NTM1NTI4Ojs1
Nzg1NTU3NTU4ODQ1NTc1MzU0MjMzNTU1NTU3MzU1NTc1NTU7OTU1ODgyNDU1NTQ1MzU1ODs4NzU1
NzU1NDU7OTk4NzQ3OTc1Nzo4OTc7Ozs5Ojc0NTg1ODU0Mzg5OTg3ODo8OjcyNTQ5Ojo4OTU7Ozg1
NDQ1OTc1ODc7OTk0NTU0NzU0NTc5NTQ3OTU4NTg5NzU1NTI1NTg4MjM1OD04NTg4Nzc5ODU4Nzc4
ODc1NzU1Nzg3OTk1NDc4NTc8Nzk1Nzg4Ozs3Ojs7Ozk4NTU3PDU0ODo3NDc3NTU4Ojc0NTc3NDUy
NDU6OTc3NTk1MzU3OTU0NDU0NTI1NTIyNTMzNTU0NTMxMTMzOTU1MzEwMTM3MjE0NTU0NTQ0MzMz
MTM3NTQ1MzQ1NTk1NTM1NTU1NTUxNTc3NTQ1NTU1NTU1NDk7NTc4Nzk5NTQzNDU3NTg1NTcyNTc1
ODc1OD07Ozk4OTo5NTc6NzU5NzI1Nzc7NzU5NTc3O0A7NTc7NTg7PTw3NTs7Ojw7Nzg4Nzg4OTk3
OT4+NTg4Nzg3OTg1Ojk5Pj48Ojo5ODs6Ojw7Ojw6PDw7OTo6OTQ6PTo1Oj07OTw8Ojg8OTg9OTs+
OTg5OTc6PDxAPTs9PTc6Ozc1NTs7PDg4ODo7Nzk5Nzo7Ozs+Pj09Pjg4PDw6Ojw7ODs5Ozs8Oz09
Ozs6Ojk5PD06Pjs4Ojo5QTs6OD47PD08Pj06Pj46OTk5OTs+PDc5Ojw8ODs9ODk7PDk7Oz07OTo9
Ojw5Ozs5Ojk7Ojo8Ozk5PDs6OjU7Pjs9PTs8Pj45PTs6PTs0Nzs6PTk3Nzs7Ojg3OTg8Ozs1NTo3
Nzo5OD06Ozo7NTo8PDw6Nzs8PTs6Ozo4OT49Ojk3OTo5Pjs6ODo3NDU7Pjs7Ozw8Ozk4Ojw7Ozw5
PDw7OTxAPTw+Pjw5Ozc6Pjo9Pj09PDs7Oj45ODo5ODs8Pj46Oj48PDs7Pj49Pj06Oz09Pjw8PTo7
Ozs6OTg4Pjo7PDg6Ojo5Ojs+PDk4Ozk6Oz09Ojc1Ojs1ODk7Ozc5Pjs5Ojo5Oj49PDo8Ozg6QD48
Ozg6PD09PTs7Ojs7PDo6Ojs4NTo4ODs7Ojg4Nz1APDo7PTo7OT0+PTo5Pjs7ODU4Ozo+QUA3PDk5
Ojk+Pjg3Nzk7PDw6OTU7Oz0+OTk8NzU1PD07Ozo9PDo7OTs8Ojs6Oz48Ojc8Oj05ODs+Ojo8PTs9
Ojg4ODc4Nz44PD44Ozo3Ojo7ODo6Ojs4PS8vMzc1NTQzMzIzMTI1MzA0ODAuMDAzMzEwMDEwNDQ0
NTUzLjEzMjIwLzI0MzIxMDE1MTM0NTc1MzU1MzMxNTM0NS4yMTMzNTEvMDEvNTU4MzEyNTIxLDQ1
MzIxMjE3NC8yMjUyMjM0NDUzMTIxMjIzLy8yMzIzNTIvMDE1MTMzMDUyLiwwMDQzNDMxMzMzLzEz
My8wMTQ0MDAwMCssLzE0MjE1NTM1MzAzMzU1MzUzMS4wMzMzMzIxMTEyMDEwMS8xNDQzMjIzMDUz
NTMyMTMwMjQxMjMwMjQyMzExMjEwMDIxNTMyNTU0NTIwNDc1NTIvMjM0NDQ1MjAyMzIzMjEuMjI0
MTAyMzczLDAzMzEzNzczNTMwNTQzMDE0NTUxMTUyMTAyNDQyMDE0NDU0MTMyMjIzNTQ0MDQ1NTAx
MzM1MS8wMjIyMjQxMjExLywxNTU0MzU0NTczNDU1NDU1NTU0MjQyMzMyNzI1NTQwMjUzNzg1NTU1
NC8yMzM0MjU0MzQ1NTUzNzQzNTQyODc3NTM1MzQ3NDc1ODUxODU1NzU1NTU1NDUyMjUxMzUzMzM1
NDc1NTQ0NTUxMzUyMjI0OTg1MjUzMDQ3NzUzNTUyNTU0MzQ0NTM1MjQxMTMxMzUzMTI0MTQ3NDU1
NTU1MzEyNzcyMTUyNzU1NDIyNDI0NDU0NTUzMTQ1ODU1OTU1MDIzNTIzNzQzODMzNTU1NTQyODQ0
NTMzMjU1NTM1NTQxMDAyMzg1ODg3NTEyNTIxMzEzNTIzNTU0NTg0MjQyMjQ1NDgzNTI1MjM1NTcz
NDMzMzMzMzAvLzMzNTU0ODc1MC80MjU1NTU3NTQxNzU0NDQ1NDc1NTU1NTU4NzQwNTU1NTM1NDQ1
MzQ1NTI4Mzc7NTQ0ODIyMzIyNDIzMjI1MTEzNTQzNTMzLy80NzE1NTc1OTUzMjEzNDU6NTU1NTc1
MzU3NTg3Nzg5Nzg1MzU1MzUyMTUzMzAzNTM1NTU0NTU0MjQ0NTU1NDg1MzExMjIxNTU0MjEyNDU1
Ly80MzIzNTA1NTQ1NTMzNTUxMjQ0MzQ3NTMzNDQ1MzM0MzI0MzQ0NDU0MzU3NzU0ODIzMjc1ODg0
NDQ3NTI0NDQyMjQ0NTIxMDMyMTQ3NTU1MjM0MjczNTg1NzU0NTU0NDQ1NTU1NTM1NTU0MzU0NTU3
MjU4Mzc6OTU0Nzc1NDUzOTUzMzc3NDQ1NTM1NDQ1MjM1ODo3OTc5PDk4NTI1NTg1NTM5NzU1ODo0
PDg1Nzk9NzU3NTc1NTQ1NzU3MzU4NTc4ODc1PDc3ODk3OTk7ODU5Ozs3Oz4+Pjo6ODc3NTU3NzU+
PD45Ozc7PDc3Nzg4Oj09Pjw5NTk1NTUzNTo4NTU1Ojo5Ojc4ODk6PDk1OTo8Ojo5Nzk3Ojk1NDU3
NTo4NDQ4ODQ3NTQ1NTc1NDU3ODo4NDU3Nzg5OTQ1NDU1OTU0NTc3MzM5NTU3OTg3NTk0NTQ0NTU1
ODI4NTc1NTQ1OTU1NzUzODk6Nzg7Ojo5NTc1NDU5NTU3MzM1NzMzNTU1Ojk3NzU4ODg4ODg6OTU1
NTM0NTg+PDk1NTQ3OTo1MTQ1NTQ3NTU7Nzc5NzQ5ODk3NTo4NzU3ODk6NTQ1Nzc6PTgzNTU3NDg1
Nzc1ODw3ODc4NzU0MTU5Nzk6Nzg4OjU6Ojk3OTo6OTc1ODk3Nzk7Nzc6OzQ1NzU3NTQ1ODg4ODc7
NTo6NTg5ODc1NzQ1Ojs1Nzo7Ojo3OTc3Nzo1OTU3MTM3OTU1ODc5OzU1ODc1OTg4NTc4NTU5Ozk4
OTc3ODg3ODQ0MjQ0Nzk3NzQwMzc0NTQ1NzQ1NTQ1NTMyMzQ1NTUyMTQ1NTQ1ODg4NTg1MzM1NTU1
NDMzMjMyNDQ1NTcxMzU1MzIzMjIyMzc1ODMzNTQ1OTk1NDU3NTU4ODk4ODU1ODc3ODc1OTg4Nzo5
OTo6NzI0Mjo7Ojc4Nzk1Ojo7NTg7NTU3Nzk7Ojg4NTs7Ojg4Nzc1Ojk7Ojo1OTs4Ojo7Ojk7ODw4
Oz01NTo3PTk1Nzk4PT49PDs1Ojk7ODk1ODU5OTk6OTU1ODs5ODg0Nz07OTc6Ojs4Ozg6Ojw7Ozo+
PDw+PDk7ODc5PDw5OT48Pjw5Oz4+Ojo8Pj08PDw7ODs8PDs8OTo8PTk6PTw8Ojo4PD48Oz4+Ozo3
OT09Ojs9PTw9Ojg1Ojc7PDc5PD09PDw9PD47PDw7OTk8NTU3Nzs6Nz07Ozk6PTo6Ozo+OTs7PD06
Ojw8ODg7Ozs8OTg5Ozs7Pjk8Ozw5ODk3PDk7Pjo6ODo3Ojk4Pjs6ODg7PEI9Nzo4Nzk6OTk5NzU6
NzU7ODg6NzU4Ojg4ODo4Ojs5ODo5Ojw9Ozg7Ozk4Ojo+PT06Ojw7Nzo6OTk5Ozs5ODo8Ozo9OTQ8
Ozw9Ojw9Ozs7Pjs5ODU6PTw3OTs+ODo9Oz46OT4+PTw6Ojs6OkE+Pjk6ODg4ODs3ODk7Ojs9PTo4
Pjw6PTs4Nzo6ODs9QD49QD47Nzk9NTtAPj07PD0+Ozk6OTs8PD08Oz4+PDs7PTk3OD49Pj47Ozk6
Ojw9OTxAPD49QD06PT08OTs8OTs6PTs+PTw9PTw7Ozg5PD09PDo7ODk1ODo8Ojo7Ojc9QD08PDs+
Ozo4Nzs8Pj04Nzg5Oz06Ojg+PTk9Ojg3Ojs6Ojo7PDs1OTk6OTs8Ozg8Ojk1Nzk6Ojo+PTo5Ojg9
PTw+Pjo5ODs4Nzw8OT08O0A+OTU3MzEvMDI1NTIyMzAxMzEyMDEwNDczMDIyNDAyMDExMC8vLjEz
MTEvMDEyMjAwMDMvMjIwLjMyMzMyMzIxLzI0LjE0NDEyMy8sLzAzMzIxLzAzMDE1NTQzMTAxMjIx
MTIzNTU1MzIzMC8yMjQxMDQxMS8xNTM0MzEwMjAxMC8xNTUyMTU1Ly80MzQ0MzIwMTQ0MjIxMDQ1
Mi8yMTAzNDQwMjM1MjMzMzQ1MjIwMjUzMS4uNTM0MjA0LzA0MTIyLy8wMTIxNDQzNTMxMjc0MzIy
NDU1NTQ3MjAzMjEzNzQzNDMwMTIyMzU1NTc1NTU4NDM1MjAzNTIyMjM1MTIwLzM1NTM0MDMxMjAv
NDM0My81NTUwKzExMDIzMzEwMzEwMCwwMy4vMjMwNDEwNTUyMTMxMDAuMDU0Mi8wMjEwMjAyLzIy
My8yMzM1LjIzNTMxNDU0Mzg1MTExLzMyNTczNTQxMzMyNTU0MzQxNTU0NTU1My81MjE0MzM0NTMz
NDMyNTQzMTQ3NTU1NTEyNTo1NDI1NTI1NzQ1NDQ3NTU1ODU1MzIzNDQzNDE0NTI0MTExMzI1ODIx
MzEyNDUzMTI0MTUyNTMzNDExMjEsMjQxNTM1NTcyMTExMTI0MjE0NTI1NDM0NzU0NTQwMDM0MjM1
NTQ1MjMzNzk1NTc0NDQ3MzIwMDo4MzU1NTIyMDI0MjQvMjMzMjQyMzQyMzQ1NTIxMzU3MzMzMzg3
NDMvMzExLjIyNDU4NDIvMzQvMjM4NDA0MzI1NDM0NC8zNTQ0MC4zNTIxMjUyNDQ0NTQ1NTU1NDU4
NTg4NTQxNzQ6NTM3NTI4NzQ1NzczODI0ODU1NTg3MzM3NTg3NzU1Nzg3NzM0MzIxNDM3NTEyNTUw
MjM0NTgzODM0MzI1Nzc0MzU0NTM1NTUzMzU4NTU1MjU5ODQxMTExNDU3NTc3ODU1NTEzNTc4NzQ3
NTgzNTk3MjM1NzU1MjI0MjU0MDUyNDM1MjQ1NTc1NTU0NTU1NDUyNTg1MzM0NTU3NTQzNTUyNTU3
OzUyMzU1NTU5NTE0MTI1MjUzNDMyNDU0NTUyMTU1NzQ0MjU0MjI1MzI0MjQ0My8yNDU4Nzg1Nzg1
ODk1MTI1NTU6NTU1NTU3MjQ1MzUzNDUzMjQzMzU0NTMxNzU0MzI0Nzk4ODUzNDU0OTU1NDQ1NTU0
NDM1NTg0ODg3NTIwMzUzNzc1NTczNTc1MjEyNzU1NzU1NTg4MzU1NTU0Nzg1NTg4NTc4Nzc6OTg7
Oj05NDU4Nzc1Nzs5Ozs4OTc4Nzs4OTc1NTU6ODg6OTo7Ozw8PT06ODg1NTo6PDs6NTU4OTs4Ojs3
ODk4Ojo1NTc3NTU3ODk7NTo7ODo5Pjs4ODU0Ozs7PD48Ojg7Ojc3Ojs6NTQ1NzQ0OTg5Ojo6OTk1
OTc1ODk0NTM4ODc1ODs3NTU1OTU0NDUzNzc5ODU1NDc4ODU5OD05Nzc5NzM3NzQ1NTU1NTg4NDM1
Nzo4Nzc5ODg4OTw6NTQ8ODUyNTc5NzU0NDc1NTc1MzU3NTQ0NTg3OTo7OTUzNTg4OTU5NTk1NDQ1
MzA0NTk3ODg1OTc1NDk4NTU1MzU3OTc3Mzc1ODU1NDQ1NTU4NTk5OTk1NTo8OjM1MzM0MTI1OjU1
NTQyNDc3NTc4Nzc8NzU4OTg4Ojg1NTU4ODo7NTU1NTg3ODo5Nzc1NTU5OTc1ODU3NzQ4ODU3NTc6
NTU7Ojc1NTc5NzU1Nzc3NTU3NTU3Ojc1NTg1OTc5NzU1MzU1NDg1Nzk5ODU0NzQzNTM1NTUzNTc1
Ojk1MzM1ODQzNTU3NTU5OTU1NTg1MjQ0NDU0NTU3ODIvMzM3NDc1NTU1NTQ0MzU1NTM3NzM1MzU0
NDMwNTU0NDAzMzU1NTQ1MzU1NDQ1NDM1Ojg5NTU1ODg1NTg0NTk3NTU1OTU3Nzk7NTU1ODc3ODc4
Nzk4Nzc1NTo1Nzc6Ojc1ODg4Oz47ODg4Nzc4Nzg1ODg6OTU0NTk6NzM5ODg8PDk5Nzs6Ojc9OTk1
NTg3ODg5Ojk7OTg4Ozw6PDs+Pjo1OTo7PD04OT47OTs7OD48PT4+OT05ODw7Nzo7OTs4OTs7Pjw7
Nzo4OTo+Oz4+Ojs6Ozw9PTw+PTw6Ozo6PTw+PT07QDo4Ozs+PT06Ojw5PD07Nzg6PTs9Ojg5Ojk6
PEA9Oj05PDo7Ojk5NTk4ODg5Pj0+PDg+Pj09PDo6OTk4Ojs7PDs6Ojg4Nzs7PDk4Oj4+PTw8ODw5
Ozk6Pjw+PTw1NTg5OT47Ojo6PDs3Ozw4PDc1Ozo6NTk7Ozs5NTc4Ojw9Ozg6OTo4Ozk5Ojc3NTs3
NTc5OTc5PD06ODo5OTg5Oj06PDs5ODg7Ozo8Ozw5OTk3ODc7OTc5NTk3Ojk3Ozw8PDo4Ojs7OD0+
PDc7Ozs+ODk7Ozo7Ozs7Ojs9Pj4+PTg5ODc6ODg6OTs5Ojw8Pjs7Ozw5PD08PkA7Ozo6OTw6ODg4
Ozs6Pjs7Ozs6Oz07Ozw8PDw6ODo8OTg5OT0+Pj45Oj07Ojo6Oz04OD04Nzc1OTg3NT04ODw9Ojs7
PEBAPDo7Nzk6PDc8OTk9Ozs7PD06Ozg7Pjo4ODc7Ozo6OT48OT49PD06Oj4+PDs4Ozw6ODw5NzU6
Ojs4Ojs5OTo+Ozk5ODk7PDk9Oj4+PT06Ozo7Pj09PD09Pj1AOzo9PTo4Nzs+Pjo4OTo8Ojw+ODo7
Ozk5NTo3PT01OTs+PTs5OjozMTQxNTQ1MDEyLiwxNDEyLi4xNDQyMjUyMTEyMDMxMjIvMjU0NTMy
LzE3NDEvMjQyMzUyMDA1MjAvMDIzMy8vMzUzMTExNDExMS8wMjM0MS8sLCwsLzAxMzMwMjEzNDQ0
NTExMDE0NDUxLzIyNTQ0MDEzLjEzNTs5NDEyMDIxMjIvMDIxNDIwMTI0NTMyLzIyMjU1NDMxMjMw
MjU1NTg1Ly80NTMwMTIyMjI3NTQzMzMyMSwuMzEyNTI1MTQxLDQ1NTMxMS8wMTE1NDM1NDQzLjAy
MTM1MTIxMS4uMTEvMzMzMzUwMjU1MTEyMTEzMjMyMTM0MzExMzAvLjUxMC8uMC8wLjA1MTU1MjEz
MjM3NTAyMzQ0MjEwMzM1MC8xNTQ1NTMyNDQ0MDEyNTcxLywwMC8vMjU0NTIyNTUzNDc0MDEyNTU0
MjEwMTQ1NDEvMTU0MTI1NzMyMDM1NDI0MDAxMzAyNDIzMjIvMjI1NDIvMjAxNDQyMy8wNTUzNDU0
MTEyNDIzNTMwMzUzNDMyMTEwMjEyNTIwMTQ1NTMxMjM1NDM0NTIzMjQ4NTIxMTM1MjM1NTc0NzUz
MjA0NzQzNTM0NTIxLzU3NDMyNDU0MzU1MzAzMTQ6ODU0NDIwMjQ3LzA0NTU1NDQ1NTUwMjQzNTMw
NDUyMTMxMDIzNTMyNDUzNDA0MzU1NTc3NTU0MTEwNTc0Mzc1MzIzNTQzNDI3NDQyMzAzMzUyNDMw
MzI1OTI1NTQzMzM5NTQ1NDEyMjM3NTMzMzAxMzUyNDM1NTQ1MTAvMzMzNzQ1NTs4NTQ0NDM0NTo1
MjU4NDU6NTIyNTQ0OjQ1NDUzNDg3NzQ1NTgyMzc0NDM0NzIxNDUzMjU0MzQ1NTU1MzM1NzU3NTAv
NDU1NTM1NzMxMzQ0MzE0MjI1NTU0MzI0NTU0NDI4OTc1OTE1MzQ1MzI0NTQzMjI4NTM0NDg5NTc1
NTM1NTU0MjEzMjQ0NDU5MjQ1MTM3MDE1NTI3OTU0Nzk1LzU3NzU0ODc1NTg4NTM1MzQyNTQwMjMy
NDg1MDE0NTQ0NDMzMzMwMzUzNTAyMzU0NTQzNzc1ODg4MzE3OTM1OTQyNTMzNTUzMTQyMjI1NTU1
NDMxNTk5NzQzNDU4MzQ1NzQ1NTI1NTQ1NTU1NDM1NDU1MzM1NTM0MjEzMzI3Nzg4NDI0NTU0NTUy
Mjc4NDc3ODQ0Nzc5ODQ0NTQ1NTc5NzQ0NDE0OTc6ODc1NzU0NTc7Ojg5Ozg4OTU5ODk5NTU3NDU7
PTg3NTg5NTc1NTo9OTc1NTU4Nzg5NTc3ODg5ODk5NTk7Ojo3OTk3ODg4OTU0OTo6Ojo6OTo1Nzc1
Nzo1NTc4OTo6Ozs4Nzs8ODk5Ojs6Nzc5Ozo4Nzg5ODU5Oz45NTEzNTk3OTQ4OjU1ODk3ODU0NTk4
OTUzNDQ3NzQ1OTU3Mjc4Ojk1Nzc1MjQ0NTc5NDU4PDg1ODc1Nzc3Nzs3OTc3NTg5NzU1NTQ1NzU1
OTU3OTc0NzUzNzc1Nzg6NzQ4NTg3NTM1Nzg1MzE1NzAzODs4Nzk6NzU1OTc1Nzc4NzU0ODU0NDc4
NDc5OTk6NDc1NDQ1NTc4NzQ3OTU1NTQ5Nzo1ODUzMTUzNDkzNTk3NzU3OTU0NTU5NTE1NTU5ODc0
Nzg1OTU3PDg1ODU4NzU0NTU4NTU3ODc6OTo1ODg1NDc4NzU1Nzc1OTU1Nzc6PDw4NzU4ODk3NDI1
ODk3NTk6Ozg4NzU4NTU1NTk4NTU3OTU5OTg4NTU4OTU3Ojs8Ojc1NTg5NTQ3NTU1OTg0NDU7ODM1
OTg4NzU3ODQ3ODk3NDU1NTc0NTc1MjEzNTU0NzU0NTQ1NzU1NTc1NTc1NTc4Mzg1MzMyNDU1NTUz
MjU3Nzk4NzQzNDU0MzE1ODc1NzgzNTg3ODo1MjU1NTU5NTU1NDc3NTIyNTk3NTU3ODU0NTU1NTg7
Nzc0NzU4MzU4Ojg3MzU4Nzg1ODk6OTs4ODg5OTg4OTo7ODs5Nzg7PDs6NTg4ODg6OTg7Ojk6PDw6
NTk4Nzo4NTs6PTw4Ozo4NTU5OTg6Oz49PD49PTs6Pj48OTo5ODk8PDc4ODU7Pjk6PD4+OTk4PTs5
Oj4+OTg5PT1APjs7PEA+Ozw+QT48Ozk7Pj08Oz49PTw6PDw7Pj08OT09Ojs7OD09OT09PT47Oz07
NTo6PD4+Pj48Ojo6Oj09Pj47PD48PTs5PD08Oz4+QTw6PEBAPDw6Ojo5PD07PTs9Ojo9PD4+ODk5
OD1AOjc6PDtBPUA8PkA+QDw6Ojw6OTs3OTU3PDg9OTQ1Nzk8ODc0ODk7PDk6PTs4Ojk8Ojo8Ozo5
OTs7OTs0NTc4NTU3OTg7OjU5PTo3Ozo3NTo5NTQ6Pjs4PTw6PDo6ODs7PD46Ozo7Ozo8Ojw8Pj46
Ojs9PDs8Ojw5OT47Ojw+Nzc7PDs+QDw4OTk5ODw8Pjk8Pj0+PT05Ozw4Ojk4Oz09PTo7PD05OT06
Oj48Pjs9ODw7Ozg7Ojk7OjU4Ozw9PD0+Ozo6PEBAPDo1OT09Oz49PD08PD48OTk6OTc5Ozk3OTo6
Ojo5Pj47OTs8Ozw8PTs+PT09Ojw6PDs+Ozs7PDw9NzU9Pjw7PDo6PTs4OTc7PD0+Ojo5Nzo6Ozo3
OTs8OTs6Ojk5PTs4OTk9Ozw6OTw6Ozo6PDU6Pj0+QD09Pj0+PD4+PTk3ODs+QD44OD0+Pjw9PTk+
Pjw5Ojk5OTo8Ozs+PjI0MjQzMjMyMDEzMDQ1MjA0MTIxLjIxMTQ0MDAyMzQ4NTIzMzMxMzIwMzEw
MjE1NDI1NTIwLi4vLywuMjAyMC8xMi4sMjAzMy8sMTIxMzQyLjEzNDQ0MDI1NDEyMjQxMjU1NTQx
LzAvMjMwMjQ1NDQwMDIyNTMvMjQzMDAyMDE1NDMuMDIyMTM1MDEyNTUyMDAvMzEwMzMvMDEzMzUx
MC40MzIzMS8wMDIxMTM0NTQwMTM1MTA1MzU1MzEvMjMyMTg0MjAyNTMuLzExMzIwLjMxMDQ1MzIx
NDIzMjQzMjI0MTIuMTMyMjExMzcxMS4vLzE1NTg0NTMxMjU1NTQzMzIyMjM0MjI0NDIxMjI1NDMz
NTUxMzQyNTUyMjU5NDIyNTc0MTM0NTQ1NDEzNDM0ODMzNDQ0MTIwLzA3NzQ1MjIwMjI1MzMxMzIv
MjMzMjM1NTQxMS8wMC4vMi4sLDA3MjMzNDIuLjI0MzEzMzMwMzMxMzMzMzUyMDQ0NTU0MjExMTM1
NTExMjMyMDI0NS8vNTQ1OjU1NTIsMjQxNDU0MzMyLzQzMDE0NDIzNzAxMzI1NTQzNDMzNTUzMzMz
OTc1NzU3NzIyLzM1NTgzNDM1NDUzMTEuMzc1NzMzLzQzMzQ1NDUzNTQ4NDQzNDI3MjU4NDMzNDMw
MzA0MzE3NzI1MzEyMzEwMjcxMTAxMDA0MTEzMzQ0NTM1NTEzNDU1MzUwMDU0NDU0NDcvNDQ1Mi80
NTQ3NTIwNDk4NDMzNTg1NTAsNDMyNTIyMzQ3NTQyNTQyLC8xNDMzNTU5NzU0MzIyMjIyNTU1NDc1
NTM4MzI1ODUzNTM0MzU0NDc3NTM1ODQyNTk1MzQ0NDg1NTQwNTg0NTc1NTU3NDIxMjIxMy8yMzQ1
ODoyMTQzNTU1MzA0MzM1MjU3My81NTIyMjI0NDU1NDI0MjQ0NTQ0NTc3NDUzNTI1NDU1MjQ1NTUz
NTg1NDM0NTMxNTc1NDU5NTMxMzU1MTU0NTI1MzE1MTM3NTM0MzMzNDM0NTIzNTQ1NDEwMjM0MjQ4
OjQyMzI1MzU4Ojc1NTU1NDU3NTg1Nzs5NDQyMjU4ODg6Ojg5ODUxNTQ0NTc1NTk1NTQ4MjM0NDc1
MjQ1MzM0NzQ0NTg0MTI1NTI3ODUxNTU1NTQ0MjU3ODM4NTIzNDMzLzA1NTg1NTU0MjEyMjM1MzMx
NDU1NDU4ODo3ODc0MzU3Nzg3NTQ1Ojc1Mzc3NTU3Nzg1OTs1NzU5ODk1Nzg5ODc1NTUxNTo5ODk4
Nzo7Ojk7Ojk8PDg6PTk5OTg3ODo6PDk7Pj06Ojw5ODg4Nzg1Ojo3NTU0NTc6OTk5NTc5Nzg8Ozo7
OT08Ojk0ND0+Pjw4ODs7NTU+Ojc4PDg1NTU5ODw4Nzg0MzQ4NTQ4OTc0OTc1NTUzNDU0NTU1NTc1
OTU0NTU3OTc4NzU1MzI5ODU1OTc4NTM1NTc1NDQ1NzU3OTc4ODc1NTQ1Nzc1MjUyNTU1NzQ0NTc4
NTU4OTU1Nzo3ODw1MzQ1Ozk3ODo6NTg0NTk1NTc1NzU6OTU1NTU5PTw1NTs5ODc1ODU3Ozc3NTQ4
NTEvNTk1OTc4NTQ0MzQ0Nzg1ODozNTU4NTc3NDMxNTU4NTM4NTQ3MjU1MDU1OTk6ODQ1MDc6OTc4
OTc4Ojk0Nzc1NTI1NDg7OTg5ODo5NTk5Ozc1ODg1Ojc3NDc4OTk3NTc4OTg3ODUzNzs0Nzo6Nzc0
MzU5NTU1OTU5OTQzMjU5ODc5ODU4Nzg3NTU1ODkzMTM1Nzc4Nzs3ODc4NzU1NTg1NzU1OTg1ODc5
NDc1NTU0NTc1MjM5OTU1NTk4Nzc1Mzc1NTUyMzU0NC83MzQ1NDU0MzU4NTU1ODU0ODc1Mzc1NTg4
NTU3Ozs4NTU4NTQ4NDI0NTUzNTc6NTU6Pjs1NTU0NTU5Ojc1ODc4Ojk3Ozc1NTg6Nzg3ODg1NTQ4
ODk4ODg4Ojk5NTo3NTs5Nzg4Ojk4NzU1NTc8OTg4ODo4ODw5ODs5ODk3ODg5OTo8ODk4NTk6Ojc4
OTo5PDw8Ozo7OTk+PTw9PT05Ojw+Pjo3Ojk4NTg1OTg4Ozw+PTs9Ozw6OjxAPDs7PTw3PDk9Pjc4
OTg8PTg6PT49PDo9QDw7Oz07Ojs6Ozs5PDs6Pjw9Ozs9Pjs4Ozw7PD06PDs9Pjo4OTc5PkE+PTw9
Ozs8PT46Ojs9Ozc1PDk6Pj0+PDs8PD09Ozo8PDk8Ozw9Oz07Ojw8QTs5Pj49Oj07PDs6OTk5Oj45
OTc5Ojk3NDU6OTo9PDs7Pjw8PT08Oz45OTk6Ojk4ODg0OTs4OTc4ODk6Nzo7Ozk9Ozw3Nzg7PTo8
Pj47OTo9Ozk4Ojk5Nzs5Pj49PTs5OTU1Ojs+ODg4Ojw8Oj08PDg8Pjo9Pjs4Nzo8Ojo6OTs7Oz09
OT06Oj4+Ojk9OTg3Ojk8PTs9OTk7PUA7Ojo5ODs7QDs5PD47Ozs7PDc6Ozo7Pj4+Pj49PUA+PT4+
OTk4Oz0+QDw7OkA+Pj08Ojk3ODo5Pj49PTs7ODc5Ojc3Ozo5ODw6Oj49PDw6OD48PDk3OT07PDs7
PDk1Nzg3OTc6Nzo5PT06ODc3Nzo4PDk6PT48Ozg6Ozs5Ojk9Pj05NTk7Ojk5OTk8Pjs7PT08Ozs5
Ojc1Nzg5Ojo9PTo6OzU7Ozw6PTw7PTw+Pj48PT5APjw8OTg5Pj5APj0+PTw5ODk5Oz06PDs7Ojs3
ND08PT07OzU6MDIyMzAwMTI0MzE0LzEwLjE1MDQwMTEwNTI1NDQxNDQxMTIyMTMxMDEyODcxMTMw
MjMzMDM1MTMwLzU0Ly8wMDEyMi8uLjExNDIwMjIzMjAxMC4uMTEwMTIxMC8yMTA0MzUxMjA0MjIx
MS4xMzIzMDMzNTMyOTQyMTM1NTIyNTQzNDQ0MjMsLjEwMy8wMTQwMDEyNS4wMTEyMTIzMTQuLzIw
MjI0Mi4vMzMxMjAyMTQwLzEyMTAvLzM1MzMyNDQ0MjExLDAyMDM1NTIwLzEvMjIxMjE0MDIzMjQ0
MC8xNTE0NTMyNDQxMTAyMTI1OTcxMDQzMjUyMDAxMTM3MSwzMzMwLiwuMDIvMTQ0MDIvLjExMjQ4
NTIwNTEyNTc0MTIwMi8uMTIyLzAzMTE4MTAwMTQzMTIzNTEwMjIzMzM1NTMvMjQzNS40NDQ0MjM0
MTQ1MjEvMjQ0NDU1NzUyMDQyNDQxMzI1MC8xMjMxNDUyMjU1ODc1MzIvMjUwMTQ4NTU4NTg0MzM3
MzQzNDk3Nzc0NDQxNTU1NDU3MzMyODc0MjE1OzU1NzQxNTMwMzU0NTM1NTMyMTEyMzU1NTU3Ojc3
NDM1MzI1OTU1NDUyMzI1NDc0MzMxNTQzMjQ1NTUzMzU1NTA0MzczMzE1MTMvMzUzMjM1NTgzMzMy
MzMxMjI1OToyMzU1ODk0NzQyNTU0NDI0NTkyMjQ1NTI1MjAzMzMyNzg3NzU0NDU1NDcyMzQyMzU0
MCwyNTM3NDE1ODc0NTQzMzMyMzQzNTU3MzIxMjE0NDM0NTU1NTI0NDUzMzI0NTUyMjU3NDc3NTQ0
MTI4NTU1NTk0MzI1MjQ1ODgyMjc1NTM1MTE1NTU1NzU1NTMzMjU1NTU4NDI1NTQzMjEyMzU1MjIx
MzU3NTE1NTAxNDQ3NTQwNDU1MTU3MTMzMzEyNTc0MDQ5Nzg1ODU0NTU4NTI1NTQ1NDg4NTQ1NTU1
NTU1NDE0Nzc1NzU1Mi8zNTkzNTQzNTMvMTU3NzMyNzU3OTg4ODU0NDg1MzQ1NDMxMDE0NDIzMzQ1
NTU1NTQ0MzU1NTI0MjU0MzMwMjUzNDQ0NTIvMjMxNDc3MzM1NTc1NzU1ODMzNTc1MzI6NTU5ODA1
NDU1NDU1NTU0NDc3ODI0NTQyNDU1NTQ1NDM0NTQ1NTU1MDQ4MjM0NDU5NTMvMjM0MzU1MjQ1NTQ4
Ojg4NDM0OTo4NTk5NzU1NTU3ODg0Mzg1Nzo4NTUzNDU3NTU4ODU5NTk4ODo1NTk0NTQ3MzQ7NDU3
OTQ4Ojc4OTk4NTk8NTw7OTs1OTs5OTo4OTc1OTk7Ojo7Ojg4Ojw8Ojk4Ozw6NzU7ODk8Ojg3OTk7
OTw7NzU5Ojo4NTg1Nzk7Ojs1NTo5Ozk1ODg6Ojc3NTc5OTU3Ojk5OTo3Ozc1Ojo6Ojk3PDc5ODUz
NDk1NTQ1NTU0NTgzMjU5OTc6NTo5ODgzMzQxNTU0NzU1ODk1NTU1Nzg5OTI1ODU4Nzc1NTI0NTU1
NTUyNTU1NTUzNzg3NTM1NzU3NTM3OTU4NTg7ODU1NTU1NTM1NDc1MzE4NTg5ODQ0ODM1OTUzNTUy
NDg3NzU1NTU3ODs8NTU1ODU1ODc1NDU4OTc1ODk6Nzc3NzQ0NTg5ODU4OTczNTc3Ojk1OjczNTw7
ODg1NDI0ODo1ODc3PDU1PDU1NTk4ODc3NTc5Nzw4NTM1OTk8PDU1ODc1Ojg1NDQ1NTU1ODk5ODg6
NTg5NTU1NTc4PDk9OTc1NTU4OTU6OjczNDg4Ozc1NTc4OTc1ODk6ODczMTQ0NTU0NTU0NTg1NTU3
NzU1NzUuNDc1NzUxNTMzNDU3OTU1MzU3Nzg3NzU0NTM3OTUzNzc1NTo5ODg1NDU3NzU1MzU1ODU1
Ozs5NDIzMTU1NTU1MTc4NzU1ODk0NTc3OTs1NzM1NDQ4NzU1ODo8OTU1OTk7ODU1ODk6OTk3NTo5
Nzc6ODU3ODc5Ojk8ODg5OTo8ODU3Nzc1ODo5ODc3ODU3NTg3ODg5NTc7Pjk3OTo8Ozw6ODo4Oj4+
PDg3Ojo7PDs4Oz05PD08PTs6Ojo5Ozg7Ozw5OTw9PDw7PDo6Pj08PEE+OTg4ODw7Pjs5Pj46Ozk7
OT08PTtBPjg4PTw+PUA+Oz05PDs4PUM8Ojs+Oj49Ojs+Pj07Pj07Oz07OTs3Oj09Oz4+OTo6PDs4
Oj1AOzs9PTw7PTo9PDo4Nzs7Ojc6Pj48Ozk5PTw5Ozw8Ozs7Nzo4PDw+Ojg3Oj49PTg8PT08OTg9
PDk7Ojg7OTs5Ojk4OTs1Ozk5Nzc4PT05ODg5NTg7PDo6OTk6ODw9QDs6PDo3NDU4ODc3Nzk4ODk+
OTo3ODs8Nzo1OTk8PTw6OTg1Ojg4Ojc5PTo8Ozw3OTk4Pjs7Ojk7Pjw5Ozo+PTo8PTw7PDw+PTg3
Ojw5Pj05Oz05Ojo9PT46Pjo8PkA8Pj49PUA6OT5CPjs8Ojk7PDw4OTs+Pjs+Pjo7PDw7Pj06PDc8
PD46PDs9PD06PEE8Ojs4Ozo3OTg5NztAPj0+Ozg6Pj5APT49PDo7PD06ODk8PDw8PDk3OTk6Nzs6
Ojs7Ozs3ODg6Ozk5Ozs8Ojk1OTo4PEE5ODs9Ojk7PTs3Nzk4ODs5PDk1Nz06PD48PTs6OTg3Nzg7
PDk8Ojg3PDg8PTg9PDw9QDs+Nzo8Ozo5PDw4Ojw+OTs7OTg6ODw9Pjw8Ojg3ODs+Pjw7PDs4OT09
Ozw9PTkvMDMyNDM0MTIyLzAyMzQxMTI0MzM1MTM1NDMvMjQ0NTQ0NTIzMTAvLi8xMzc1LzEyMTU1
LzAyNDMxMjI1NDUyMTExLjAvLDA3NTAxMjMvLjAyMzM1NTUyMzMxMDMzMjIzMjIxMjExNDQ1NDU1
NTU3NzUyMi8xNTQxMTMxMTQyNTE0MzIxMDIyLzAyMzExMDIwLjMxNTExLy8sKzAxMjQsNDUvNTUy
MDEwLy4zNTUxMDA6NTExLzExLzIyNDExMzMxMzczMDEyMzMyMDMxMTEzNDMvMS8vMzI0LjE0NTIx
NC8yMzMzMjQ1NzQzMjM0MzUzNDI0NTczMzQ0MzM1NTMzMzIxMjI1MzIxMzQxMzEzMzE1NTMzMjU1
MzIyNTMxMDI1NTEzMTEyMS8xMzMzNTc1NTQyLzI0NTAwMTUzNTUyNTUxMTIyMjUzMTEzNTQ1NDU1
LDQ0MTAvMzQxMTU1Mzg4NDMzMzEzNTUyNTk1MzIzMTI0MjMyMjU4My8vMTU0NTQ1NTU1NTIuLDU1
NDU1MzIyMzIzMzAwMjM1Ly8xMzIxMzUxLzE1NTc1Nzc1MzU4NTc1MjQ1MzMzNTQzNTszMjMxNTQx
MjIzNDQxMzE1NzU1MzU0NDU0MjQzNTEzMjIzMjMyMzU1NTUyNS8vMTQ1MjU1MzE1NTMzNTU4MjQy
NDIzMzQyMDQzNDUyNTIyMjU0NTM1NDMzMzMxNDEzMjEyMjAwMjU3NDIyMjExMy8wNDQ1MTQ1NTEy
NTQ0MzA1MzI1NzI0NTMyNTQ1NDUzMzM3NTc0MTE0NTk5NTc1MzIxMjUzLzM0NTg0ODU3NzU3NDQ0
MzU3NzUyMjU1NDU1Mzk1NzU0NTU4NTI0NTUyLzMzNDUzNTczNTQ1MjE1NTU1NTU1NTMxMjQ0MzQ1
LzA1MzQ1NDQ1Nzc1NTU6MjAxNTU1LzM0NDUyMzQ1NDMyMzU1NDM1NDI3NDMzMzc0MjMyMjI0NTI0
NTU1NDAzMzQwNDMzMzQ1NTUyNTo1MjMzMjQ1NTU1MzU0Mjc3NTU1MjU1MzM0NTU3MDI1NzMzMzU4
ODI0ODg1MzU1NTczMzMzNTQyNTU1MzQ1Nzc1NDU1NTQyMjQzNTQzMDM0NDI1OzQvMjIyNDg6NTU5
NTU1MjU1NTg1MzU1NTU0NTU3Mjc4MzIyMjMyNTU7NzQyNTo0MTM0MjMyNDM1MTM1Nzg3NTUzNTk3
OTU0NTU1NzU0NTU1NzU3Ojc1MzEzNDc3PDk1NDgzNTo0ODU1ODo6Nzc3NTU1NTM3NTU0Nzk5Ozk3
NTg6NTk8OTg1MzU3ODU1NTk6Nzc1Nzc4PD08NTs0NTo8OTk5OTg8OzU5PDk3NTM5Nzc4Ozg5OTo1
Ojk4ODo7OTU1NDU3NTU0NTg1NTU4ODg4ODUzOjU5NTc1ODc1ODc0NTc1ODg1OTo3NzcyNDc1NTU1
NTc5Ojc1NTw6OTU1NTk5NTk4ODk3NTQ1NDU1Mjo6NDU0Nzc4NDU4Nzk5NTk1Nzs6NTc3NTU1MzU3
NTUzMjQ0NTM4Ozg3NTU4OTg1ODQ0Nzs1MzQ0NTg3OjQyMjU3ODU4ODc3ODU1Nzc4Nzc3NDQ4ODU1
NDg3NTg1NzU1NTc3NTU1ODk1ODg3Ozk6Nzk3NzgzNDU1NDg1Nzk3PDs1NDQ3OTU1Nzo3OTQ5NTM3
Oj45Ojk5ODk5NzU3Ojo3NTc1ODg4ODcyNDg5PDc1Nzk3OTs0MzM1NTc5NzM3Ojg5Nzs6NTc4NTM3
NDc5Nzg3NDU5NTU3Mjg3ODg1NTU3NTUzNTc1NzU3NTU3NTQ1NTU1NzU5OTg0NTU3NTk4NTU1Nzc1
MzM0NDMyNDg6NTc8OjQzNDU3NDQ1NTc0ODgzNTU0NDQ1OTQ0MzQzNzg1NzU1NTk1NTM0NTc1MjU9
ODQ5NTU5NTg1MzU1NDU4NTg1NDI3NzUyNDU5OjU1NTU1NTU4Ozk4ODU7OjU5ODg5NTg8Ojg4Ojw7
OTU1NTU3ODc3NTk4NzU4ODk6NzU7Ozk8Ojg4NDU8NzU3Ozs5ODU4PDs3NTo4ODc1OTc5Ojo6Nzg6
Ozo8OjU1OD04OTk1Nzo5Ozo3Nzk7Ozk3ODk6Ozs3ODw4Ojk5OTk6ODk6QDs7PDs5OD08OTg5ODw8
Oz05Nzs+PDg9Ozk7Oz4+PDU3Pj06OTo8Ojk7Ojw+Pjo1PTw+Ojk9Pjg6PD49Ozw7OTo+PDs5Nzo7
PDo1Ozw5ODo9PTs6PDo3ODk8PTw9PDk3PD09Ojs7Ozw5NzU+OTg6Ozw1ODo9Ozk6Ozo5Ozk4ODw7
PDk3MzQ4OTk8Ojg5PD06OTo5Ojk5NTU7Ozw8Ojo4PDs5Ozo6Ozg0Nzg8Ozw7ODo6PDk4Ozw8Ozo9
Ozs7Ojk5Ojk5PDo7OTo6ODw7ODw6Ozs6Ozw7Oz47Ojs9Pjw9OTo6Nzk7PD09Ozo8ODs5OD0+PTw8
PTg7OTw+Oz1APj47Ozk9Pjw4Ozw8NzQ5PDw5Ozs+Ojc6Ozw6Oj0+PTs9PDs+Pj05OTs9OTk7OTo3
Ojw5Nzg4ODQ5OD48Nzg5OTg5ODk5Nzk4OjU9Pjc6PD4+Ojg8Pj44NTk9OTc1PDs4NTo7Ojk4OTs7
PT45Ozs8Ozk3Ojw8PDg5Ojg8Pjk6PD08PDs7Pj08OD06QEE9Ojk1Oz45PD47OD49PDo+Pjw3PDo6
OjU1PDo6PDU9PDo9PDw8PDw7PT05Ojo8Ojw6Oj04OTs7Pjw1Nzk7OT06Oj48Ozg4PDw8PTo5Ojo3
PDU0NTQvMTMwLC8xMC8vLDAyNS4vMTM0MC8xLzAyMzMxNTMyMjIwMTQ0MzExMS4wLi8yMjQ1MjUz
MzMyLC8yMjIyNTUyNTU1MTEuMDEwMTI1NTAzNTMzMjMwMzQ1MzI1NDMyNDUyMzAwMDExMS8xNDIx
NTIwMS8sMjEwMzEyMDQ0MjcxMDU1MTIzMTAwLzIyMzEvMzQyNTMzMi8sMC4xMzAxMTIxMjEyMDAy
NDIzMTI1MjIxMzEzNTUxMzEzNDMzMzQwMzQzNTI1NTAxMzAvLzI0NTEzMi8wMjExMjMzNDUxMzEw
MzM0MzUzMC4yMy8vMDAxMDQyNDU0NDMyNDIxNDMzLzAwMjI0Mi4xNTMvNDQzNDIyMTUxLjI0MzMy
MjM0NDM0MzIvLjMyMDEvMTIyNTUvLzMzMCwsMDExMTExLC4xMjQxMTIyMTAwMS4yMzQ0NDU1NTQx
MjM0NDU0NTMwNDIzNTMyMjI0NDEzMzIyMjU1NTIwMzExNTEzMzMxMzI0NDM1OTQ0MzQyMzIwNTUy
NTUyNTQzNDc1MTUzNTE0NzQxMDQ1MzIwMzQ5NDE1NTM3ODg3NDUyNDU5Ozg0NDU0MjU1NTAxNzQy
NDMyNTEwNTM1MjI1NDc1Mzg5NTIyLzQ3ODc4NDU3MTI3NDIzMjM1NzMyNDQxNTI1NTEwMzQ1NTQ1
NDM0MjU0NTI1NTg4MTAyNTQxMTM0NTU1NTIxMy4xNDMzMzQ1NTUzNTQwMTM0NTUzMjU0MzQzNTUz
NTQ1NTIzMjM1MjU1NTU1MS81MzQ1MzQ1NzU1MzU1NTczMzEyMDAyNDIzMTU1Nzc1NTU3MjU1NDIz
NTU0NTU5OTU1NTU6NTU1NDQzMzM3NTU0MzQzNDc1NDQ1NDU3MjIyNTQyNDI1NzUxMDU3Ojo4Nzg1
MzEyNDA0NTQ1NDU3NzMzMTM3Mi8xMTI1NzMwMTc3NTMzLzEyNzUyNTUxNDQ1Nzk3NTMwNDIzNDU1
NDM1NTExMjM1Mzo1MDQ3Nzc5NTM3MjI1NDQwMjU1NTU1NTQ1NzE0NTU0MzM1NzU1ODU0NDQ0MDQ0
ODQwNDc3NTM1NTg0NTQ0NDU3Nzg1MzI1NTQ1NTIzOjU0MTE0MzQvMDE0MjE1MjAxMjQ1MzQ3NzQ3
NTc1MjM0NTI1OTUyNDU1NzQ0NTU6ODU1NDMyMzQyNDQ1MjAyNTQ1NTU0NzQzNDc1OTUzNTczMzQ1
NTg1NzM0MzI3NTUzMzM0NzU0NTg3Nzc1ODg7ODg1Nzc1NTU1Ozc1NTc6Oj06OTU4ODU0OTg5ODg3
ODk8Ozc5PDs3ODk1Ozk5ODg8Ozs7Ozg4PDw3Ojk4Pjs4Ojw6NzU8Nzk8NzU6Ojk1Nzg5NTc3ODw3
NTc5NTI3ODg5NTc1OTc0NTc5ODQ4ODg5OTc5Ojc4NzIyOjU6OTc3NTg4NTo4NzU5ODU1NTs3NDc3
NzU3Nzw5NTk3Nzc5NTM0OTU0ODc1MjE1ODU1ODU1NzU5Oj04NTg1NTk0Nzo8PTs3NTc1Mzg6Ojcz
NzU4NTU1NTU3NDU1NzM0NzQ4OTU5NTczNTg3Ojs6ODc4NDs6OTs5ODU3NTk1NDg7OTo4NTg1NTU5
ODU3NTU1NTc1OTc3NTc0OTk5OT45Nzc5NzU1NTg4ODU3NTk3NTs5OjU1NTU5OTg1OTc1NzczNDU3
NTk1Nzk1PDU4Ojc1Nzk3MzU1NTo7OTUyMzU3NTg1ODk1MjU1NDU1NTQ3Nzg0NDU0NDc4NTg5OTo4
ODc6PDc1NTg1NTc0NTc1Mzg5NDUzODU3NDg1NTU3ODw1MzI1ODc1NDI0NTc0NTU4NDM6OTc1NDU0
NTQzNTk4NzQ1NTU1NTU1NS8xNzc5ODUzMzU4NTU1MTIzMzUzMzU3Nzc4NTczMjU1NDU1NDUzODUx
NTg0ODg3NTU1NTMxNTU4Ojg0NTE0MzQ0Nzk3NzU0NTU4NzU5NTc3NTc3Nzc4NTk9OTU4PDg1NTg0
ODk1Ozo3MzcyNTg4OTg4ODU6Ojg3ODg6OjU6Ozw6Ojo4Ozc1Pjs4NTo3Nzc4Ozo7PTo1NTg4ODo5
NDQ4ODM5PDU3Ozc4Oz07NTg1Nzw6OTc4OTs9PTo6Pjw6Nzc4Oz08ODk3Nzg7Pjw7PD49PTw9PTs6
PDo6PDw4OTo7Ojg9Ojk6Nz5BPjs7PDw3Ojk6PDw8Ozw7PDg6Ozs6Oz04OTo8OTs9Pjo+Ozw6OTU7
PDw7OzU3Ozw7Pjs8Ozw7PTo8Ozs7OTg8ODU4PDlAPjs5ODo4Oz05OT05PTs6OD07PDo9PTk5OTU1
OTc3OTo6PDs4ODs8NzU3Ojk4ODU8Ozk4ODo1Nzo4Nzk3NTg8Ojg4Ojc6ODo8Ozs+Ozs7Ozw+PDw5
OTg7Ojg+PDo8Ojw7Ojg+PTk7PTs1Ozo7ODo8Ozs5PDs6PT4+OTs8Ojw+PDo8PTk5Ojs6PD4+Ojo7
Pj08Pj07PT08Ojo6PDw8QD08Ozw7Pjg6Ozo5Pj49OTtAQTs5OTw8Ozs1Nz47Pjo4Oj05Ozo7PT09
Ozg4Pjs8Pjk5OTw6ODo8OTs7OTw7Oj06OTU7Ozo6PT07Ozs7NTg9Ojs+OTo7PT48Oj09OT0+PDo4
Oz1APjw5NTg+Pjk8Ojk7PDc6PDs9Ojo9Oz07ODk+Pjk6Pjk6Pjo6NTo8Ojw6PTw8PT07PT06Nzw8
Oz0+QD07Ojo4QkI+ODc4PDw6OD08QTo5OTc6OTo+OTg6Ojs5Ojo7OD07OTo9Pjw+ODs7NTc3MzEz
NTIxMjUzLjEwMTM1MzQwNDMxMTIwMTQzNDIyMzIwNTUwMjI1NTQxMDA0MzUzMzAxMDE1MjM0NDIz
MS81NTMyMjMsNDQ0My8wMjMyMTMxMTIwLzAzNDQzMjUzNTExNDMyMzIxMDEvKzIxMDIxMjUxLzAw
LzIxNDIxLjEyMjAxMTEuMDIzMzMzNTQwMjEyMzIwMDQyNzMzMDAyLDAxMTQzMzE0MTEwMTQyLzIx
MjMyMTQwMTQ1MiwsMzU0MjEyMjA0NTMuLzMwMDAwMTIwLDQ0Mi8xMzQyMTQyMDMzMzMuMTI1MjEy
MTUzMjIxLjIvMDE0MC8zNDQyNDMzNTQ1NDM0NTMzMzE1MC80NDU1MjA1NDQzMS4xNTgzMjMxLzAw
MTQyNzUzLzQzNTQyMjM1NDAyMzMyNS8wMjQyMC4sNDEzMjE0Mi8wLy4xNDIyMzUyNDQyNDQyMTQv
MjQyNDMwLzI0MzMzMjU0NDQyMjIxMTU0MjE1NDEzLywzOTMyMzI1NTQwNTc0MjMzMzMxNDE0NDM0
Mi8yNDU1MzE3NzUzMzMxMjQ1MDMzNTU0MjU1NzI0NDIyMjU1NzM0NTI0NTMzNDI0ODQwNDE0MCw0
NTI4NDExMDMyMjQ1ODMyMTM1Ny4xMTQ0NTU3OTU0MzQyNzU1NTIwMDMzMTQvMjIzMTQ1NTMzNDIw
MTIzMzUyNTU1NDIzNTUyNTU1NTc1NTQ1NzI3MzAwLzQ1NDMzNDk1MjAwNDQ0NzEyODExMzQzMzIz
NTQwMjEzMTQ1NTc1NzU0MTMxMzExMDI4NzQzNzM1MzU0MzU1ODU0MzQyMjMzNDM1NTU4NTI1NTU3
NTU3NDM1ODc0NTc3NzU4Mzc1NTc0MjU0MzM0MjQ0NTU1NTQ1NDMyNzQyNzc0NDIyNTU0ODQzMzEx
NTQ1MjA1NDQ1NDExMjI1NDUzMTMxMjQzMjUyNTUxMzIzMzQ0NzU0NTM1MzQ3NTU3NC4wMDI1NDMz
NTU0MjE0NDU0MzEzNzMyNTc4NTM0NTU3MjQ0MzQ3NDQ0NDI1MzQxNTMwMTQvMzU3NDg7NTA0NTQz
MzIyMzI1MTU1NTUxMzEyMzQ5ODU1NzQ1MzE0NzgyMjQ1NTc1NTQzNDIyNTU3MzU1NzU0MTI1NTU4
MTEzMzU1NTg4NzM1Nzk3NTU1NTg3Ojk4NTc1NDU0NTQzNTU1MTQyMzQzNTU0Nzc1NTU1NTQyNDk3
NTU1NTM1ODU0NDEwNDU5ODk1NTUzNTU4Nzk0NTk1NTc6ODQ3NzU4Nzk6OzU0NTg1Nzo5ODs6OTo3
NzU4ODk7OTg4NzU7Ozo5OTg5OTk4ODg3NTo1Nzo5Ojk4ODk4Ojs6PDo7Pjo7ODU4OTU1ODU3Nzo0
NTU6ODo4ODg7Ozs5ODkzNDU4NTc3NTk6ODU0NDQ3NTc1NTo3NTg5NTg4NDU3Mzg5NTc3NTc0Nzo9
NTUzNDU0NTg1NTo5OTk3NTM5NzU3NzUxNTc1Nzc3NzU1NTk3Ojg5NTIzNDU1MjU6NTQ5NzQzNTU0
NTQ1MzMyNTU1ODU1MjM0NTg3Nzk8ODU7Ojc5ODM0ODU3Ozo6OTUxMzk4Nzc4NTk1NTU6Ozo5ODgy
Mzc1NTc3Nzo4NzU0ODc1Nzo5NDU5OTk4Nzc4Ojk1NTU1NTk1ODg4OTU1NTU1OTk1NTg1NTIzNTw6
Nzk4NzU4NTg3Nzk4NTc7Ojk6OjU3NTU4Ojk3Nzg6ODk6Nzo4OTg8OTQzNDU1NzU6Nzg0Nzg1ODk4
NTUzNTU0ODk1NTo5Ojg1NTQyNTU5NzU3ODc4NTM1NTU1MzI0NTU1NDg1NzU0Nzc0NDU3NDI3NTIy
MzM1NC8zNTI1NzQzNDQ3NTc0MzQyNTQ1NTQzMzM0NDQ1ODQ0NTQ1NTU0ODI0NTU6MjI1NzQ1NTc3
NTIzNDU1NzU1ODU4OTU1Nzc1MjU4PTc1NTU3OjM1Ojc3NTo7ODc+ODg4ODg5OTU0OTk3OT04OTk5
Oz06Ojk7OTg4Oz08ODg5OTk6ODU4Ojw5Ozo1OTk4ODU8Oz06OTg3OTg5Ojo6NzU6Pjw7OTw7Pjo4
PD47Pjo3Oz46Nzs6Ozo9PDo6Oz49Ozk8OTs6OTo5OT47Ojg5OTo6Ojo3Nzk3OT49Ozk6Ozw6Nzk4
Oz0+Ozs7Ozk7Pjw7OTw8PTw9Pj07Ozw9Pjo8PDo6OTg4Ojw8Ozo8PDw4Oz06PTk3ODs6PTw8PDk5
Ojk5PTs4NTg8Ozw5PTw7PTw7Ozs8Oz4+Ojg5Nzc8OzQ1ODs8OTs6ODg9PTs1PDo1NTw7Ojk5ODo4
NTc4ODo8ODo8Ojw7Pjw1Nzg1OTw8Ozk8Ozc3Ojs7OTc7Ojc9OTk1NTc5ODo5Nzo5Ozs4Nzw6PTw3
ODg4OTk6ODo7Ozc6PD08Ojs6OTU7PTtBPTo3Ozo5Nzk8Pj46PDw7Ojg1Nzk9Pj4+PD47NTU7OTw9
Ojs9Pj49PDs6OT08OTk6PD47Ozw5Ojs9QDo6QDg3Nzc5PDo6OTo+OjU6PTs8PT4+Pjo+Ojs8Ozk7
PDg9Oj07Ojs5NTk8PDk6Ozg8PDo1ODo4Ozw6Ozo7PTo3Ozk5ODg+Pjc4OTg5Pj0+Oz08ODg6OTs6
PDw5Ojs8PD4+OTw7PDs5PDo8Pjw6Nzk6NT07ODc4PD4+OTxAPT07PDs7Pj45Nzg5Ojw+PDo7Pj04
Oz07PDs8Ojg8Ozs6OTk8Ojo7Oz5APTw7Pj09PT47ODk9Ozs7Ojg8OTk6OTk8Oz07OTk1MDMxMC4y
MjIzMi4xNDIwLC8yMzUzNTI1Mi8wMTAxMzI3NTEvMy4uMTQwLjAyMzAyMTEzMzIwMDIyLjAvNDEv
MTIvLjIyLDAzLjMyLzIzNTIxMzE0My8uMTEyMzIyNDU1MjEyMTQzNTE1NDM3NTAyNDAwMDA0MDE0
NDU3NTMzMjMzMjQyMTAwLzEsMjQzMDA0MzEzMS8vLzMzMzQwMTIyMzIxNDQxMzUxNDIzMTExMjU1
MDAwMjM1MjIzNTMxLzM1NTQzMzAyMTMyNTMzMDQ1NTMvMi8zNTMyMzIvMzEwLzE0MTExMjM0MzAy
MzQ1MTIyMzIwMi8sMzc3NzMxLjM0MTIzNTEzMDI0NDM0NDEzNDQyMjIzNDAwMDEyMDIyNTMyMjIw
MjMwMzMwNDMwNDMxMzMzMzIyMzQyMDQyMzU0MDIzNTU0NTIvLjc1NTAsNDQuMjM1NDc0MzQ1MzIx
NDEzMTU1NDg1MzQxMC80NTQzMjMyNzo4NTU1MDM1MTIzMzM0MzU1NDEsMTU1MzUwMDMzNzUzNDQ0
NTc0NDQzNTMyNTM0MTE3NDE0NDAxNDQ1Mjc5MzQzNDEzMzIxNDUvMjU0NTU3NTAuMzMzNTU1MjE3
NDI3ODUzMTEyMzIxMzM0MTEzNTQ1NDU3NTg3NzU1NDMzNDI1MDEwMTMzNDUzMjMwMjIzNTczMzUz
MzM4NTQzNTU0NTU1Mzg3NzUyNzQ0MjUzMTIzNTc1ODU0NTQ3NTM0NDM1NTE1MzIzLzMzNTUyMTMz
NTQ0NTg1NTc0NDI1NDg1MjI0NTU1NDMyNDU0MzU3NTQ0MTQ3MzM1NzM0NTQ1MTI3NTU1NTc6ODQ1
NTIxLzUzNTUzMTEzMTQ1Mzg1MC8zNDc1NTMyNDg3MS8sLzQ0NTU1NTU0Mzc3NTIyMS8uMzI0MTE0
NDU1NzUzNDU1MzQ1MjEyNzUzNzc1NDUzMDQ0NDA1NzMzMjIxMTM1NDUzNTEyNTI0NDEvMDIzMjU1
MzQ1NTQ1NDQ1MTE1NTU1NTUzNTU1NzQ1MzEyNzQyMzU0MTMzMjExMzQ5NTMxNDM1NTQzMzU3OTU3
NTU1MzAxMjM0MjM0NTM0NTc0MTU0MzU1MjM0Nzc0MjM5ODc4NTU3NTU1NTg4NTQzNTczMjU1NzIy
NTk4Nzc0NTQ1MzQ0NTUyNDM5OTU1MzU1NTMzMjQyNDU0NDM3NTMzNDQ0MDI3NTE0MTI1NzU3OzU0
MzUzMTQ6ODg0ODMyNTc6NzU1ODo6Ojc6Ojo0OTk7OTU4OjU5Ojk8OTc4Ojg3NTo5OTg3OTk1OTg6
OTo5OTg4ODk7ODg9Ojo5Nzk7OTk7Oz48NTg1NTU3Nzo3ODg1Nzk7Ozw1NTg8PDo7OTQ6OTk7ODU1
ODk3NTk6NTg6PTk5OTc7Nzk1ODU0OTU5Ozk1NTk6OTU0ODU1ODk5NTg1NzU6NzU4NTo7ODc5NTM3
NTU4NTUzNTQ1NTQ3Ojk4Ojo5Ozc3ODs4NTU1ODU3ODg1NTc3ODo8ODc1OTc4ODU4NzU0NTg4NzU3
Ojs6Ojg4ODc5Ozk4NTQ1NTU0NTc3NTg3NTUzMzQ1NzczMzU0NTc1NTU1NTc4NDU5OTk1NDQ5Ojg4
ODU3Nzg3OTU4PDk0Mzg3NzU1ODU3ODU1NTQ3ODk8NzU4NTQ5NTUzNTk1NDg3NTU5OTg6NDs4ODo6
OTg6PDs4ODo5NTU5Nzc1Ojw9OTo5OTM4ODk7NTU1NTk7NTk4ODc5NTc1ODU3NTU1ODU1OjU1ODo1
NDc1OTo0NTU0NDg1NTc3ODU4NDM1NTU6NTU4Ojg1Mzg3NzU3NDk1OTg6NTMwMDQ1NTM1MzU1NTM6
OTQxMzQ3NTUyMTI1ODQ3NzUzMzI1OTU4NzU1NTU1NTc3NTMzNTQ1OjU0NDg8OTU1NTU0MjU4ODc1
NDQ1OTg1NzU0NTQ1NTU1MzI4Ozs5NTU1NTc3Nzc4NTU1NTU3NDU7Ojs3NDg4ODQxNzo0NzU5OTw7
OTo4ODk6Nzg1OTs7ODc6Ozk3ODk7Ojk5Ozw4Ojc1ODk7Nzg4NTM1Ojk1Nzc3Ozg5ODg5OTs7OTo6
NTk5Nzg7Ozc6ODk0ODs6OTU4PDs5ODo7Ojo6PDk4PDo3PkA9Nzk5OTs7Ojs8Ojs5Ozs+PDc7Oz03
Ojs+OTk5Ojo8OT1AOjk6ODg7Nzs7PDk7Ozw5ODw5Pj46Ojw+PT4+Ojg9QDs6Ozo7PDs5Oz0+Ozs+
PTs6Oz05Ozk4OTg5Oz49OD49NTc8Ozk+Qz47Oj03Ojw3Oz08Ozk7ODg7PTk6Ojk3OTg8OTg4Ojo4
NTg8NzU6Ozg6PDc6OTo5Ojc3NzU8Ozc0NTU4OTk9Ozo1Ojw7NTg8PDw6OTw7Ojo5ODo5Ozk3ODw9
PDk8Ozg5Ojg8OTs8Pj4+Ojs5NTU5PDs5Ojk3OD09PT48QDw1OTg6Nzg5PUA+OztCOzs+Ozc1Oj07
OTo8PD49Oj46Ojk7OkA9PTo8PD47PDk6Ozs8PT5CPj07Oj4+PD45Oz4+PDs6Ojc3Ojs5Ozg4Ojs9
PTs6OjU5OTw8OTo5Nzk8Pj4+OTk6Ojw+PTw4OTs+Ojw7Ojg3ODc6Ozc6Ojw9Ozo9PDo8Ojo6PTo1
Ojo6PT09Ojk6Ojw9OTk9PTo6OTw8PTc6Ozo7OTo7Oz0+Ozk6Ojg3NTc4Oj08NTg3OT0+PT06OT06
Ojw9PTw5Oj09Ojs6Nzg7OD09ODk6PDs5PT48OzU5Oz05OTg5NTk5Oj05ODk8OS4wMC8zMjMyMDAz
LDEyMTE1MzMxMTIxNTUwMTQxNDMzMzMzMjE0NDAyMDEwMDI1NTQ3NTQ1NTQ0MTEzMjA1NDM3NTI0
NTQ4NTEvMzQzMjEwMjIyMzMxMzMyNDUzMC80NTU0MTAxNDM1NDExNDU4NTQzMDIxMTI0MjMwMSws
MjU0NDMzMTExMjQzMzMyMDU1MzQ1NTE0MzIyNDUzLzEzMTEsMDEyLzEvMDQ0MTMyMjExMzAzNDI0
NDMyNDIwLy4zNDMwMTAwNDAxMTAwMjAzNTIvMzUyMjMyMDExMDAyLy4yNDUuMDIyLjU0MjMzMjE1
NDU3MTAvMDU1NDUzMjI1MzE1NDIuNTUzLzEyMTQyNTQyNDIwMjAvMzM1NTIzMzEyMTI1NDU0NDIv
Li4xMzI0MiwvMy8vMjExMi8wMDQzLy8uMTEwMjI0MzIxMC81NDMwMjExMjQzMS8uMCwxNTQ3NzI1
MzQyMjA1NCwyNDU0MzM0MzA0MzQyMzEzMjQzNDMyMjExLjM1NTEyNTUzMjMyLDIwMTMyLzE0NTIu
NTMvMDM1NDUzMzI1MDQ3NTQ1MzA0NTQ4ODc1NDU1MzQzNTA1MzU0NDMyMzMzNTg0MjM3ODQ0NDQ1
NzMyMzIxMDE0MzU0MzMxNTg1NDIyNzc0LzM1NzU0NDMzNDUxMzU1NDU1MzQ1ODUxNDk1MjMyMTIz
MDE1NTUyNDMwMDAxNTUyNDU0NDMyMjM0NDQ1NTIyNDMzMDEwMDQ4MjExMjU1MjAzNTIzNTk1MjEx
NTI0NTU3NDUzMzU1NTQ3NzUxMzQ1NTIyNTU1MjU1OTo3NTIxMTMyMzU0Nzc1MTMzNzU3NTQ0MjQz
MjQ3ODUxMTc5NTcyODgzMTQ1NTIzNzo4NDQyNTMzNzc0NDc1NTU3NTU6NDUxMDM1MzAyLzI3NTIy
MjQ0MTo5NDAwNDU0NTIzNDQ4ODc1Nzc1MzI1NDIwNTUzMTQ0MjAzNTg1ODc4OTU0NTU0NTg1NDEw
MzUzNTU3NTU3NTg3MzMyNzQ1ODU1NzU0NzQxNDU3NDU0MTQ3NTQwNTg3OTQ1NDI1NDU1NTIyMjQy
MTI0NTc3LzIyMjM3NDg1NTU3Ojg0NDE1ODQzMzg0MzEzNDc1MzMyNDQ1NDU3MzU0NTczMjEzNDU3
NzUxNTUzNTg1NTU4NDU0MjQwNTM1NTMyMTQ1MzM1NDU1MTIvNDM3OTc3NTs4NTc1NDU1MTU4NTU1
NDU0NzM5Nzk5OTk1NTI3Nzo1NTc1ODk3OTg6Oj08NzU1NzU4ODk7Ojk4PTw3Ozo7Ojs4ODg4Ozk4
ODk4Ojo7OD05OTk8ODU3Ojc1OTo4Ojs7ODU3NTw6Ojc6NzU1OTgzNDc3NTo3NTg1NTc1NDc1ODU4
NDg3NzU6NTQ1ODc1NzQ1NDU0NTU1ODU4Nzg1NzQ1NTc5PDUyNDc3ODk3OjU0NTU4NTU1NTc6NzU3
ODU1NTUyNTU0NTc5OTUzNTU3Nzg1NTo3NTU4Ojo6NTM1NzUyNTg3NDI1NTU4NTI1Ojs1NTg3Nzgz
NTU3NzU3NTUzNDc1OTk3NDk6NTUzNTg4OjQyNTU1NDU4ODg1ODU3ODc1NTQzNDU3Nzg5ODg4NDg5
NTc4ODg0NTc3ODU1Nzg6OTc3NTU1NTQ3NDg1NTU1OTw5ODg4MjU1NTc3Ojg5OT03MjI1NTU0OTc6
OTc5Ozs5OTg6Pjg1ODc4Nzc3NTc4NTU4OjU1ODU4NDQyMjU4Nzg7OjU0OTU1NTU1OTQ0OTQ0NTc5
OTc7ODs5Nzg6ODg3ODU4ODs1NTg0NTc1Nzk3NzU1OTU1NTU5NzU1NDQ1NTg3MzM1NzQ0NDM1Nzcz
OTUzNTg5NDg6NTU1NTU1MzM1NTc1NTQ1MTU1NzU1NTQyNTQ1Nzc4NDEwMzU1NTM1Ojg0NDU3NDU1
NTU1ODU3NTQ4ODQyNTUzNDQ1NTg5Nzg1ODk3OTc3ODc4PDk1NTg5NDg8Nzs6ODs8PDk3NDg4Nzs7
OTs6Ozo7PDk5NTc6ODs7Ozw8OzU1OTo1ODk5OTgzODc1Nzk3NTU1Nzo4Ojo9OTU3ODo8Ojg7PTw1
NDk5Ojg6PT06Ojk3Ozs9QDo3Ozw5Ozw5ODU4OTs8Ozo8Ojk6Pjk6ODk6Ojk5OTk5PTk4Ojw6Ozo6
QTw8PD45PDw5PD48Ozs5NTk9Ozs8Pjo9Pjs7OTk4Oz49Oz43OTo4Ozk8PTw5Nz41Nzs7PD0+PkA8
OTk+Pjw+PTw4Ozw8OTs6Ozs7OTs4ODk5Nzg8ODg5Nzo3OTU6Ozk0NTk8PTs6Pj4+Pjs9OjU3OTw6
OjU4Nzc1NTk8OTc4ODg+PDc5Ojg5NzU3ODg6PTw3Mzk3PDs3NTk6Oj04Nzk5MzU6ODg6NTk7Ojg1
ODo8NTg7Ojo5ODs6Ojg6Ojs+PDg6OTo3ODs5Ozs5PEE+Pj45ODs8PDs3OD4+Pjg5PDk+PT47Oj0+
Ozw8OTs+Ojk8PkE+PDs7PDw+Pjs7Pjs1ODw7Ozs4OTw8PT4+PT46ODo6OTk4PDk7QDo7Ojs8NTU7
OTk6OD4+PTs5PTc1Ojk8PTs5Ozo5OTw9Ozo4Nzo9Ojo4Ojg4Ojk6Nzc1Oj0+PTw8Oz1AOjk6Oj0+
Ojs8PTo7PD48Oj1AOzs9PUFBPTw3OTk8Ozo7PT47Ojw7PDs7QDs5PTg5Oz0+Ojg7Ojg7PDo8PDk+
PDs9Ojg5Pjw7Ozk4PTw6PDw+Ojs7Oz05ODo9Ozc+PDk+QD47Pj05PD46NzQzMzI0MzQ1MjMwNzUx
Mzk1MzM0NDEyMjEzMDEwMjEwMTExMDIxMjQzMjcyMDEzNTQ3NTIwMjMzNDU0NTMyMDEzNTMvLDEw
MzUzMzE0MzIyNTIyMzQzNTM0MTIxLy4yNDExMjAzMzQyMzEyMDIzMjI1NDc1MjQyMzUwMTQzMy4w
MzI1NDMwMDIvMTQ1MDM3NDM1MzM0MjE0MDI1NzQwMDMyMy8vMjUyMzU1MzMvMTQuMTUxNDcyNDMz
NTMxMTQzNTAzNDIzODUwMTM1NDMzMTA0Mi8zMzMzMzE0NzUvMzU1Mi8wMTIwMDEyNTUzMjI0MjEz
NTIzMi8yMjE0NDMxNTExMTQ0NTQzMTEyNDQ0NDQ3MzIzMTQ3OTU0NDMyMDMzMi8wMjEyMTEzNTA0
NTMzNDM0NTQzMjczLzEwNDU1MTQzMi8zNTUwMTExMTc3NTQ0NTQzMTEzNDQ0MTM1NDQwMTUxNDUz
MjE1NTI1NTQ1NTUyMjQyMDA0MzcyMTI0MjA0ODM1NTIyNDIyNzMvMTExNDUxMDIyNDU1NzQzNC8y
NTQwMjEyNTM0NTc0MTQ3NzIzMzMwLzM1NzU0MzM0MzM1My4xNDU3NzQ4NTQ3MzUzMTQ1OjU0MzQ4
NTUzNTU1NDU1NTE1MjM1MzI1MzQxMzc1OTQ1NDA1NDIuMjU4NzU0MTQ0NTQ0MTc4NTM0NTQ0MzU0
NDUyMjQzMzM0NDMxMzc1NTIyNTczMjU1MjM1ODUyNDU0NzIyNzk1NTgzMzkxMTc1NTIyMTAzMzUy
MTI1NzQ0MjAyMjM0MjE1NDEyNDUyMzQzNDczMjI1NTc1NTQ1NTc1MzU1NTc4NDU1MzU0NTQ5NzI0
MjU4MTM1NTk1NTQxMTMzMzU3NTQ1MTUwMDEzMjIzMjIzNTU0NTU1NTQ1LzMzMDI0ODU1NzcyNTU0
MjI1NTU0MzQ5MjQ1NTQ1NTMyNTMzNTcxMzMyMTIwMjMxMzM0NDQ1NDIyNDc4NTIzMzg0OTk6NzM5
NTQ4NzU1MzE0NTUzNDQ4NTQ3NTQ0NDc0MTU4NzU0MzQ0NDQzMzQ1NTUwMzQ0MjU1MjM1NTc0NDU5
NDE0NzczMjMxMDEzNDMzNTg1NDMyMDU0NTk1NTU3NzQ1OTk5NTc0NTU4Nzc5Ojc4NTM3NTc3Nzc0
NTU1NDcyNDU0MzEyNTU1NTQzNTU3NzUyNDM1NDU1NTU0MTQ1NTg1MjQ0MzMzNDU5NTU1NDM1NTMy
MzI3NTMyNTM0Nzc3Nzc1MzU1Ojs3MzU1NTUzOzg1NTM5Ojk3NTc4ODk6OTg5Ozs5OTo1NTc8Oj09
PTo9PTc1NTs4NDw7Ojo4Ozs9Pjk3ODU1Ojk9PTs5PDk4Nzc9PDg5Ozw8Nzg3ODQ1ODo6ODk6OTg1
ODo1NTc3ODg1NzU5OTw1Nzc4Ojs3OTk6Nzg3OTo5NTk4NzM1ODk1NTg5OTc5Ojg6ODs4NTg5ODk5
NTQ0OTU1NDc0NTU1NTI3OTUzMjU3OTo7ODU6NzU7MzE0NTk4NTc6OTU1NzU3Nzk1MDI3Ojg3ODc4
ODk1MzQ4ODU1MjM1ODk4NzE0NDk4ODg1NDU1NTU1NzQzNDU1NDQzNz47ODg3Mzc1Nzg1NDU4ODc4
NDc1NTU3ODU3ODc1NTU3NTc1NTU3ODc4NzU1NTU1MzU4Ozk1NDU4NTk4NDU1Nzk6ODo1Nzc1NDM3
NTU3NTc3NTg5ODU5OTo1Ozs6ODc1OTk7NTc5Ojs6Nzs+Ozg4Ozw4NzU6PTs1ODc1ODc6ODc1Mzg5
NTU3Nzg4NDU0NTc5NTM1OzU0NDUxNDU1NDU3OjUyMzc4NTQ1NDU0NzMyNDQ1ODcxMTU1NTU5MTU0
NTgzNTg1NTUzOTU1NTc3ODg4OTUzNTU0MjMyNzU3NTU1NTQ0NTc3NTc3OTg3NTM3OTc1NTk4NTc1
ODU1NTU1NTQ1NTc5Nzg4Nzg6NDI6NzU1ODk6NTQ1NDUzPDs1OTg4ODg3ODg6OTc4Nzo+Ojc1NTg3
ODk1NTo5Nzc7OTo7Ojk6PTw5NTU7PTo8PDs8PTg7Ozs+ODo9PDUwOjc1Ojo3Ozo4Ojk3Nzg6ODc3
Oz04PD49PDc4OT07Ozw7OTw+Pjs5Ozs4Ojs5Ozk5Ozw7OTs8Ozg1OD07PDw5OTg1Ojw6Oz08Pj47
Ojc5OTw+Pj08OTs9PDs7PDw8Ozo8Ozo5PDw7PT47Nzs7PT05Ozg3ODk+PTk7Ozs5Nzg4PTw8Ozo6
ODg7Ozo5OT07OTg9OjU8Pjs7NzU5Ojg6Ojk4NTs6Ozo5Ojs5Ojk5ODo5PTo8PDk5OTk5Nzc7OTg5
OTk3OT46Ojk1Ozg7NTk4Ojc3Ojo6Ozo5ODo9OTk7Ojo3NTk6ODg1Nzo6Ojs5ODw4OTs+PTU4NTg6
OTs5NzU5Oz1APTk4Ozw5Pj48Ojs+PT4+PDs+PTk4OTxAPj49PD49PTg3PD06PDw8ODs9PDw8Pjs5
OTo6OTw8OTU5OTc8Pjs8Ozw8Pjw8Ozo8Ojo6Pj45PDk4Oj4+Ojw6OD08Oj07PDo5Ojk5ODc4ODc5
Ozw4OTg5Ojo7Oz48ODo8PTs5Pj09PTg6OTo5Nzs8Oj4+ODo7PTg6NTg6PD0+PTs7PDs7PTs3PEA3
Nzw+PD48PD1BPjs6PD08OztAPDo3OTU5ODg7PDw5PDs6PTo8Oz49ODc4OkE8OTw+Pj41OTw9Ozk5
PD04Ojw+Pjs5Ozg6NzU9PDw+PTo6OTk4OD4+PDk8QDk6PDs7OToxNDU1MjQxMzEyLzExMTI1LjIw
NDg3MjExMjUzMSwwNDQwMjExMDA1MC8zNSwwMjMyMzEwMDAxMjQyMDQyMzIwNDM0MzAxMjQzNTQy
MzQ1NTU0MTExNDMyMTEzNDUzMzUzMzIyMjM0NDAxMTc1NTQ0MjQzMTIxNDIzMjAyNDEzMDIxMTM0
NDAxNDU4MzA0MiwxNDUyMjIvMC8yNTUxMjQyMzM0MzExMTE0MS80NzQyMjI0NTEzMzM1NTQ0NTU1
MjQ4MzAxLzU4NzU3NTMyMzMvMTMxMzQyNTUzMDI0NTM3NTQ0NTU0NTMzMjAyMi8xMC8vNTQxMC4u
NDAuMzQ1NDU1NDIyMDExNTUzMjQ0MjIyNDQyMTUzMjI1NDU1NTU1NDQvMDIzMTIwNTM4NzIyNTMx
MTMzNDMzMTQ1NTMxNTQwNDgzMzMzMjMzMjQ0MzI0MjQwNDEvLjE0NTM1My4xNTIxMjM0NS8wNDI4
Nzg4NDUzMjAwMzM0MzM1MS8zMTEwMzA0NTc1NTIyNDM3NTIzMjUyMzIxNTU1MTM0NDQ1MzU1NTc1
Mzc3MjM1NDMyMjk4MTEyNTU1NTQ0NzQ0NDMyMTU4NzM1NTMyNTUzMTE0NDU1MzM0MzU1MDIwMTM0
NDIxNzMwMDg1MTI4NzQ1NTQ1NTU0MTEzMzI1MzMzMjIxLC8xNTIuMzQ3MTAxNDIyNDQzMC8wMTQz
MjUyMDU0MzU0MjQ0NzgzNTUyMjM3NzMxLzA0NDI1NTMwMTMxMjEwMjMzNDUzNTMzMS8zNTQ1NC81
NTE0NTQvMjEzMzQzMjI0NTQyNTg3NTAzMTA1MjU0MzExNDUzNTMyMzEzMzczMjQ1NDAyMTMzMzMx
MTEwLzUzMTAyNDMwMzQ4MTI1MzU1MjE0MzIzNDM1MjgyMjM0NDMxMzM1MDAwMjIuLDAuMTQ1MTQx
MzEwMzIxMjAyMzM0NTMyMi40NTU1NDQzNTU1OTU1NTc1MzQ1NTMzMzM1MjQ3MTMxNTkzMjU1MDI0
NTQzMTEzMjUzMzQzNTQxMDAyNDI1MTAyMjc1MzM1MjMzNDc6NTEyMjU1NzUxNzQzMjM1ODk4MzQy
NDU1NTUzNDUwNDQxNDc3OTQ0NTM1MzU0NDU1MzQ1NTQzNTAzNTU0NTc0MTU0NTo1NDU0NTczMTUz
MjU1NDc1Nzg7NTM1NTU1Mzc3NTc1NTQ4NzU1Ozw3Nzc1ODo3NzQ4NDI1NTc1NTU0NTU5Nzo5Nzc4
NTk4ODg7OTU1NTU1NTc3NTQ1NTk8Oj01Ojo7PDg3NTc7Ojk6ODs7Nzk6Ozk7OD07NzU1NDU5ODU1
NTo6OTU5OTo4Nzg7Ozk5Ojo7OTg3Nzk6Ojk4OTk7OT08OTw9ODc5NTc4Nzo8Oz09ODM1Ozc4Ojw5
Nzc5Nzo5ODU1MzU4ODg0OTk7OjU3OTk1ODU3NTI0NTk4Ojc4NTQ0MzM1Nzc5NTc3NDM1ODg4NDU1
ODc1OjU1NDQ1NTk0NTU4NTU0Ozo3MjM5ODc6NDM1ODg1NTU3NDU7ODg0NTc4OTk0MzQ1NDc8NTU5
NTk3MzQ0NTo5NDQ1NDEyNTcyMjQ4ODg4ODU4OTk1NDU1Nzc0NTU3MzM1ODk5Ojk5NTg7NTM1NTU4
NTQ1OTo5Nzg5OTc5NTU1NDQxMTc1NTU1NDo8MzU6Ojs4ODg0NTU1NTg9Ozg6ODc1NDg5Oz06NTU1
NzU6OTc4Ojg4Nzg7ODk4OTk4Ozg1PDg4OzQyMjc4NDc1NTM1NzU4NTU0NzM3PDg4ODk7NDg3ODc3
OTU1NTMzNTs3MzUxMzU0MzUxNDU3NTI1NzU3ODg1NTc4NTIxMzc1MzMzNTU1NTU4MzQzNTU0MTM6
NTk1MzU6NTU4Ojo1Mzc1NTU1NTc1ODwzNDQ6NTU6NzU0Nzc1NTg1NDM1NDQzNTk3Nzg5NTc5NTU5
NTU3NTk6NzU5Ozk7NTQ3OzU4Ojo3NTs5Nzo7ODU3OTk1Nzk3Nzc3OTk1NzU3OTo3OTo3NTU4Ojc1
NTcyNDU4PDs6OTU4Pjk5Ozs7Ojw4NDg7Ojk5ODo8ODs6Ojk4NTc5Ojo4OTk6Ojo3OT45NTw8PTg3
Ojk7PDk6PDs5Nzc6NTs9Pjc5ODg5Oj06OTo4Ojs7Ozw8PD08PT05Ojw8Ozs7PDo7PDxBPj07Oz45
OTk5PDw7PD08PTw3OT45OkE6ODs7Oz49OD06Ozk4OTg3Ozw7Ojc5Ozo9Oz05ODk8Ojw8PTc5Oz48
ODw5Nzk6PEA8NzU1OTs7Ozw5ODo5ODg6Ojk7OTg5PTg4Ojo5Ozo9Pjs3Nzk5Ojg5PDs6OTc4PDs1
NzQ1Ozo5ODg1NTc6Ojs1ODw6OzU0Ozg4OjU1Ozs6OjU3Ojg4OTc8PDk6PUA+OTU5Ojs6Ozs5PDw+
Ojk4Ojs6PDo5PD07PDw4OTs8OTo+Pjw8Ojs7PD4+QT0+PDw+PDw6Ojw8PDs6OTk7PTw9Ojo4Ojw+
PDw9OTs9OTk5PTg4OTs7PT07O0I9ODg9Ojc4PTs8Pjw7Ojk5PTs5Oz0+Ojk6PTk8Nzs7Ozo8OTo7
Ojg6PDc6PD05OT1APDc5OkBBPDs9ODk5PTo6Ojs7Oj47OTU6Ojs3ODk7Pjk6OT5BQTo1ODo9Ojo4
PDw7Ojo6PDw5OjQ0NTg5Ozo9Pjk6PT06NTs8Ojo7OTw9ODk6Oz48Ozs8Ojw8PT0+PDg6OztAOjk5
Ozw7PT4+Pj04Ozw7PTw9Pj4+PD47OTs9QDo1NTs+PDo7PjUxMTEyNDQxNDMwMzEwMzIzLjAxLzAy
MjI0MzMxMDIxMi4sMDQxMC8uMDQzMzIxMi8xMjMuMTEwNDMxMSwvMC4xLzAyMjMzNTUzMzIyNDUx
MTEwNDMvMzQvMTExMjU1LzAuMTEzMDMzMjIzNDMyMDI3NDEzMjIyMzExMzQvMjEyMzQ0MzIyMjE1
Mi4yNDQ3NDExMTEyMS8wMTQ0NTIyNTA1MzUzNTc0Ly8xMzIxMzQzNDQ3NDIzMjEyMzM3NDQ1NTQz
MTMyMzIuMzAvMjU1NTIvMTU1OjU3MzUyNTUyNTQ1OTQxMzExMzQ3NDIvMzEyMTIzLy8zNTU1ODUx
MDAyNDU0NzIzMzMyMDAwNTIxMzUyNDQ0MjIwLy40MTQyMjQwMTMzMzIyMTMxMS8wNDMzMjA0NzQy
MDc0MDEyNTM0MzAyMjEzODUyLzEzMzMyNDUxMzcyMjM1MzQ1NDMyMzM0MTU3MTAvMDEzNDczMTU0
NTMyNTMxMDU0MjI1NDcxLzUyMzI1My8yMTIxMTEyNTg4MzAyMjU1NDIxNDA3NDQ1NTE0MS4xMzU0
MzQ0MjA0MjU3NTIyNTMzNTUzNDQ1NDM0NTQxMzExLzA1NTQ0NTUzNTU0NTQyNDA4Ny8zNTc0MzMz
MzMyMDMyNTEyMjM0MTM0NTc0MzExMzc1MTQ3MzIvMjIyNTg1LzAvMjMxMzQzMjQwODQ5MzQ3Nzk3
NTQyNTUyMjc1NTU1MzQwMjI3NTc5Mi8zNDU1NTQ0NTMxMjU5NDUzMi8zMzQzMDI0MzM3NS8wNDMx
NDUwMTMzNTQwMjA0NDU1NTg0MjI1NTU1NTU0MzAwMzczMDc1NTM1NDQ0MjI0ODU1MjM1NTU1NTc3
NTE0NTQzNTc1NTc1NDU4ODU1NTM1NC8wNDMyMzQ4MTI0MzU1NTE0NTMzMjAxNDEvMjM4NTc3NTU1
NDU0MDQ0MTAyNDI3ODMzMzAwMjc3NTIxMzEzMTQzNTMzMzQ1NTc1NzQ1NDEzMzI0MzM1NzU1NTIx
NTI0OjM1NDMzNTMxMTI1NTQyMjEyNTU3NzQzMi8sMTU4MzI0LzQ1ODg1MjMsMDI1MzQyMDMxMzEu
NDQ0Mjc0MzUzNTU1NTUyMjQ3NTI1NTI0NTQ1NDQyNTg0NDU1NzczNDM0NTUzNTI1NTM3ODU4NzQw
MjQyMTQ1MzM1MjQ0Nzg4NTU1Mjc1NTU3MjQzMTU1MzIyNzQ3ODU4NTg1NDgzNTQ1NTQ3ODk3Nzkz
Ojk0NTc4Nzk3ODo6NTg3Mjc5OTg6ODo6NTc3Ozg3NzQ5NTg3OTk3Nzg1Nzk5OjQ3Ojg6OTc4OTU1
Ojw7ODw4Nzo6Ozk8Nzk8Ojc8ODU7ODo7OTs7Ozo5NTk8ODo8OjcyOjw4MzQ0Nzc4Nzo4NTk7ODU5
NzQ3OTk1NTU1ODg5ODU0NTU6OTo5ODU1NDU1NTM1NTk3Ozk1NTQ1NTc4NTc8OTs3Nzg3ODk1Nzc3
ODU1ODc1MzMvMjc1Nzg6ODU5NDg1NDc4Nzg7OTs4Mjc4ODQ1Ojc1ODQ1NDU1NDg4Ojk4Ozo1OTg5
ODU5ODk5ODc3NTc1Nzk3ODk1NTU5OjU6ODk4NDQ1Nzk5Ojo1NTQ1NTc7Ojc6NTU1NTg1Ozk6OTg3
Nzg5Ojg6NTU1Nzo7NTg3NzU1OTc1Nzg5NzU6PDU1NDU4ODU1NTU3NTc1NzU3Nzo3NTg3NTQ5OTc9
OzU4NTU4Nzk4NTc0Nzg4ODk1NTw5NTc4ODo7OzU3NTk1NTc4ODU3Mzc3NTU1NTk4OTc3ODg3NTc6
OTk4NTU4ODQyNDU0NzU0ODc5ODUxNTk3NTU1NTU6NTI1NTI5NTM0NTU1NDU1MzQ3NTU0NTU3ODg0
MzQ1Nzo0NTcwMzQ4MTg4NTIyOTg5MjI4ODU1NTU0OTU3NTM0NTQ1OTk1NzcxNDU0NDc5ODQyMzIz
NTc1ODU1MzU1NTU4ODk1Nzg3NTc4ODo1NDg1NDU3ODc1ODg3Nzg3Nzc6Nzg6ODg4NTk6OTU5ODU6
NzU3Nzg1NTc4Ojk4Ojc3ODw7NTk6NzQ3ODU1ODU1ODU5NTg1Nzw3ODc4ODc9Nzk6Ozk1NTM4ODU8
ODw4OTc5PDo5Ojg4ODo4ODk4Ozs4ODw6Ojk6OTc1ODU1OD0+Pjw7Nzs7Ozk6Oz05NTk7Ozc6Nzo6
Pjg7Pj07OT09NTk6Oz09ODw6Ozw6OTc8Ojk3ODc8OTc6OTk6Ojs5Ojw8Ozg4Ojs3PDk7Ozk6PTw+
PDw7PTo3ODU5ODo5Nzg4Ojw5Nzk4ODw4NTc5ODc6PD08Ojg5OTs4NTs7Pjs5Ojo6OTg4ODk6Nzc3
OTs7Oj09PDw5PTs4Oj05OzU1ODo5PTs4Nzk+Pj1APjo5OTk5ODo6PEA+Ojc6Ozw4Ojo6Nzo6Nzk7
OTw8PTw1OTk6PT48OTw9PD48PDk6OTc4OT08Oz09Pj48ODk+PDw9PDw4PD07OT4+Ojs6Ojk8OTs7
Pj08PT49PTw7PkA4ODo7Ozg5Pjs8PDk5PTs9PTs+Ozw6Ojs6PTo5OTw9Ojg+PDg5Ojs6OzU3OTw8
Pjw7PDw6NTg3Nzg5PTk4OTk7Ojk6OTg3ODo5Ojk1NTo+OTk+OzU1ODo6PDw5OTo8OTk9PDg5Ojs5
PEA+OjU5PTo8PDg5OTw8PD08OTc7OTw8Ojc5PTg5ODk7QEA3ODo3OD03PTw4Ojk6ODg6ODs4Ojw5
Nzc4Oz07ODc3OD07PTs7PD48OTg6Ojw8Ojk7Ozs7LzMzMjEyMjMyMzIwMzIvLzEwMjM0MzIxMzQz
MzQvMDQvLjEwMTIvNzUzMzMxMDExMzE0MDU1MjIyMjE0NTAsMDMzMTQ3MzIwMzMxLzA0NDEyNDUw
MzIyMzMzMjQ0NDEvMDI0NDMyNTU1Nzg1NTMzMzczMTQ0MzUzMTAyMzEzMzAxMzU1Mi8yMjU0NDQw
MDc4MzAxMTMyMDAwMzQwMjIxMTAwMzEyMTU3NzIvLjEyMzIzMDA1NTMvMjgyNDUzMjMxLzQ0MDEu
LDEzMTAxMzExMTAwNTQzMjEwMTI1NDExMjIzMTQwNTA0MTE0MjAvMTU1MzIxMjExMjQzMzMyMzQ0
NTQxMjAzMzAyMjQzMDEwMDExMTIxMzI1NTUyMjA1MC4sLzQvMjM1MTI1NDQxMzIyMzUyMjIxMTQ1
NTM0ODUyNTU1NTcyMjQ1NTUxMjI0NDAvNDM1NTM1NDI0MzE1NTMwMTQxMjU0NzUyMjQ1NTU0NTUx
MDM0MjAzMjM0MDA1NTQyMjAzMzQ1NTcyNDU1NDo1NTIyNDU1NDQzODk1MzU1NTgzMTUzMjMyMjEx
MTU0NDQzMDQ0MzM1MTExNDU3NDAwMzM1NTQyMzMyMzcyNTQ1OTMxNDI1NTQ1NTQ0MTQ3NTM1NDMw
MjE0NTU1NDU0NzExNDIyMzUzMTMzNTQ3ODU1My8xMTI7OTQzNzg1NTU5NzI0NTMxMzEyNDUyNDc1
MTM1MzIzNTUzMC4yMzU1NDEwMjI0NTQyMjIyNTMzMTU3OTMzMzMwMzEyMjU1NDEwMTQ4MjMzNDUy
NDM1MzU3Ojk1Mzg4NTU1ODU0NTQ1ODQ4OTczMzM0MjEzNzk1MjE0ODg1NDc1Nzc1MjU5OTo4NDM0
Nzc0NTQ1NTg1NTU1NDMvMzc1NTMvMzc1NTQ1MS8yMzM1MjU1NTU1MjIyMTIxMzQ1MzU1MDIwMTU1
NTU1MjMwMDAyMzMzMjAzMTM0NTMwMjMyMjU1MzE1NDc5MzQ1MjIzMDAzMjQyNTgyMjEyMjM0NTc0
MTU4MzU3NTI0Mjc3NDE1MjMxNDM1MjM1MzM1NTIxMzU4NTU0MzM3NTQ0NDU1MDQ1ODU0NDU1NTU1
NTUyNTQzNDc3NTI3OTQyNTQ0NDU1NTg0MzM0ODc4ODc0NTMwMzU1NTQ4ODQ3NzU1Mzc0NDUyMzMy
NDQ1NTQ3Mzg1OTk0ODMwMzk8NTU1NTg3NDQzNDc1NzI1NTI1NTU5OzUxMzc4ODg1NDM1MzQ1NTU1
NzQ1Nzc3NTo1MjQ1NTc1Mzg5ODg7ODg5NTU4Ozc7Ojc1ODw3NzU0NTg4NzU6Ojg5NTU3OTs1Ozg6
Ozg7OjU1ODo4ODk5Nzw9Pjs5PDo+Ozo5Ojg5ODU1Nzc4NTo3PDg7Ojg1NTg4NTk3Nzg5OTc5Ozg5
ODc5Nzc4OTU5OTc4ODU1ODUzNzc1ODg6ODk9ODU1Mzo5ODc7NzcyNDU1ODU5OzQ1NTo3NTU4Nzk1
OTk3OTc0OTg6OTU0MzM1OjU1NTg9NzUyNTU3NDUzNDQ3OTc4NTo6NzU0NTc1NDU3OTg0NTc1NTQ1
NTU6Nzc3NTM1MzU1NTMyODk1OjU1ODk1MzMyNzc6Ozg1ODU0Mjg5OTs6Nzg6Ojk1NTk3OTczNTk6
ODc3NTU1ODk5OTg1Nzg3NDk1NTc3NTU1NTg5ODU1NTU4NTU1Nzg4NTU0NTg6OTo8OTc6Ozo5ODg+
OzU4NTU3NTU1Ozk4ODc3OTs3ODc1ODU4NTo6NTc1NTc4Ojc1Nzk1NTk1Nzg5OD05NDU3NTU1NTcz
NDc5ODU4OjU3NTExNTo4MzI0Nzg0Mzg1NTQ0NzczNDU1NTIyNTg4NTU1NTU0NDc1ODg1NTU4NTQ0
NzU4NTUzNDU1Nzk0NDU3ODo3NTs3MzU1NzU1NTU4NTc5ODc1NTk6OjUzNTcyNTg0NTU1NTUyNTg1
ODw4NTQ0NDU6ODU1ODo1NTU0NTc3Nzo4Nzc3NDU6PDc4ODU6Ojk3NTU4Ojc3NzU3NTg5Ojc5Ojs7
Ozg5Ojs5NTc4OTk3OTg5OD48Nzo8Ojo5Ojw8OTc6Nzk4OTs5OzU4Ojs5OTo8Ozw6ODQ5PDk4NTo5
OTg3NTc4ODc1NTo9Pj45OD08Nzs7ODs6OTs6Ozs7Pjs3Ozs3OUA8PTs7Ojs6PD0+OTk9Ozg3PDc3
Ozk6ODk6Ozw4ODc6PDs9Ojs+PTw8PDs7PD05ODk7Ojo1Nzg+PT47OTo4OTk4ODo8OTk6OTw6Ojg5
Ozo7Ozg7Ojg6Oz08OTs6ODk6Ojs8PDg4ODg6Ozg5NTc4OTg4OTs4ODw5ODw+Ojg5Nzg4OTs5Nzg7
ODo7OTU4OTU4Ozw9OzU4Ojo3NTk8PDg3ODs5NTc5Ojo5OT05NzU4Ozk1Ozg6Ozk5Ojk3Nzw+OTk+
PTk7Ojs8Ojs7Ozs8PDo7QUA+Pj07Oz08OjU9ODg6Oz07OTg1Ozk6PDg6QEA9QDxAPDg8Ozs5ODg5
PDs9Oz5APjxAOTo8PD08Oj08OTo7ODg6PD09Ozw5OTg7PD47PTs6PT04Ojs8ODtANzg3Oz04Ojs6
OTw4Nzs7Pj46Ojo6OTw7Pj48Nzo3Nzg9Pjk4Oj05Oz0+Ozs6Ojo5ODk6Ojs6ODw6PDs6OTo7Oz47
Ozg9ODo5PTo7PDw8Ozs6Ozk8Ozo5NTc5Ojg8Ozw8OTk7Pj07PDo7OTo8Ojw+Ojk6OTs8OTU4ODs9
PTw9Ojo9NTk8PDs+OTc4PDw6OTk+Qzs3NzoyMjMzNDQ0MzE1NTIwMzMzMDIzNzUxMDMyNDQ0MzMz
MjU1MzE1NTQxNTIyLjI0NDU1MjQyMTIyMjIvMzIyMjMxNDUyNTUzMTc1MzEyMTIxMDIyNTQ1MzEx
MDAxNTIyMDEwMTUwMzM1NDIyMTQ1LzAwMzc5NTMyMzU0MzIyMjU1NTAvMTExMTQ4NTI1MzExMjEx
MCwwNTQxMjMyLjAvLDI1NC8wMDE0MzIyNDQ1MjIzNDIzMjEzMjUyNTIxMzQ1My8vMzU3NC4xMjUx
MjQzNDI0MS8wMTEyMjE0NTUxLzIvMzQyNTQ1NzU1NTUyMTIzMjExMzAwNTU0MTAyMTM1MjIyMjQ0
MzEzNDU1NTU0MzUzLzAzNSwxNDEyMjIxMzIyMTEyMzE1NTMwLzExNTMyMjU3MjMzLjIzNCw0NTM1
NTE3NzUxMTExMTEyMzUzMjQ0MjQzMjM4ODU0NDM0MDA0Nzk4NDMyMjQ1MjEyMi8wMzQxNDM0NDMz
NDAzMi80NDM0NDAxNTgyMTAyMzEwNTU0NDQ1NS4vMTM1NTU1NDU1NTQyMjIxMTUzMTE0NTU1NTg3
MzM1MjMzNzc1NTg1MzI0ODUyMDIxNDQyMzM0Mjg3NDU1NzM1LzA0MzQyMzMzNzQ0MDM3ODQ3MzA1
NTg5OTg1MzIyLjA1ODg1MC8xMzQxMjU4NTQzNTQvMDQ1NDQwNTk3MzQ1NDUyMzQ1NzQ1NTEwNTEz
LzAzMjIxMjU0NTU1NTM0NzEzNDE0MzEwMTEvMzI0NDMwMzU1NDAwMTEvMjM1NDMxMzUxMjQ0NDcy
MTIvKiwyNDU3NDc4NTczMTE0Nzk3ODUyMzU1NDc1NTg3NTU1MzU3NzU1NTQ1OTg1NTUxMTM1NTg0
NTc0NTU0MjM1NDE1NDQ0MzAyNDU0NzUxNTgzLDA1NTU1NTQ0NTg3NTU0MTU3NDQ0NTU0MzM5OTM1
NTUzMzU4ODQ0NDQzOTUxNDIzODc1NTU0NTAxNTQvMS8vNDQ4ODM0MjUzNDIzNDk0NTU0MzMzNDUy
NDQ0ODc1MDM1OTU3NzU1MzEyNTU1NDQyNzU1OjUxNTU0NTU1NTU4NTQ0NTUzODU1NTIxMzQ1NTc0
NTU0NTk1MjI1MjU3NzQ1ODs6NDQ1NTQ1NTM1OTcwMjIxNDU0MjU3NTU1NTU0NDU0MjIyMjE1NTE3
ODQ1NTU3NDQ0NTU4NTQ1NTc1Nzk1NTQyNDg4NTU1NzU3NTc1NTM4NTMyNDE0NTQ4Nzc3OTUzOTw5
NTU1OTU3OTo4PTc3NTU5Nzg3NzQ0ODg1NDg5Ojk1NTk7ODs5NTc5Nzk4PDo5Ozg8OTU3OTk4Nzo9
ODc4Ojo3Ojw+PDo3O0A6Ojo4ODg1NTk7PDk1Nzk4ODU7NzQ7ODg8PDo1NzU0Nzk5NTg3ODU5NTc4
ODU3Nzo7Pjg3Nzg1NTQ0NTU3MzU5NTU4OTg3NTU1ODg4ODU4ODk3NTc5NTc1Nzg0NTQ1NTUzNzU4
OjQyNTs6NTMyMjQ1OTU1NzU1OTc1NTg1NTQ1Nzg1NTc1NTk4NTg4NDI0ODU1OTo0NDU1ODU1Nzc3
ODc1NTQ1NTg1NDU5PDg1NTU1OTg0NzU3OTo3MTQ4NzU5NTU1OTc0NTU6NzEyNTIzMTMzMjQzNTk5
NDU4MzU1NzU1NTg1NTU4Ojc5ODg3NTQ3NTc3OTc3ODs4Nzg5NTQ3ODg1NTU0NDc1OTU4OjU3Nzg4
ODU3ODk3OTU1NzU1ODc3NTg3NTc3Nzg4PDs1NTU1NTI3OTg0NTg1NDQ4ODQ0NDIzNTM0NDc4NTU6
MzQ3NTMzNzM1NzU0NTU3NTU1NTc1NzUyNTMyMDA0MTQ5ODQ1NTU1ODU3OTk1NDMzNDM0NTQ1MzE1
NTE1NTM1Nzk4Ojg4NTM1NTU3NDM0NDM1OTU0NzQyOTU0NTc0NTg1MzM0MjU3NzU1NTU1NzU1NTU1
Nzc0NDUwNTk4NzkzNDU8Ojg1NDE1NTU1ODo4NTU1NTM1ODc1ODk1NTg3NDQ1ODs4OTU6ODc3Nzs4
Nzo5OTc1ODs3NTU5ODk1MzM5ODo6OTc6NTg4Ojw9Ojk8OTs5NTg4Ozs5Ojs9PTU4Nzk8PDo8PT45
PDg4Ozo6Ozk1OTk5Ojk7OT09PDw7Pjs1ODo8PTo5Ozk6Ojs8ODU5OTo7Ojo3NzU5Pjs6PDw8PTw8
Ojo3ODk5PDc7Ojg1OTU1ODs7OTw7Ojk5PDU3Nzs4OTg6Pjw+Ojk6OTs4Ozo5OTo5Pjw6PDo4ODg4
ODk7OTs3ODs7PTc4NTg5Ojg5OTw7PDo7OTo+Ozo6NzQ3OjU3Nzk3Oz46NzU6Nzs7ODk8OzQ3Pjo4
NTc1NzU1NTc9PDU5Nzg5OTo8Ozk6OTg3PDw6NTU5PTw3ODo5NzU3Ojo4PTo3Pjw6Ozo6Oj08Ozs4
NTs8Ozo8PD48ODg1OTw6OTc7PTw+Ozs6Ojk5QT08Pj4+Pj08Ozw6Oj49PD09PTw7Ojo+Ojk9PDw9
PT05OT08Ozw9Ojk+PTw8Ojk4Ozs7PTs1Nzw8Ozw8Ojs8PD1AODk9Ozk5O0BBPTs6O0RDQDw7Pjw8
Oj07Ojw8PDw7Oz47Ojk7PUE8Pjw8Ojk5PDo7OjU5Ojk4ODo+QD0+Ozk8PT49PT5APTk7PkI+Pj07
Ojk6Pjw8PDo5PDo5OTc5Oj0+Ozk8Ozo9PTw+PTo6PD07Pj47PD04Nzs+ODk5OTk4NTk8OzQ5OTs4
NTw8Nzk9PDo5Ojg6PD04Ozw5OTs4OS4sMDMyMDEyMzIvLjEzMDExMDIyMC4xLzA1MDMzMjMyMjMy
NTM0MjAyMjUyLzEsLzMzMjE1NTIxNTIyMDMyMDMzMjEyMTMzMTMyMy4xMDMyNTM0MjQzMS4vMzc3
MzMsMDQ0NTI1NTIzNDU0NTEzNDMxMTIyMTIxMi8wNDM1MzEwLDMxLzMyNDEvLzEzNDMuMDEvMDQ0
LjQyMTAxNTUzNTMwLi8wMDE0MjEwNDQxNDMyMzEvMDIyMTAuLjMwLzMzMjA0MzIzMTEyNDExNTU1
NDMyLzI0MTIzMTE0NzQyMDA1NDM1MjAxMCw0MzArNTIwNDQyMjQ0ODQwLjIzNTIzMjQxLzAzNTQx
MDEuLzAxMDIzMzUwMjU1MzQ0My8xMTEvMTM1NDQ0NDQyMjQ0MC4sMDQwMC4xMzAwNDE0MjEuNTQy
LzEwMTI1NDM1MjQ0NTMzNTMzMTAwNDI0MzEzMjE1NDIyNDU3NzQvMTUzNTMyMzU1NDAyNDQ0NTM1
NDUzMjQ0MTU0NTMyNDE0NTIzNzUzMjMyMzU1NTQyMTQ0MjE1NTMsKzI0MTU1NDM1MjU0NTMwMTI0
NDM3NTUzNTUxNTg3NTQyLjQ0NzQ0MjAzNTUvNTU4NDIyMTQ1NDUyMzMyNTQ3MzQ0MjQ1NTMxMDIz
MTA0NDQ1NTUyNDM0ODU1NzEsMTIzMzU0NTU0NTQyNTUzNDEwNDQzMTIyMzQzNTg3MjA0MjU0NTc1
NDI1NTMxMjQyMDM0My8yMzU0NDI1NDUzMDQyNDI0NTIxNTIwMDQ1MDU3NzMzMzIzODU0MzEyNDQ4
NzU0NTQzMzg4NDc1ODU1NzU1NDU0NDQzNTQ1NTczMDU0MzU3ODU1NzM1NTQ1NTc1NTU3Ozo1MjI1
ODU3NTU1NzU3NTc1NDQ3NTQzMTM0Ojg3NTIwMjU1NTQyNDI1NTg1NDIzMjAvMzIwMzUyNTU0NTg1
MzM0NzM1MzQ0NDU5ODUzNTQxNDIyMzQxNDIxNzUyNTM1MzI1NTU1MzQ1NTgzNDUyNTU0MDAxNDQ0
NDU3MzQ0MzQ1MywxNzc5NTEyMjM0MTQ3MzQ1MzM0MzQ0MzU3NTM1Nzg3NDA1NTU1Mzg4NTIzNzcx
MTUyMjU1NzczMzU1NTU3NTg1NTc1NDc4NTU0MzQ0MjU1NDQyMjAyMzM1NTQzMjQ4MzIwMTc0MzU0
OTk1NDU1Ojg3NTg1NDc1MTAzNTQ3MzUyMjI0ODg3OTU0NDM5NTc6PDc1NTg3NTMyNDMzNTU6ODU1
OTg3NzUyMjM1ODk0NTczNDU0NTk4MjU6Ojo6NTc5Ojo4ODU3Ozk4NTU4Nzs3Nzs8OTU1NTU4NTg5
Ozo1NTw6NTU4NTk6PDw7NTo8Oj01Nz05NTk6ODc6OTo4NTc1OjU5Ozk0ODc0OTk7Ojg4ODU3NTg4
ODo6NTc5NTI1NTc3OTU4NTg3NTk5OTk1NzM1ODk4NTM3NTU1NTgyMzg0NTU3NTk5OTk4Nzg3NzU1
NDU4ODk3NzU5NDM1NTQ0NDc4NzU0NTk7NTgzODk5OjU5Ojc4OTo1NzU4OzU5ODg1NTM3ODczNDUz
NDU1NTA0NDM1NTU3ODc0NTU6OTU3OTk1NTQ0ODU3ODUyNTc1Nzg1NTU1NTQyNTc5ODk1Ojk4ODU3
OTU1Mzk8OjM0NDs7OTU5NTc3NTg1MzU1NTQ3NzU3NTQxNTU8NTU4OTs8Nzs5OTc3ODM0Nzk3MjU3
NDU3NTc4NDI0NTU1Ojo6OTQyNzk4OTU0NTg1NDQ1OTczNDU1NTg7NTc6OTc1OTc1NTQ1Nzg1NTo1
NDM0NTUzMTU1NTM0NTc4Nzg1NDM1NDM1ODU1NTU7OTk1NDU1NTI1NTQ1NDIzNTU0MjM1NzU0NTcz
NTk1NTU1MjI1NTU3Ojc3NzU1NTI1ODQ0NTc1NTU1NDc1NTc6OTU0Nzc4NTU0NTo8OjU1ODg3OTk5
NzU3OTU4Ojk8OTc1ODQzNTc4OTU1NzU3Nzc1Ozo4ODk5NzU3OTg4ODo7Nzc6OTc3Oz45OTU3NTMz
ODo1ODc3Ojs6OT09Ozg1Nzk5Nzw+Ozw4OTs6Oj43Nzc4Ojk5PTc1OTk9PTk1NDc5Pjs4PTg6Ozg3
ODk6Ojo4NTk6PTw6NzU5ODo6OzU3Nzk4ODk4OD07Ojw5ODw6ODk8Ojg6PDo7OTw4OTk+PTk6Ojo4
OTg3Ozg3OT1BPjw8PDs+Ozs7PDg6PDk3Ojg4PD4+QDs9PDs3Ojs8Nzo7OTU4OTg5PTg1Ojg3Ojo6
Nzw9OTg4ODU1OTg3ODc4Nzg4NTU5ODUyNTs4NTs6ODg6OTg7OTg6OjUzMzg3Nzc3ODg4Ozk5Nzk1
NTg6Ojg1NTU1NTc6Ojw1NTU5NDg5Ozs5Nzk1NDo8Ozk5ODc5PEA+Ojc5OT07Ozs7PDg7Ojw+PTo+
Ozg6Oj08Ozo8Oz09Pjw7Oj05PDs4Oz0+PDk6PD4+PDs3Oz06Nzo4Oz08Ozs+PTo9Ozs+Pjs3Oz47
Nzk6Oz0+Pj5APDs6OTw8Ojg+Oz07Ojs+Pj46PDw6Ozg5Nzs8Ojg6ODc1Ojs7NTk4Ozo6OTc5Pj08
Ojs+OD49Pj0+PTw6Ojc3Ojk5Oj4+PDs7PD09PTw+Pj47PT47Ojo3Nzg9Ozs7OTo5PTw9Ozs9PD1A
PDs9OTc8OTw5ODo+Ojk6ODk7PD46PD07PT0+PDg1ODk5OzU4PDs5Ozo7PTo6Pjs8Ozo4Ozo5Ozw4
OTc5ODk6Ozk5Ojg8PTs6Ozg7MTAxMjAxMTI1NDIzMDMyMDIyMzAxNDM0MzMwNTUxMTI0MzQwMTQw
NDI0MzEzMjAwMTU1Mi4uMjMyNTQyMiwuMDUyMjEyMjEyMjEwMDExMTEzMjMxMTM4NTQxMzc1NTMy
MTEzMjI1MzIwMjMzMDM0NTQ1MzExMTM1NDE1NTUxMzUxMzU0MjAwMzE1MzU3NDEyMjEvMDM1MDI1
MzAwMjEvLDIyNDEzMzMwNTM1MjUxNTIyLzA1NDMyNDAzMzMvLjEwMjQzMDM0MjU1NzU1MjI1NDQy
NDAxMjExLzEzMjQxNTU0NTMzMzQyMzMzMzU1NDQvMzgyLDAyMjM1NDIyMzMvMTU1NzMzNTExNDIy
NDIwNTI1MzMyMzIxLzAvLzIzNDI0NDIyLjMzMjE0MTExMTA0MTUzMjEzNDE0NDUzNDExMTMyNDMz
MC4vNDUyMjMyNTQ0MjQ1NC8xMjIyMTI0MzMzMzQ0MjExMTM1MzEyMTM1MjExMzU1MzAvMjI0NDIz
MjQxMjUzNTI1NTM0MzMxMzU1MjU1NDE0NTM1MTc1NzMvNzUzNTMyMTU1NDk1Li4xNDU0NDc1MzEz
NTgzMDAzNDEyMDQ0NTMyNTU0MTU1NDUwMjAyNTMyMTM0MjMyMDAyMjM1NTI0NDIxNTMyNDU1MTM0
Mzk1NDc3MTM1MjM1NDEvMTMzNDMwMTM3NTA1NTU1MzU1NTIxMjI0MTI0MjIzMzI0NTQ1OjcyNDUz
NTc3ODU1MTMxMjExMTEzODQ0NDQ3MTEzMzIzMjQzNDMzMjc3NDExNzIyMzMxMCwsNTUzMzQ1NTIy
MzMyMjAyMzMzNTMyNTUzNzc1ODk1NDM4NTMzNTUzMDM0NDIzNDQzNTM1NDU0MjQ1NTM1NDMxMjI1
Ojc1NDg5Nzc1NDU1MzU1NTMyMjI4NTU0MzMzNTIyNzg1MzA3NzMyNDQzMjU1NDU3MzE0NzU1ODU5
NzQ1NTU1MjE1MTM1MjEuMjUyMjU0NDc1NTg1NDQ1NzI1NTU1NTU3MzU3MzQ1MzU1MzQzNTc1ODM1
NTU1MTE1Nzo1MzM1MjU1NzQ4ODcxNTU1NDMzNTQ0Nzc1NzQ1MjU0MTE1NDU3NTM1NzcyMzIzNTU4
NzcyMzI4NTczNDQ1NTg0OTo1MzQ4NTM1NDQ3MTI1Nzc1MzU3NTQzMzM1NzEyMjU0NDU0NTU0Nzg1
NTU1NDM3NTU4NzU0NzQ1NzUyNzU5NDQ0NTUyMzU7NDU8OTk3NTU0NTU1NTUzODo8NzU1ODU1NDU3
Ojg6OTg4NDc1OTg5Ojo5OTg7NTg6Ozs6PDs9Ojo4OTo3ODc5OTg8Ozs5Ojc4NDg5OTc1ODc7NTU6
OTo7ODk6Ojo4OT05NzU3Ojo1Nzk1NTk8PTs5OTs5OTo8PDw6ODo1Nzs1Ozo5Nzc1NTk3Nzc1NTM4
Nzk5NDU5Nzc3NzU1NTs7OzU3ODg3ODg7ODc5Ojc4OTs6Nzs6ODs5Nzo8Ozk5NTg1NTc6ODU6NzU0
Nzc1Mzg1NTc1NTc3OTc1NDg1NTg3Nzs3NTQ1NTQzNzUyMzczMjQ1MjU1NTU1ODQ3NDU0NTM1NTc0
NTM1OTg5ODc1NTk1NzU0MjU0MjU1NzU0NDc3NDU1NTU1NTc1NDM3Ozk4NTc3NTo6NTQzNTc3NDQ1
NDQ1NTU3ODc4ODc1NTU6Nzg5ODU3NTc1NDU1NTg1NTU1NDEzNDg1MzM3NTU3ODc3Ojg1NTU1NTk8
OTg8NTU5OjU3NTU3NTQzNDQ3NDU5Ozk5ODo1MzI1Nzg0Nzc1NzU3MjAyMjc1NDg6NTg5NzU1NTk1
MzM1NTg3MzQxMDM0NTQ1NTI1NTQ0MTQ1NDMyNDc1Mzc4NzE1MzEyMTEyNTQ1NTQ0NDQxMzU1NDEy
NzM0NTMyMzIwNDM3NTEyMjU1OTc3NTIyMzU4NzU1NTIzODk3ODk4NzI1Nzc1NDM0Nzg1NTo4MzQ7
OTUzMzM5ODU4NTMzNTU3Nzc5OTc1ODo1ODg7PDo1Ojk5ODQ1Nzs3ODc6NTo4NTc6Ozk6ODcxNTg8
Ozc5OTc4NDc6Nzg5ODc6OTU4Ojk5Ozk4ODo9OTo6Ozo6Ozw6OTg1OTk6PTs0Ozo5NTk5NTc8Ozc3
Ozw4NTg5Ojs8OTg8PDw9Pjs8Ojo8Pjs4ODo8Pjg5ODo7PD05Ojs4PTw5Pj04OD49PTo5PD08PT07
Oj09Pjo6Ojk7PDo5PT4+Oj06OTo7Ozk3Pjw5OTg6NTg4OTo8PTk5ODM3ODw6OTw7Ojc1PTs3Nzg1
OTo4OTk1NTU1Oj45ODc5Ozk3Nzc5ODg6Ozk9Ozc8ODs1ODs4OTc7OTg5OTU0NzQ1Nzs3Ojc4NDg4
NTU1ODk7ODs7PDo6Ozo4ODk6Nzo7ODU4OTw6Ojk6Ojo7Ozw8Ozo8PDo9Nzo8OD46PTg7Pj47Ozs9
PTk6OTg4Ojw4OTw7PTk7PDg9Oj0+Ojs5PD08PTs9Ozo7PDs8PDs8Pjo6Pj47Ozo9Pjs7Oj08PD08
Oz5AQEE+Ojo8QD45PDo7Ozo5PD07PT49OkA+Ojs+PTw7PDo4PTs6PTw+OTo8PDw5Ozw9Ozo6Ozo6
ODs9OTk1Ojk7PDk7Oj04OT1BPjs4Pj43PEA9Ozk7Ojs+PDg6ODw7Ojs9Pjk6PDc5ODc7PEA9Ozw9
PDo4PEA+PDw6OTw8Nzo8Pjw5PT4+Ozs4OT47Ojg5Pjs6PEA8Ojo9PDw4Ojw+Ojs7PTw6Oj5BPjw+
Ozo7PTw8Ojs6PkE9OjkxMS8wMC4uKy8zMjIvLDI1MjMwMDI0NTI0MjI0NTMzNDIxMjMzMjEyMDQ1
NTUxLjIyMjUxMTEzNDIvMDIvMjEzLzExMjUxMCwvKzA0MTIxMDExMS4yNDAuMjEuMjIwNTUwNTUz
MTM3MDEyMzA1OjkzMjIxMjIxLjIwMTM0NDAsLzM1NTUyMzM1MzEzNDU0MTAzLzMxNDMyMTQ1MDEy
MjA0NTIwMjI1NDU1NTIxMzExLzAyMi8xMjMxLjEuMDAvMzQ0NTQzNDUzMDEwMC8yMzQ1NS8wLi8z
NDQwLC8yNTQxNDQzMjIyNDAyMzM1NTUxLy8wNTg1NTU1MDM1NTc0MjQ0NDMzMTQvLi8yNDIyNDIy
MzU0NC8vNDMxNTIxMzQxLzIwLzI0MjUzMjExLjIzMjMyMzUzMzU0LjU1NTQ5NzQzMjI0MjU3ODMx
MjUyNDE0NzIxMzI1Mi8xMzI0NTIxNTMxMTQ1NTQzMjU3MzAvMzI0MzQyMjIxNTMyNTU0MzIyMzU1
NDU5NDIyMDE1MzM1MzMzNTU3Mjc1MzQ3NzUyMTU1MzU3NTI1NTU1NTU1NDUyMzMvLDQ1NTc3MjU3
NzU1MzA1NTIzNDU0MzQxNDA1NzU3NzUyMjQ3MzU1NTMzNTUzMzQ1NDU1OTUyNTQxMjMxMzI3NTQ0
NTg0NTAzMjMvMzg0NDU0NDU1MTIzNTI0NTUxMjMzMjQ0Mi8zMzI0MjE0MzE0NDI1NTQ1MzEyMTM0
NDUyNTc1NTQ0NDQ7OTUsMzU1NTU1MzUzNDg3NzQ0NTU0MzMzNTQyMzQzMjIzNDc0NTQwMTMzMjQz
NTM0NDg1OjU0NTo5OTQ3NTg1NTUzNTk4Nzc3NTU1NTc0NDc6PDkzNTU1NTQyNDAvMzQ1NDg4MjM3
NDU4MjIzNTUxNDczNTQxMzU3NDIzMjc0NDM4OTMvMTQxNDQ0NzU0ODMzNTc1MzI0NDczMTM0NDU1
NTM0NDc1MzM0Mzg0NTU1NTg3NDM1MzM3ODQ1NTcxNDUxMzQyNTU1NTozMjQwLzUzNDM0MzkzMzU0
MjIyNTM3NDM1NTMyNTU1NDg3NTQzMzUyMzAyNDU3ODc4NzU1NDQxNTUzMjIzNzU3MzM3NDUyMjI1
MzEyNDc3NTc3NDI1MzQwMTU0MzI1NzQwMTQ3NzQ0NTU0NTU0NTIyMzU1NTI3NDIyNTI1NDExMTQ1
ODU1NTM0NDU1NTU1NTQ1NTUyMzMzNzUzMzU3MzU1OTQzNTU0NTM1NTg4NTo4NTU7NzU1NTQ3OTc5
ODU1Ojk0ODg6NTQ0Nzo3NTs3NzU1ODo3OTk5NDU7PDw5ODo1NTk6Ojg5OTw5NTo5NTc5Ozw1Nzc5
Ozw5PDs3OTg4OTg4NTg7Ojo9Ojk6Ozs5OTk1NDg3NTU4ODg1Ojo7ODk5Nzg4Ozk4NzU3MzU7OTc6
NTc0MjE0Nzg1NTQ4ODM1Ozc7OTQ1NTU3NTU0NzMzMjM3Mjc4Nzk3NTU0NDo6OjU1OTo1NTIxNTc4
NTU1NTU1ODk0NDU3NTQyNDg3NzU4ODU4ODc1Nzc3NzU5Nzc5OTo4Ojk3Nzk3MjI1NTo4NTc5ODc4
NTg3Nzk1NTc3Nzg3MzQ1NTk3NTU0Mjg0NTc3NTU1NTg1NTg3OTs4NTk5ODg7NzU1Nzg7ODo5NzU3
NTk6ODU1NzU5NTU1NzQ6ODc1NTc4NzczNDU1ODU4ODo4ODgzNTU3NTs6OzU3ODU3Nzk1OTk1NTc0
PDU5Ojg4NTc3NTo4ODg7ODU4OTk3OTo6Ojc1ODg1OTk1NTQ0ODc1OTU1MzM3Ojc0MzM0Mzc1NDI1
ODQ8NTM1Ojc1MzQ4NTU1NTU0NTM4ODMzNzQ3NzU1NDU1MzI1NDM0MjU0NTU3NTMzNDs6NTMzNTg1
NTc8ODQ1NzQwMzg4NTQ3NTU1NDU3NzU4NzU0OTU3NTM1NzU1NzU1OjozNTU0ODg5ODU3ODg1NDc5
OjU3Ozs3ODUzNTc1NTc5ODU5OzU3NTk1OjUyNTc1NTk6NTU5Ozo4NTU6OTc7OjU3NTk6PTU0ODg8
ODk3Nzk0ODQ6OTg6Ojg4NTU7Ozg4OTo8ODs6Ozw6Ozs4PD49Oj09OTc4Ojk4ODs7OTg6PDg7ODg9
Pjw5Ozw4Ozs8PTk9Ojw9Ojk6OTs6Ozs4OD09PDk4PT44NTg9Ojg3Nzw9Pj47OTw8Ojo7Pjw6Oz1A
PTk5ODc6PDk4OTg3PTk1OTk3OTw7PDs6Ojw8ODw7Ozo8PDk5OTg6Ozg5Ojw7OjU3Ojw5NTU8OTU7
OTk1OTc6Ozk7Ozc4ODk1NTg5Ojc4NzU3Ojs4ODU3Nzs7NTU4PTo1OTs7Ozw3Nzk4Ojw4OjU6OTo6
Nzg4Ojw9Ozg5ODo5NTw3OTs8PTs+Ojg5NTk8Oj07OTU5OTU5OD5AOzk7OT08Ozo7OTo7PDs8OTc9
PDk9PD49OTo4PT09Ojg1OTo8PD07Oz0+Pjs8QDw9Ozw5PEJAPT4+Pjg4Oj09Oj0+PEA+PUE+Ozo8
PDo6Ojk5Ozw8PD5AQj08OjpAOzo9PTk7PTw+PT4+PDk7PTo7Pj49PD49Ojo7PD43NzpBQDs3Nzs8
PTs1NTU5PTw7ODk3Ojw7OTs8Ojw+PTs6OTw6Ozk5PD08PTw8PT4+PTo6OTc5PDg5Ojo6ODg7Ozo1
ODw6PT49OTk5PDw9Pj1APT07Ojs4Ojo9Ojk7Ozs6Ojw5NTk6PTo6ODU6Ozg7PDk5OTg4PD01NTk8
Ojs+PDk6Ojk5Oy8vMzMyNDE0NTEvMTIxMzAwNDQ1NTQ0MjAxLy8vMjU1MTEzNTIwMjEyMS80MDEx
MzEwNDEwMzIvMTEuKzE1NS8xMDEwMCwwLzIxNDUxMDQzNCwuMzI1MTIxMS8yMTE0Nzk3MjQxMDI1
NTUyMDEyMjU1MzI1MzQ0LzIzMzM1MjE1NzM0NTAvMjA0MTAxMDAwLy8zNDEwMjM1MzIyNTQvMTUy
MzU1NTIzNTU1MDQ4MzMxMzQzMjQzMzQuLjEyMTU0Li8yMjExMC8xMzM0NDExMjAxMjMzMTEuMjMy
MzAyMTMxMDAwMDQ3NTMvNDQzMTAyMy4wMDI0MDI3NTQxNDIvNDA0ODEvMjAuMDE1NTAzMTEwMC8v
MjQ3NTIyMTIzMjIzMjMyMjQ1NTIyNTU0Mi8zMTQ0NTEwNDIzNTUyMjU1MzIyMTExNTUyNzAzNDMv
MTMzMTMyMTE1NDE0NDAvNDMxMTM1NDIyMzU0MjEzLzA1NTIxMzQzMzM1MjEvMjMzMzEzMjMyNTc1
NDQzNDQxMjIyMTUyMTAxMzQyMjMyMTIvMzU0Mjc3NTM4NDM1NTU1NTMyMzUzNTM0MjM3MzIyMjE0
NTUyMjM3NzQ0MzQzNTU0LzU1MTIwMTMyMzUwMTQ1MjQyMzQ0MjI0NTUzMTEzNTc1NTQzMTo5NTM1
NDUxMDU3Mjc0MjEyNTQ3NTIyMTAyMi8vMC81MjQ1MzQ1NTU0NDUyMTAyLzE0MjMzNTQxMjIyLzU1
NzUzMjU1MzIxNTczNTIyMjg4Nzc0Mi81NDQyMTM1NDU3OTUxNDQ0LzAzNDQyMzMyMzEyODg5NTM1
NDM1OjU1Ojc1NzQ6OTg1NTc3NTIzNzg1My41NTU1NDQ0MzcwLzI1NTU3MzAwNTIxNDUyNTM1ODc6
NTQzNTQ3NTg1OTU0NDMwMTQ1ODo3MzIzNTIzMzcyMDEyNDU3OTU0MjExMTQ3MzEzMjI1MzUzLzM6
NDUzMTI1NTM1NDM1NTU0NDQ0MjUzMjQ1NDIxMjU1MzQ1ODU3MzQxNDo3NDc0NDQ0MzI0MzMzNDM1
NTMxNTU0NTMzMzM1NDUzNzAwMjU1NTUxMTMzMTM3NTEvMDMyMjQzNTI0ODU1NTU0NDMxMTg1NTMy
NTQ1NTg3MjQ0NDUzMDM1NTQxNTQ1MjQ0NTU1MzQxMjI0MjQ3NTI1NzczNTgyMjMyNDc3NzU0OTU3
NTQ5NTg1NDU4ODQ0NDg3ODM0NTQ4NDQ0NDg6NTc5Nzc4ODg4Ozc1NTU0NTk1NTU8ODM1NTc5NTQz
Ojk1NTU7Ozk5PDg5NTk9OTc4ODg6OTs9Ozk1Nzk6PDk8Ojw5Ojo8OTtAPDk1OTs8ODc5NzU7OTg5
Nzs7Oj01NTk4NTc3OTc1Ojg4NTQ4NTQ6Ozo5OTg3Ojs1NTg6OzU3OTc1NTc5Nzc4Nzk6NTU6Oj03
OTk5Nzk4NTU1OTo4NTg1Nzk1NTU3NTc3ODU3MzU3NzU5OzU4NzgzNTU0NDU5MjU1NTo3ODk1NDk7
ODc5Nzc5NzU1MzU4OTU3NTc0NTU1NzU1Ozg6Pj01ODk6ODk1ODU4ODU1MzUyMzU0MzU1Ozk1NDQ3
OTU3NTU5NTc3Nzc1OT03NTg4NTc6NTU4NTUzNTo5NzU0NTk4Ojg0NTo3NTU6NTU3OTs7OjU5PTg4
PDo5PDk6OTs3ODo3OTU1ODo3OjU1OTk4NTM3NTU4Ojg4NDk1ODU1NTo1Nzk1MjU1OT4+NTU6Nzc6
ODU3Nzc5Ojk3ODs9OTU1NTc1NTk5NzU3ODM1NTo5NTw6NTc4ODMyOjk1Nzc1Ojk4NDQ0Ny8uNzc0
NTcyMzM1NTo5NDMzMjU4NDQ5NTU6ODU3NTQ1NTU3NzU1NzQ1NTU1OTU1Nzg0MjU1NTc4ODU5Nzg6
ODg1OTo7ODU3Nzc3ODU1NTU4Ozc0NTc4Nzc1NDU3OTgyMjU1NTc3NTc1Nzo3NzEwNzU0NTk3NTg7
ODc1NTc1NTc4NTM4NTU1OTU1NTQ1NTU1NDk4PTs5Ojc4ODU4Ozk4Ojc1NTc1ODo6PDk5Nzk6OTg8
NTU6ODo7PDk9PDk5NTk6NTc6Nzc4ODk8Ojs6Nzg5NzU3PTs1NTc3NTc6ODo8Nzg4NTc5NTk6OTk6
Nzk6Ojo6ODc3PT04OTk6Nzg+Oz04Nzk3ODk7Ojg5ODo9Ojo1OTk5Pj47O0A9Ojo5Oj4+ODs9PTo1
Nzg5PD08PDg5Oj5AOTg3Ojo+QDo7Ojo5ODc6OTo9PDU1Ojs9PDs+Pj08PTg4NTo8ODc+PDk3Nzc8
OTc5ODk4Nzg5OTk4OTg4NTk5Ojg6PTo3Nzo1Nzg5OTc4Ojc5Nzo1ODc1NTk3Ozo4Ozg4NTU4Pjs1
Ojw6OjU1NTc5PD0+Ojs7Oz47Nzg5OTg7Ojs6PDk7PDs5OjU1Ozs7Nzg4OT07PDs5Pjw4OjxAPDc4
PTo7Oj43ODk7Pjw8PT08PTs6OTw5PDw7PDw6OTc5Ozs9PT06Ojw7Ozg6PDo7PTk6Pjo5Oj46OTw+
PDs+Pjk5ODs6Oz47Nzg7PDs+Ozo6Ozw8Pjw+Ozs8Pjs8Ozg6Pjs7Ojw7PTk7PT5APTw7PD06OTw9
Ozw7Ojo8PDs9Pj44ODc3ODk6OD07PTs6Nzc9Pjs6PkE9Pjs1Ojw8PDo6Ozk+PT07OjxAPDo4PTw+
Ozo7Ozk9Ozk9Oz08Pj4+PDc6OD09PTo7Ozw3OkA8ODc6PkA+PDo6OTk7ODs9PTw+PDs8Ozs+Ozs7
Ozo8Oz05MzQ1MjMyMzMzMDAwMC8sMzMzMjU0MTM0MzEwLjEvMC4vLjAyNDE0NDI0MSwwMTMwLDAx
MTQ1MzAwMDAxMC4yNTUxMDE0MzI1MS8sLjQyMzAxNTU0MjQzNTQ0MDAxMzQ0MjEvMy8wMTExMTIz
NDAyMDIzMS8uNTU0MS8zMDEyMDIwLi8xMzM1NzE1MjIxNTIzNTQzNDMzMDIzNTM0My8wMjMzNDQx
NDg1NTU0NTAxMjIvMS8yLjEvLy8wMy8uMDUxMDIxMS8xNDQ4NzMzNDEyNC8xMzMzMi8yMzQ1MzEu
MDMwLi4wLDExMjMxNDQ0MzQ1Mi8wMzIxNDU0MTExMjEyMzEyMDIxMjMwMjAzMy8xMTQ1MzQyMTAz
MTU0MzUwLC4xNDIzNTMwMzI1NTUzMjMzNDMxLy8yMzIwMzUyMDUsMDQyMDAxMDM1MzEyMDIyMjMy
Mzc1NDEwMTA0ODEwMTE1NDM0NTU1MzQ1My8xMzUxMjMyMjU1MTI0MjEvMTUzOTw3MzAyMzIyNzU1
NTU0MzMyMTQzNTQ0NTU0NDI0MjQ3MTIzMjIyNTQyMDEyNDQwMTMzMzU4NTExMjUxNTU1OTUyNTU4
NTI1NS4yNTcyMTAzMjQzMzUwMTAxMzI0NTUzMzc1NTM0NDExMTM1MDI4MzIzMzUzMzM1MzE1ODcx
MjQ0NTQxNDMzMjUzMDQ0NTU1OTgxMzQ1NzUxNTIwMjEzMTAyNDc1NDU1NTMyMzU1NDQ5NTIwNDUy
MDM1NTEzMzU0MTc0NDQxNTU1NzUzNTAzNTU1MzU1ODMvNTIzNDAyMzQvLjE0MjQyMzAwMTI0NTU1
NTE1ODc3NTU3NTc1NDM1NTM0ODQxMjU1NDM3NDU0NTU0NTcxMjM4NDE0MzU0NDM0NDM0Mzc1MjU1
NTU1NDUzNTQ1MjU1NTQ1MjI4NzU1MzU4Mzc4NTEyMDM1NTg3NDI3Ny4xNDQyMjQzNDU0MzIyNTQy
MjE0NTIxMjM1NDExNTU0MzQ1MzQyMjEyMjI0NTIxNDQzNDMzMzUzNTk4MzEzNTMzNDMxNTM1MzUz
MTEzNTU1NTA4NTUzNTU1NzIyNTc0NDUzMzQ0NTU3NDQzNDQ1NDU1MjQ1MTQ1NTUyODgzNTU5Ozg1
MzQyNDUwMTU1MTU4NTUyNTU1ODM1NTUzNTc3ODU1NDU5NTQ3NTMzNDg0NTU3NTU1NTI3NzMzNDU1
NDU0NTU1LzA1Nzc0NTE1MzAzNzUxNDU0NTc5OTU0NTc5Ozc4Nzg5Nzc1NzM5NTU5ODI1NTg1Nzg3
Ozs1NTc3NTU7Ojk3NTo3Ojw9ODw3Nzc4NTc3ODo6OTs8Ojc7Pjs4OTo7Nzc6PTk6Ojc7PDg+Ozw8
PTs7PTw4ODU7OTg8OzU1ODk1OTo7Nzg6ODk1NTU5OjU0OTg1NTc0NTU1NDU1ODo6NTU1Nzc1OTg1
NDc1ODg4OzU1ODc3NTk4OTo5NzU0MzU3NTU4OjU1NTM1OTc1MzU4NTg1NTc4ODc4NTU0NDc3ODc6
MzI1NTU4ODUzMjU1ODo4NTU1NzU1NDQ3NzI0NDg1NTU0NTU1NzU1OTkzNTQ1NTc4NzU3ODU3ODk8
ODU5ODc4NzQ1NTQ4NTU6ODk1OjU4ODw1NTk3NzU3Ojo3NTU3Nzc1NTQ1OTw7Ozo4OTk4Ozk3ODo4
PDg3OTk5Nzo1NDU3OTc5Ojo4Ozk6ODk4OjU1Nzs4Ojo3Mjg3Nzc1NTk3MzU1NTU3NzU1OTk6ODU3
OTU4ODg7ODU1NzU5ODc7OzczODg1Ozo4NzU6PDs4NTo3NzU5ODU1Mjc3NTI0NTU4Ojk3MzQ0NDQ3
OTk1NDEyMzM4NTg0MzI1MzUzNTUzNDUwMzQ0NDI3NTc0NDU1NTU1NDQzNDU1NTc1NTU5NTU3NzQ1
NzU1NzU1NTU0Mzg1MzA0NDc4Nzg6NTU1ODg3OTg1Nzg1NTU1NTQ3Ojg0NTc5ODM0Nzg4Ojc3NTk5
Nzc1NzU1ODc0NDc1NDg5NTk3Ojg7PDk3NTk5Ozs6NTQ3OTs4ODc6PDw4Nzk5Ojc3Ozg5PDU5ODU4
OTk7Nzo8Ozk3NTc6Ojg7Ozs9PTw5ODU3NTU1ODg4NTo9Ozo3Oj48PDw8PTc1NTc+PTw8Pjo5PDtA
Pjs6Nz0+Ozk8Ojk7OTo7Pj46Ozw4OTxAPjs9Ozk5PUI+PDw4Ozw9Ozw5PDk5Nzs5NTg6Ojs8PTk7
PTo9PTs4Nzc6Ojg4PT0+OTo3ODg1ODg4NTk1ODU0ODk7PDo1NTc3ODU4Nzc3NzU1NTg4NTU6OTg4
PDg4Ojg4OTU5OzQ1OTw3NTk5Ojg6NzU6OTo8Ojw5Nzk8Ozk1ODo4ODg6ODc1OTg6PTg3OTs8Ozg6
Ozo6Ojw6PDo6Pj01Ojo6ODg5PDs6OTg6ODg8ODo6Ozk6Nzk6PT09Oz03NTs7Ojo7PT0+PT48Nzo+
PDo6PTs6Ozw6PDg6Ojk6Nzo7Ojg6PDk5Nz06PT49PT04Nz07Pj45OTU6Pjs6Ojs6Ojw9PDk5Ojo5
OT4+OTo9Ozs5Ozk6PD06PDs5ODk9PTw5Nzw+Nzo5O0BBOjs7Ozo7PDw+Ojc0OTo8Pjg7PTs+PT05
Nzw+Pjk5PD47Nzs+PTU5PD08OTk1Oj49PTk5Ozk7PDo7Pj47Ojs5Ozk+ODlAPj48PT49PT5AOzg1
Ozk8Ozs+PDc8PDo5OTo5OTs+Pjw9Ozs6OTk6Ojg9Ojs8PT47Ozg5PTk5PDc7NzU6ODg7Oj48OTc7
OTowMTExMzU1MTI3My8vMTM0NDIyNDMzNDAyNTIsLjI0MzEyMjMxMTIxLjEzMTEvMjQyNDIyLzU1
NDMzMDExMjEyMzI0NzMzMDQyNDE1NTUwMTIzNDQwMDEwMTMzMjMxMTM0NDUzMS8yMTIwMjQ1MzIz
MTQ1MzE0NTMzMjIvNDIwLzUyMjMvMDAzMS8vMC8wMzMwMi4yMjAxNTAwMzMzMjIyMzU0MTM1MzEx
My4wMDEyNTQzMzIyMTIzMzU3MS8xLzQzMjEzNTUyMTM0MzIyMzMwMTQxMzQ0NTIvLi80NTIyNTQ1
MzEzNDIyMTIxMDQ1MzEyNTQzMzQxMDAyMzQ1NTA0NTEvMDIzMDIyNTQxMjAvLzI1NTMxNTQzMDEx
NDUzNDU1MzEzMTM0NTIzNTM1MzE0NC8xMjQ0MzMzNTUzMzUxNTc0NTUvMjE1MzQxMzM0NTUzNTQz
NTUzMTUzMjU4MzU1NDIzNTMxNDQ0NTI4NTMzMjIyNDg1NTIvMDMzMjU1MjQzMzAxNDU4NDUxNDUx
MTAzNDU3NTM1NDMzNDU3ODczMzMyLzIzMTMzNTUyNTQzNDU1NTM1OTQ3NTQ1NTU1Mzc0MjUyMDEz
NTg4NTMzMjMzNTEzNDQ0ODU3ODMzNzU1NTU1NTQ1MTM1MzM1NTc3NTU3NzQ1NDI1NTU0NDM1MzMx
NDUzNzU4NTMzNTU3NTQyNDc0MjM0NTM1NTQ3ODg3NTEyMjExNzU0MjU3MzQ0NTUxMjMyMTM0MjIy
NDQ1NTIyMzg1NTUzMjMyMzEvMTc4MjU5NTE0NTQ0NTQyMzIzMzIvNDU1NDI0Nzg3ODU3MzU3OjU1
NTc3NTQyNTczMzM1NTUxMS4zNTQ1OTc1NTUyNTU1ODUzNTM1NDUzMzQyMDAyNTQ0NTQ4NTUxMTM1
NDMzMzM1MTM1MzIzNDQ1MzI1NTMvMzIzNDU1NDc0NzUyLzE0MzQ1NTUxMTM1NDU1NDU1NDQ3NTE3
NTQzMzEyMjI1NTM3ODg0LzAyNTQwMjUyMjUzMzMwMzAyNDU1MjIzNDQ0NDQ0NTQ0MjU3MTIzOTUz
MzQ1NTQyMTEzNTU3NTU3NTUxNDQyNTc4NzU3NTM1MzU1MjEwMDU1ODU3NTU0NTQ1NDIyMTQ1Mzk1
NTQzNDU1NDI0NTcyMjAzNzU3MzUyNDU1NDQ0MzU3NzQ0NTUyMTUzNTk3Nzs1NTEyNTQ0NDQ1NDU1
NTU1NzUyNzQ1Nzc1NTc1NDE1Nzc5OjU1NTo4Nzg5NzU3NTU3OTo0OT05NTU6OTQ1NTc6PDc4OTU5
OzU1NTc6Ojs6OTg5Oj47ODU1ODg1Ojo3Ojk4Oj05ODc5Oz08OjU4Ojc3NTU5OjU1OTg4NTU1Nzo9
Ojk5OTk4OTs5Ozo5ODk4Nzk5Nzc4OTU3NTc3PDc4OTk5NTU4NzQ4OTU1ODc5ODgzNTMzNTQ1NzQ1
NDc4ODc3NTc4ODo3Nzg1Nzk1NTo5NTU5NzcyNDU1NTg1NTM1OjU4NzMzNDc0NTc3MjU3NDU1NTg4
NTQ5NzU1Ojo5NzQ0Mjg0Nzo1NzQ1ODo8NTc4NTQ3OTs5NTU1ODg4Ojk1Nzs5NDQ4NTo4ODUzMzM1
NDQ1ODs5OTg0OTc1NTU6NTQyMTg4NzU3NTg5OTU5OTc3MjU1ODg3NTg3NTo4Nzg5OTU4Nzc3NTc6
NTM4OTQ1NzU1MjU3ODU0NTk6ODM1Ojs1NTo6NTM1NTk3Ojc1ODo3NzU3ODo4NTQ3NTU1NTg1NzM1
NTU1Nzw4Nzk1NTQ1OTQ1NDQ1ODUzNzc0MjM1NTQ4ODU1NzQ1MjU5OTo0MzU5NTU3NTM0NzMyNTIz
OT01MTU4NTczNTc0MjU3NTU6ODA0ODQyNTUxNTk1NTU4OTU0OTc1NDU1Nzc3NTExNTQ4OTg3NTg4
NDc4NTQzMjc5NTU1NTQ4NzU3NTg4NzU3Mzc4ODU0NTU4NzU3ODU3Ozk3Nzw4NDE3ODg4NDU1NDg3
NDk6OTU3ODc3MjU9NzM0NTc5PDg3OTg3ODg6Nzg5OTc4Nzg3OTc6OTQ4NzU5Nzc4Nzc1OTc9Ozo4
Ojk5Ozk1Ojo3OTg1NTU6OTU3OTg8OTU1NTU1Ojo9OjU1MzU4ODc4ODs7ODc7OTk3ODk7Ojg7Pj08
Ojo7Nzk6Ojo4ODg5Nzc0Ozg6PDs7OTk8PTo9Ozw7Oz03Nzo4Oj07Oj09ODk7OT04Nz48OTg3Ozo5
Ojg5ODU1OTk6PT04NTo5Oj06Ojk1Mzk5OTg4PDo6OTo4Ojk4PDw5Nzk6PTs3Ozo4PDk3Nzk5Nzs6
ODg4NTg8ODk7OTs4Ojw6ODc4Ozo7Ojg5ODo4ODk4NTQ4Ojo6ODU6Ojk5Ojc6OjU4NTo7Oz05Ozs6
PDo8OTg4Ojk5OTo5OTs8Ojo7ODU4Ojk1NTU5Ojg4OTk8Ozk3Nzs9Oz07Pj09PDo5Nzk7OTc5Ozw4
ODw8Ojw3ODw1ODg8Pjw9PDk7Ojc8PT07Ozg7PEA8Pjw6Ojw5Nzo5Nzs6ODc3PUE+OTU5Nzo+PDk5
PTg3OTs6OzlAPjo6OT03OTk7PT08Ojo9PDw6Oj05Oj0+PDo7Ozo3Oz46OTs+OTo+PDo+OjU5Nzc8
ODo9PDo6Oz5BOzo8PDw9Nzw5NTk5OT09OTs4Ozo+Ojs4NTo5ODs8Ozo5Ojo5Ojc8OjU4PD4+ODo5
OTw1NTs9Pj4+PT07Ozs7ODk3Nzs6Ojw6ODw6PEE7PD4+OTc8PD48PTw6NzpAPD09PTw9Ozs4OTIz
MTAwMzU1MzQzNDAyMjQzMzEwMDMxNDMxLDE0NTM0MjA0MzEyLy8sMDAxMTMxMTEvMDQzMC4xMDEz
MzQxMTEwNzUxNDQyNDIwLzEzMDAwLi8vNTUyMTAzNDIyMTExMjQ1MDE0MzAyNDMwMi8xNDIzMDQz
NDIyNDQ1NTU1NDUyMDQ5NDIwMy8wMTE0NDMyMTM0MDU1NTIwMTQ0NDM0MjMyMzQxMTMvMDM0Mi8x
LzIwNC8zMTIvLzEsLzMxMTIzODcxMjUzNTQxMDMxMTQzLy8yNzUzMjAxMzM0NDMzNTU1MzQzNDAx
MjQyMzU4MjIxNTU0MS8wMjMzMjUyMjIwMjAyNDQzNDMzMC4wMzM0NTUzNTMvMDMyMTE1NzIuMC8y
My81NDUzLzQ1NC8zMzMyLjIzNTQ0MSw0NDAzMTAwMzIyLy8yMjIxNTM0LjIzMzEwMDA1NzQ0MzQy
MTMyMjEwMzMyMTM0MjEyMy8wMzQ5NTEyMDIyNTE1MjIyMzQwNDQzODgzMzUwMDE0NTU1NTU0Mzc1
NTI3MjQzMzQ1MzQzNDU0NDU1NDIyNDM0NDU0NTg1NDEyMjU4NTU1MzM1MjEzNDIyMjExMTQ0MTMz
NDc0NTUzMjU0MjAwMzQ0MC8xNTM0NTQyMDE0NTUyMzEvNDU1NzAxNTMzNDQ0MjAxMzU1Mzc4NDMx
MzU1MzM1MDExMjIzNTc3NTI0MjMzODgzNDUzNDU1MjA0NDU3NTU0MjQ1NTM1MzUzMjUzNTU1NDM1
NDEzMzUyMzQ1MzU1NDQ1NzQ1NTAzMjU0NTQ1MzM0NDUzMjQ0NzU1NDQwLzU1NTU3MzM1NTMxMjU1
NTM1NTU3ODQ0MjIzMTU1Nzk3NTU0NTE0MzU1MzM0NTUyNTc1MjQ1NTMzMjMzMzUzNTI1NTU4NTIz
NTIyNTIvMjI0MzU3Nzc5NzcyNDU1NDA1MzI3NzMyMTU3NTU1MjMyNDQyMjI1NTU1ODU0NDEyMS8x
NDQ1Nzc5NDQzNDIyNzU3NTM1NTU0NDQ0MzU1MzE1Nzk0NDMyNDEvNTk0NDMzMjU3NDUyNDc0NDIx
MTQ0NTc1ODg4NTQ1MTIyNDQzMjU0MzM0MzM3NTQ3NTMvMjQ1NTg1NTQ0NTg1OTU4OTU1NDU4NzQz
NTcwMzU1NTExNDQ0MTEzNTMzNTQ0ODoyMjUxNTMyMjEyMzI0NTU1NDM1NTU0MzU3NDQ0MzU4NzU0
NDU1Nzg0MTUwMjc1ODc4OjU1NTc1Mzc1NDk5ODg4NTU7OTU1ODUzNzg3NTk4PDk1NTo8NTU3NTg7
OTk8Ozc6OTo7Ojo6ODo8PTw4NTk4Nzc4PDg9Ozo4Ozo1NTg3OTs5Ojs7Ojc6NzU4OTk5PTg5OTg4
NDI1NzU3ODg5Nzw1ODg3PDk7Ozw9ODU1OTo5NTU5Ojg5NTc3NTg5NTU4Ojg3NTg5ODk1NTg1NTU1
Nzo7NTQ0OTk7OTs4OjQyODk3ODk3NzQ1ODU0NTk5MzU3OTo4ODs1NTg1NTU1NTc6NzQ0NzU3NzU3
NzU3NDg4ODU1NTc5NTU1Mjc1NDU4Ojk1Nzc5OTUzODUzODg1NTU3Nzg3ODU6ODc6ODg7OTw5Nzc0
ODU0NTU3NTU5NTU1ODc5Ojc1OjU1NTc3ODk5ODU4Nzw6Ojg3Nzc5Nzg1Ojg4NTU1NTo6Nzk3NzU3
NTk4NTU3NTg3ODM0NTg1NDU4NzM1ODc1Nzc+Pjg1NTM3Nzc3PTo6NzU1NTc4ODg1NzU1MzU3NTU1
NTg3Nzc4ODc4OTg5ODU5NTU4NTU1NTo1ODc0NTg7Ojc1MjI1ODk5NDM1NTU0ODU5NTU5MzQ1NzQz
MjE0ODk1ODcxMzUzMzQ1NTU1NTU0MTI1NTc1NDQ1NTU1NDU1NTU4OjU0Ojc0MzU1OTg3NTQyMTEw
NTk3MzUzNTw1ODUyMTU0NDU1MjUzMTU7NTU0NTI0NTU3NzU6Ojc1NzU1NDM1ODc0NTU3Nzc1Ojk6
ODg4ODs5Ozg4ODU4NTk3ODs6NzMyNzo4OTc5Oj45NTw6ODk4NzAzOTg4Nzc6PDU5ODkzNTU4PDo5
NTU4Ozs9Ojc6Nzc3NTc1Ozw9PT09NzU0NT45ODk1ODw5Ojk4NTs5ODw6ODk6OTk5Ozo4NzU3Oj46
ODc4ODs6Ojs8Ojg3Ozs6PDs8OTs+Ojg4OTU5Pjk7OTs8Ojo1ODk4ODo1Ozw7Ozk0NDs6Ojc6OTo7
OTo5OTU3Oz48ODo6OTs4NDc5OTo7OTk3ODg6OjU4ODg3OjU3ODc1ODk5Nzc4Ojo6OjU1NTU5OzU1
Nzo7Nzk6ODg1NTc1Nzg6PDg1ODk7Ozg4OTgzNTg1ODc0NTg6NTk6Ozs6OTc7OTg7Ozc5PDg7Ozg5
OTo3Nzc8OTk6Ojk6PDs+OjU6ODU6Oj41ODs8PTs4ODU6PTw6OTk6PDo7OzU3OT46ODU4Pjs1ODs6
Ojo8OT0+Ojk8OTw9Ojo9Pjg7Pjw4PTtAPT05ODw5ODk9Ojo7OTo+Pj0+Pjk3ODk7ODk5Ozs9OTs9
ODw8OTo1OTo6Ojs7Pj07OTc5QDw3Ozs5Ojo6OTo4NTs5PDw5PDo4Ojw7OTU6PDg9PD48OD0+Ozk+
PDs4OTs6NzU7PDs6OTo7Nzk9PDs6OTc7Ojc3Nz1APDw6PD09ODU7Oj49PDs+Pj48PT44PD49PD05
ODo9Ozw7Oz4+Pjw9PTs+QDw9Ojs5PTw6PTo5Pj07Ojo5Pj06OTw7Pj48ODw7Pjw6Pjs7MzA0MzQz
NDUzMzEzMzAwMDAzMzIxMDIyNDE0NzEyMzEyMjEzODUyMjI3NDAyMTAwMTMzMjEyMzE0MjMwMi8x
LzEyNTU1MDE3NDEvMDQwLDMxMDEvMzU0MzM3MS8uMTEzMjI0NTEvMTM1MjQwNTQzMjEzMDAzMDE1
ODQ1MS4vLy8yNTEwNDMxNTUxNDEzMDQ0MzMuMDQ0MzI0MS4xMy80MzMwMDUwLjEyMC4uNDIwMjEx
MjMyMi4wMjUxNDU0NTk1MzQ1NzQzLzQ1NTU1NDQxMjIvMDI0NS81NTQyMzIzMjMxNzUyNDQwMTIy
NDExMjUyNDUzMTQwMS8xMDE1NDIxMDAxMjUyMi8yNTM1MzE0NzU1ODU1MzAxNDI0MzI0NDU1NTU5
NTAxNDU4MjQ1NTM1NTMzMTUzNDEvMzMvMzU0MjMxNTczNDEvLzI1MjMzMS8xMjMsLjAyMTI0MDIy
NTM0MTE0NTQyMzM4NTMyMTIyMzEyNTE0MjAxMzUzLzE0NTQ0NTU1NDEzNzUuMDQ0MjMyMjM3NTM1
NzU1MDQ0Mjg4MjU1NDUyMDU1NzQ0MzMxMDAzNDU1NDIyMzExNDU0Nzg1NzEyMTEyMy8xNDQ1NTc1
MjU0MjQxMzMzNTQ1NTU3OjU1NDEyNzU1NzU1NTMzNDM1NTM1NDU0NDUwMDM1NDM1MzU1MTM1Mzc1
NzU1NTU1MzQyMzM3NDI0Nzg0NTQxMTAxNTQyNDEyNTU0NDEyMzUxMzI1ODUxMzQ1MzIzMjE0NTU1
ODQ1ODc3MDI5NDEyMzQ0MjAzMTIyMzExNDQyNTIyMDMvMzUyMjIwMDM1NzQ1NzQ1NzQ1NTU4NTIy
NDc0MzQyNTIyNDk1ODU0NTM1NDMxMzQ1NTU0MzU0NzQ1Ozc4NzU5MTA4ODQzNTU1MzQ3NDQ1NTU3
MzAyMzM1NDU0My8zNTQwMTc1MzUzMTUyNzM1MjI1NDMwNTU1NDAyMzU0MjA0NTQwMzQzNDQyMTEy
NTUyNTU4ODU3NDM0NS8wNDIxNTMvMTMxNTg1NTM0NDE1MzczNDQwNTU5NDEzNDQ1MzQ0MzQ1Mzg3
NTc1NDI1OTU1NTU3NTQyNTEwMzI1ODU3NDI0NTUzNDUzMjc1Nzg1MzU4NDU1MTU1MS4zNTMzNTM1
MzAyNDU5NTU1NTU3NTc3NzU1NTM4NzU1ODU1NTU0Nzc3NTkyNTk4NTQ1NDQzNTM1ODk4ODk3NDU3
Nzc0NTg1NDg1NTU4NTg1NTU0NTU1NTg1Nzc3Ozk1NTQ3NDs5Nzs6NDU3Ojo7OTk6ODo8Pjg4NTk7
Ozs3Nzk6Ozk6Oj07PTs4OTs4Ojo3NzU1NTw7Ojc3ODU7OTw5Ojo5OTk5OTs7PDg8Ojs4NTU4Nzc4
OzU1NTQ5NDU5OTc3ODU5OTg1ODs4NTg7OTg4ODQ3OzQ4OjU1NTk6OTU1NTo1Nzk3Nzg3OTg1Nzg1
MzQ1NTU1NTc4Nzc1NTk6NzgzNTc4OTc4Nzg7NDU5ODU1NTI1OTU1NTs1NTk4Nzg3Nzc1NTU3NTU1
MzQ1NTU4ODU5NTU6ODc1Nzg4ODQ1ODczNTg3NTg1NTU1NzU1NzU5MjQ4MzU0NTg7OTU4Ozc1MzA1
OTo3Ozg3Nzc1OTU1Ozw5NzU3OTc4OzU0MjQ7NTUxNTg4NzM0NDc5OTU1Ojg0NDQ4Ojg7NTU5Nzk3
ODk1ODc1Ozk7OjQ1ODU4Nzo5ODU1Nzg4OTo4NTU1NTU3ODU4OTc3OTc1NTQzODg0NDU1OTc0Mjg3
NTQzNTM3Nzc3ODU3MzQ1Nzg4ODMzNDU1NTc3ODs5Ojc1ODg1ODgyNTU5NzQ4PDk3NTU3NzU3ODU3
NTQ5NTQ3Nzk0ODI3NzQ3NzM1NzU0NTM1NTo4OjU5OTk4ODU3NTQ1NTQyNDU1NDU3NTc5NzU1NDU1
MTI1OTU1OTQ0Nzc3NTU1Mjc4NTc4ODQyNDU4Nzg3NTU3Nzg4ODU1OTg1MzI1ODc7ODU1Nzk4OTc1
OTU1Ojg6OTk1NDQ4OTU1Nzc4ODg8Ojg1OjU1Nzg6PTo5Nzs7OjU3OTo7OzU3OTo5ODo3NTg4ODk5
Ojo3NzQ1NTk5OTg6Ojg7Ozg6ODg6OTk5OTo8Oj48OTs7OTs6Ojg6NTk7Pj04ODc4Oz01ODo5Oj05
PTs1OTw+PDw6Ojs8Ozk5OT08Ozo6ODk8PDw5OTo7OUBAPDs9PDg5OTk6Ozc1NTs6Ozg1ODk5PD04
NTg5Nzk6Ojw6ODo8Ozo3Oz49NTk6Ozs3ODs8OTU1ODs5NTk7ODk6NTo4NTk1OTw5Nzc3NTc4Ozc1
Ozg5Ozg7OTk5ODg1NTU4Ojo5ODw5Nzk5OTs7NTo4Ozs5NzU1NTU1NDo3NDc1PDk7OjQ4QDw5OTs4
Nzs7Ojw9Nzk5OTk4ODU4ODg1NTo7PD08PDs+Pj49PkA+Ojs3Nzg8Ojk7OT07PDo7Oz06Ozw7Oz09
Ozg6Ojs7Ozo9Ozk8Oz0+PDg7OT4+Oz4+PDw9Ozw8Ojw8Ozo7OkE9Pjs6Oj07Ozs7Ozo7Ozk7PkE9
PDo7Oj48PT48PDw6OTo8Oz4+Ozk6Oj44Ozs3ODU4ODg0NTk1Ozk+PDw5Ozs9Pjk7OTc7PDs7Ozk8
OTw9Ojk9Ojs8PDs8Ozo8Pjk3PDs4OTg4PT09Ojo+PUA4ODc3PTw9PEA8PEA9PDw4OTs6PDk3Ozw7
OTs6PD4+OTk8Pjs7PT07Ozs8Ozk6Oj46Ojo6Oj08Ozw7PD0+Pj05OTg+Pj05OzwxMDAyMDA0MC8y
LywxNzQxNDExMjUzMDAxMDEzMjIvMDAyNDUwMjMvMTAwMTEvLjEyLy8wMjI1NC4yMC41NTI1NDMx
MjIyMS8xNDUxLjEzMjMzNTU1NDQ1NzAyNDMwMTQyNzU0NTQ1MDUzNDEyLzI1Mi4vLDEzNTM0NTAv
MzAyLzIvMDA4NDAzNTU0MjUzNTU0MDEyMDQvMDEvMzU1NCwwMDMyLi41My81NTAxNDM1MjMzMDE0
LDEzLzMyMjMyNDEyMzIyMDE1Mi80MzMzMzQ0NDcyMTM0NTQyMi8wMS8xMzE0MzQzNTU0NTIwMTQ1
MzI0MTI0NDEyMzI1MzU1MDAzMjQzNTQ0MTIzMzIxNDExMDMvMTUwMDEwNDIxMjAyMjM1NDI0MzIw
Mi8xMjQ0MzE1NTMyMzM1NDU1MTIyMTU1MDMwMDQzNDU0MjI0MDIyMjAvMzEsMDMwMTIzMzU1MjEz
NDc1NzM0MzMxNTc1NTAzNTc1NDI1NTU0MjA1NTMxMTMxNTQzNDEzMzQ1NTU1NTU1NTE1NTU1MzIz
NDI0MzM0MTI1NzU1NTQ0MzExNTM1NzcxMzU1MzQ0MzI0MTM7NTMyMDAyMS8zNDU0MzU3NTAxMTEy
NTU1MjIxMzQ3ODc1NTI0NTUyMzQ0MjU0MjUyMjU0MzQwMDI1NTQ0MzQ0NTIyODIzMzg1NDU3NzU1
Nzg5NDUyNTQxMDQ1NTUvMDU1NTQ3NzU1NDk1MjQ4NTU3NDI1MzUzNTg3NTI1MzEzNTMyNDMyMzAy
MzQ3NTIwNTU1NTc1NDUyNDg4MzI1MzU0NTQ3OTc3NDI1NTIxNTU1NTc1NTQyNTQ5Ojg1NTQyMzMu
MzM1NTQ3NTU0MjI1ODM1NzU1NTo4ODo3NTc3MiwxMDMwMzM0MzIyNTIyNTU3MzI3NTEyMDEvMTg1
MzM1NTU0MzA1NTM1NTQ1Mzg1MzU1NDM1MTI0MjM1NTUyMTIvNDQ0MjA0Mzc0MzIwLi40NTQzNDU3
OjQ0NTU0MjU3NTMzNTc1NTc4NzgzNDg3ODg1Nzg1NDI0NDQ1MzUzMzU1MjU1NDM0NTM0NDU1NTUz
NTM1MzU0LzE1MzMzNDM1ODMzNzc4NDg4NTQ1NDQ1NDMzMjAyMDU1NTQzNzg1NDE1NTk1NDUzNDc0
NTU0MDU4NzQ0NTU5ODIxNTUyNTUvMzU0MjUyMDU1NTEzNDI1NTUxMjM3NTUyNDM0NTQ1NzQ1NTU1
NzU1NDQxNTUzNTI0NTU4NTc3NzU5Ojc1NDc8ODg1Nzk6OTg1MjQ5OjU4OTk1NTk1Nzk5NTU6Ozs5
NTQ3NTc1Nzc1Nzk1OTo6OTo3ODg3Nzo4NTg5Ojk6Ojk5ODg5ODg4ODc1NTU6OjU5NTU5NTg9Pj05
ODU1Nzg5NTQ3Ojw4ODk7OjQ0Nzk3NTg8PTg4NTc1NTc3NTU4NTU1MzU1OTg3NTc7OTc0NDU4NTU3
NTU1Nzo5Ojc3Nzk5NzQyOjk1NTg6ODk1ODU1Nzg1NTg3MzI5ODU3Nzs7NzU3NTQ1OzU3NTc1Ojc3
ODg7Ojk3NzU1NTI3NTUzMjc1NC8wMTo7NzU4NzQ4NTg7OTU4Nzc3Nzk1ODk5OTw7NTU5OTg6ODk4
Nzs8ODQ7ODU7PDc1NTc1NTU1ODo6NzU7Ozg+Ozk6NTQ3Ojk7Ojg1NzU1NzU3OTk4NzU6NTU1NTQ4
Ojk3Ojc0ODk5NTg4NTI1NTU5NzU4NTU8NDM3NzU3Ojk1NTU1OTU4OTc3ODk3NTU4NTU4NzQ5NTQ0
MjU1NTQzNzc1NTg5NDI3NTU3ODk4NTQzOTg1NTI1ODUyMzQ0NTQyMjQ3NTM3Nzc1NTMzNTc3NTU1
NTUyNTczMzc3NTQ1NTU0NTIxMzc6NTQ1NTU1NDg5ODc1ODg0NzUzMzU1MjQyNTUyMjQ6NTI1NTU1
NzU1ODc1NTg1Mjc1NDI0ODUyOTk4NTU0ODg3ODo1PDo4Ozo3ODk1NTo4NDM3NzQ1Nzs4Nzc4NDU4
OTc6NDU1OTg4ODg3ODo4OzU1ODg4Ozc3NTg7Ojk6ODk4Ojg3NzU6NTU6OTw4Nzg6Ojo4ODg6Ozg5
Nzo7Ojk4ODo5Nzg5OTg3ODU3OTQ6Ozo8OzU0Ojw7ODU5Ozs4OTo5Nzc5Nzk1NTU6PDs7Ozk5OzU6
NTs6OTg5OTc5OTg1Nzg1PD47NTU6PUA7OTs8Ozc1OTk+PkA8Ozo5NUA7OTk5Ojw8Ojo+PTg3Ojk7
OTc5NTU3OTs4ODs8ODc5OTo6Ozo7Ojc3Ozw7OzU1NzU1ODs4OTU6ODo3NTU4Ojo4ODo5OTs1NTw4
OTo5NzUyOD08OTU1ODc1ODk9PDc1Nzg5PDo4OjU6Oz45NTU3Ojc3Nzo5OTo7ODs6OTs5ODU3PDw1
Nzk5ODk5OTs5Nzg1OT4+PTo5ODs9Ozg8Ojs7NTk5Ojg3Ojw6OTw9PDs7PD4+Ozw6Ozw6PD07ODw5
PD05OTo+Pj05Pjg4Ozo4OD0+PT04NTc6Ojk8OTk5Ozw5Ozw5Pj0+Ozw7PT06Pj4+QD49Ojo9Ojw7
Nzc5Ozo9PT4+Oz4+PDk6Pj4+Pjs8PUA8PD47OTs8PDo3Ozw8PDg5Pj04NTs9Ojk+Pj05OTo5OTk7
PDw4Oz45OTw5Oj09PD4+PDo+PTk4Ozs5ODo9QTs8QD5APjw8O0A8ODs9ODo7Ozk7OTw9Pj45Ozs9
PkFAPTs8Pj4+Nzk5OTs6PDo8PTtAOjw6Ojk8PTU6Oz07Ojw7OTs5Ozw6Oi8vMzUyMDMyNDQ1MTIx
NTU1Mi8xMi81Mi4xNDAvMDMwMjM0MzQzNTc1NDMzMC80MTUyNDIuMjMyMTMzMjAzMTU0MTA1MjAz
NTUyLzAyNDE1My8wMjIxMjI0MS8yLy4xMjc1MDMwMjIxMi8wMTA0MjM1NDUxMjIyMzMzMzAwMzM4
NTMyMC81NDI3MzE1MzUwMDIwMDQxMTM1NTIyMjU1My8vMiwuMzEvMi8vMzMwLy4yMjMzMjMvMS8z
NTUyMDUyMTMwLDAyNDQzMTQ0MjEzMzQ1ODUwMTAwLjI0NTUsMDAyMzI3NzEwMzM0NTgxMjQyNTMv
MTI0NzEyNTQ3NTM1MjUzMDIwMzQ3NC8xMzc3MzIzNDMwMTQxMzMvMDMyMTQ1NDU1NDA1NzIxMTMz
NTMuMDMxMzUzLy4sLzU0Ly4wMjQzMjU1MzMwMjU1MDMyMTIyNTMyMjQyNDUyMzUxMDEzLzE0MzUx
MTk1MTU1MTAzNDU1MzA0MzQyNTQwMDEwLzIxMzU0NTU0MzQwMzQ3NTE1NTMzNTU1MjQ1NzQzMjQy
MzMwMTM1NDU0NTUzLzE1NC8xNDIxNTc3Nzc0MzAxMjI0NDQyLzE1NDUzMjE0MjQxMjE0NDU1Mzg4
NDUzNDUzMzc3NTc1NTU7ODg1NTI0MjI0NzMzMTIzNDU1ODQ0NDQ1MjE1Nzc1NTgyMjQ1NTI1NzIy
MTE0NzU1MjQ1NTM1MzEzNDI0ODQzODUzMjMxNTg0NTU1MTI0MjM1NTEzNTc1NDExMzIzNTQ0NTQz
MzQyNzU1MTczNDI1MzM1NTUzNTMzNTUyMDM1NTU1NTU1NTU1ODczNDU3Nzo3NTQzNTU0NTU1MjI1
MDQ4NTQ4Mzg4NzQ0My8zNDM1NTIxNTM0NTU0MTQ4NTU1MS8xNTU4NTQyNDQ0ODUzMzUxMjc1LC80
MjI0ODU0MTM1MjU0NTQxMjQzMjI4NzMxMjMxNDc0MjU1MTUwMTQyNTUzMTQxNDk1NTQ1MzU4NDQy
MzUyNTc3MzI1NTM3NDc3MzU0MTMxNTUwNDQzMzM0NTIvMDM4NDMyNDM1MjM0ODIyNDc1MzQ4NTIy
MjMvMDIyMjc4NDUyNTU1NTEzNDQyNTg6NTMuMjc3MDM3ODQ0NTU0MzU1NTUyMDI1ODMzODUzMTMy
MzU0MTM1MzIzNTUzMjU0MjQ0MjMxMDE1NzQ1NTMzNTU1OTk1MzM1NzU0NTEyNDc1MzQzMjIyNDU1
NTg1NDU7NzU0NDc1Nzc4OTk3NzQ1NTQ1PDs6PDw1NTU4ODc6OjQ1OD45Ojs6ODk5OTo3Nzk4Nzo8
OTk5ODs5NTg5OTc4OTs9OTg0ODc4OTU6Ojg6PDo5PDs6Ozw+Ojg4Ojs6OTo1ODk7OTk7OTo6ODo4
NTs4PD47OTE1NTg5NTg4NzU1NDU1ODk3NzMxNTk1NTU6OTk1NTg8NTg6NTU3Ojc1Nzo5ODU1Ozc1
NTU5OTk5NTQzNzc1ODU4ODU0NTc1NDU1MjQ4NTc3NzU3ODU4Nzg5Ojk4ODo4NTo1Nzc3NDU0NTc0
MzM1NDU0NDM0NzMyNzU1NDMyMjU1NDI0NTU1NTg3NTMyNzc3MzQ3OTU3NzU0NDU0NDI0NDk1NDUy
NTU4MjUzMjU5NzU1NTc6Ojg3NzU3Ojs4MzQ1ODk1NTk1NTU1NTk5OTg5Nzk7OTU1NTU3PDk0Ojk4
Nzc8OTU1NTo6NTc3ODQ3OTg1ODk5PDk7NzU3Nzg4ODo8Ojg4NTk3NTo3NTU4Nzg3NTc3NTU3NzU3
NzU1Nzk6OTQ0NDs6Ojc1NTU0NTEzNzc3ODU1NTU3Nzg0NDQyNTc1NTU1NTg3MzM1NTU3NzU4NzU1
NTUzODU1NTc1NzU1NTU0MzU4NTU0NTIyNTc5ODU1NTQ1NTU5OTUxNTk1MTc3NTM1NTc1NTA1MDM1
MzU1NTM0NzU1ODQ3NDE1NDM1NTgyMjQzNTU1MzM4ODEyNDg1MzQ4NzU3PTU4NzU1ODk3NTE3PTo5
OTo4NTU3NTg1NTs4NzU3PDg3OTk4OTc4OTk5OTk7Ozk4Ojk7PTs3ODw7NzU4NDc5OTw8Oj04OTo6
OTg5Nzs6PTk7ODs4Nzo+PDs4NTU5OTk5OTs0NTk1NTs9Ozo1NTo3NTk+Ozc4PTo1PD45Nzw7Ojo5
NzU4ODk7ODk6OTs9PTg8Ozc8PDs1OTU5PD4+Pjs6ODo4Ojo6OTg5Ozs7PTk6Ozk5Oz07Nzo7OTg8
PDk4PDU3Nzo4OTk9Ojg3PTw6PTw7PD03NTc1NTU3OTg7OjU4Ojc5ODg3OTg3OTg5ODk5Oz07Nzs5
NTs5ODs3ODg1NzU8PDs6PDs5Nzo7Nzk5OjxAPDQ4ODo8OjU3ODg3OTs5ODk3Ojs8PTw6ODg1ODw8
PTo8PDs4OT08Ojo6Oz43ODg7PTs6Oj47ODtAPTg7Ojg6PDs8ODg7Ojc6Ojk8OTo7Ozo+Ozs+PTc5
Ozs6Ojw+PDs9PkA7Oj49PT09ODk6OTk7PDs+Ozw+Ozo9PDw7OjtBQDw8OTg7PTs8PDg3OkBCPT49
PT03Ojk4PT48Ozc6PDg7Ozo+Pjw6Pjs6Ozo7Ozw5PT05PDw6Nzc5PEE+Ojw8Ojc7PT03OTs3Ozw8
Nzs9Pjs3PDw7ODs5OTg7Ozo8Pjw7OTtCPTo4Oj08PDs6OTI1PT47OTs7Ozk1PT49OTo5Ojw8OTk5
PT0+Pjk7PkE9PT47PT08Ojo9Pj08PTo6PTw+ODg8OTk7Ozo5Ozk7MTQzNDMyMjMxMjI0MzAvMTgx
MjEwNTMyMzM1MzQ0My8zMTMzMzAwMTUyMTEzNzQzMDAsMTQzNTMwNDQ1NTQzMzAzMjI1MTQvLzEy
MjEyMTAyMTExLC8yMTE1NTQvMTQzNDEyMDMyNDQyMTExLjAwMzQxLy8vMjIyMS8yNTM1NTIyMDEy
MDUzNDcyMTAvMDIxMSwuMTQzMTIzNDUzNDQxODU0NTQ0NC4yMzExMzExMTUzNDUzLi8vMTM0MjIv
MjUzNDQ1NDIzNDUxLjMxMC4wLzEyMTM0MTAsLDQzLzAxMjAvLzM0MC81NTIyNzQzNDEuLzIzLzAz
NDUwMzQwMDU3NTMxMTMxMzU3NC8yMzQ0MTQzNDQ1NTIwMTMxMDQzMDAwMzIxMDEzNDQxMjExMjQy
NTUyMzQvMzc0NDU1NTIyMDU1MzAxMzI1ODMzNTUvMzU1MzQvMDQ1MC4wMjIxNzEwMjAwNDMwMzIz
MTIxMzEzMTEwMy8zMzQzNTMxMjExNDQ1NDEuMDEyMzMvMDM0MjEwMjU0MzUzNzUyLzIxMjQ0NDM1
MjExMTAuLy8zMTU1NTU1ODU1NTE0MzE1MzM0MjE1MDE0NTUzNDM1MjU3NDM0Mi8yMjAyMjExMjMz
NTM0NTU1MzExMjIyMzIzNTM0NTU0MzI1NTU0NTQ0MjIxMjIzMzUzNDU1NTMyNDU1NTI0LzAyMjI1
MjQ0NTMyNTU1NDQyMTUyNTQxNTQ1NDMyMzM0NDM0NTQyMTQ0NDIxMzMxMzMzMzIyMjE0NTU1NDMu
LjQyMjEzNTUwMzE0NTU1MjEyMjI0MjU1NzQxMjQzNDU4NTU1NDUyMTE0ODMzNDc1NTg4NTU1MDE1
NTUxMjQ1ODMzNDc3NzU0MzM0NDM0MTQyMzM0MDQzMzQ1My80Nzc1NDEzMjEzNTU1NDAyNTIyNDUv
NDc1NDIzMzk4NTU9ODc1NDc1MTUzNDc1NTQ1OjM1NTU0MjMzMzQ3NC4wMTExMzU3NzoyMTM1NDEw
MjMvLzAzNTUxMjQ1NTMzNTQzODo1NTQwMjU1NDc1ODcyMzU0Mzc0MzE3NTUxMzI0MjEwMjUzNTU1
NzQyNTQyNTMzMjI1ODUxLjI1NTc0NTUzNDkzNDQ0NTU1NTU1NDE1NTQ1ODo1NTMzNTU5OjQ1MzEy
LzEzNDU3ODk1NTQzMjAxNTU1MTE0NTc4OTQ1MzM0NTc1NTQ4NzcyNzQ1Nzk1NTM3NTQ3NTU5NDQ0
NDMyNTQ0NTc0Nzc1Nzk3ODk1NTU4OTw7NTk1NTg1OTo5OTo1ODo3NTc3ODo0NTk4ODU7PTk3ODo1
NTU3OD09OTs6Ojw5Ojk5PTw8Ozo7Pjs+PDk6Ojc3Ozo3NTg5OUA6Nzs8OzU6NTc1OTg3NzQ1NDU3
Nzg5Nzs4NTg5NTU8OTQ5ODU5OjU1MjU5NTU3NTU5Nzc4NzU1NTU5ODg5NDs5NDU1OTg1NDc3ODU4
NTU8NTU3ODcyNTk4Nzc1NTU4ODg1MzQ4NTM1NzQxNTc4NzU3PT05OTU1Nzc1NTk4ODU5NzU0NDg1
NDU5NzQ4Ojo4NTU1ODg1NTk7NzI4ODU1NTc4OTU0NTc5OTU0NDg1NTc0NTg8OTU0NTQ3NTU4NDQ3
MzQ1OTU5OTg1OTs3NTg4NzU1Ojc1OTM4NzU1Mjg4OjU4NTk3OTc0NTU0NTU3ODg3NTI1MzU1Ojk6
OTk3NTk4OTs1OTU3NTU3NTk4NTs6Ozw5ODI0NTU1NDU1NTs7ODk1NTU3NDU5Nzc4NzM0NDg3NTU1
NTg4NzU1Nzo4Ozk1NDUzNTMzNzQ1NTU4NTI1OTo1NzczNDU0NDUyNTQ0NTc3NTc3NTU0MzU0NTQ0
NTU0ODk1Nzg1MjIwODU0ODMxMzU4NzU3NTI0NDU1MzUzODk1NzU1NTU1ODU1NTU0MzU3NTU1NTgz
Mzc1NDU1MzI1NDU5ODc1NTQyMzg3NTg4OTU1NTc1NDk4NTU1NTM1NTg6NDU4NTo5Nzk4Ozc1NTw4
ODg3OTk0NTc4NTc1OTM1Nzw5Ojc3ODg6NzU9Ojc7Ozw7Ozo7Ozs7OTs7ODg5OTk4Mzg8OT48Nzc5
Ojo7OTo5ODg4Ojo5PTs6OTw4Nzg5Ozk+PTs5OTk3OTg6Oj43Nzg4ODk4OTk6NTo8Ojk4NTg6NTQ4
Ozw7PDg3Ozg6PDw6PDs8Ozs5Nzk1Ojs6OTk7PDs1PTg4Ozw8OTs3Ojk4Ojo9Pjo6OTU7PTw3ODU4
ODk3NDg6OTg4ODs1NTo8Ojo4Ojg6Ojo4OTo6Ojg3OTc7PTg0Nzc7PDU8Ojg6ODg5ODk5Ozs4Ojo5
PDw4Mzc3NzU4NzU1PT47NTg4Ojk6OTk3ODg4NDg5Ozk4OTg6Ojs7OTw6NTg1PD01NTw8OD06Ojo5
Nzg7PDw6OTk9Ojk7OTg6OTk5OTg7Ojo6PTs5PTs5Oj07ODU3Ozs+PDs5ODxBPjs9Ojo8Nzo7PTk8
Ojs9PTo8Pjo3ODtAOjo5PDo4Oz49Pj48PD09PT4+ODxBPjo8Pj05Oz46OTk5OTU3NTg7Ojk7Oj08
Pj49PTw6PD05PDs7Ozo4OTs5ODo8OTk7ODs8PDg4Ojs6OTc8PDw8Ojk6Oz09PTo5Oz05Ozs8PDo7
Ozo8Ozs+PD09Ozo+PTw+PTw8PDs7PD5APTs8Pj45OTc7Ojw6Ozs5Ozg3PDs7PDs7Ojs9Ojo4ODo6
PD07PT48PDk8PTw6Ozs8Ozc4PT4+Pjk1OTw8PD06ODg6Oj00NDIwMDExLzExMTIxMjMvMTEzMDEy
Mzc3NCwxLi4yNTAuMzUyLy8vLy41MzIxNTEzNDM0NTMyMjIzMjIyMTIyNDM0MzQxMTExMjEyMzM0
NDEvLjIxNDQzMzUzMDQzMzIwNTQ0MzQ1MzM0MTQxNTU0MjM0NTIyMzUzMjU1NTQxMjM0MjUyMTc0
MjE0MjAwMTM1NDExMzEzLywuLzQzMjIyMjEyMzIxMjIxNDIzMTI0LzA0MTIuLjA0NzUyMjIwMC8x
NTMvMC80NDIxMjMzMDEyMjEuLi4xLi4zMDQ0MzU1NTIuMTMxNTUyMzExMi8vMTMwNTUxMjEzNDM0
MzQyMTIzNTIyMjE0NTEwMzM1NTMyMTIvNTUzNTE1NTUzMzQ0NTUzMzMxMjMzNTIxMTIyMTIvMC8y
MjUzMzM0NTM0MDIwMDAuMjIwMzQ0MzIyLzU0MzUyMjAyNTQxNDIwMDAwMDIyMjI1MjExMjQ3NDIx
MDM3NTA0NDU3ODM1Ly4zMDMzNTQyNTMxMjU1NDEyMzExMjM0NTMyNDIyMjQyMjc0MDE1NzEuMTQw
My8zNC80Nzc1NzU0NTU0MTQ1NTc1NDE0NzEyMzU1NDU1NTUzMjc3NDE0MzMvMDUyMzU1NTU0NTU1
NzQxNzU1MzMzMjQ1NTUzMzUzMDU1LzM1NzUyNTU0MzQ6NTMzNTM1MzEzMTAyMzQ1OjUzMzQzNDU0
MzU3MzQ1NTI1ODQzNTg5MzU1NzQxMTU4NTM1MzQ1NTMwMTA1ODMwMDI0MTEyMDI1MzUvMjMxMzU3
NC8yMzQ0NDUyMzE1MjI1OjQxNTg1NzQvMTM1NTUzMTMzNTQ1NDU0NTc1NzU1NTgzNTczMjQ0NTc4
NzU1MzQ1MTEzNzU0ODU3NzM0NTMzNTc0NTc1NC81NTQ0NTMzNTU0NDUyNDU1NTc1MDI1NTM0MzM1
Nzk3NTU0NTUvMDIxMTQ1MDQ0MTM0NTM0NzI0NTUzODg1NTU1NDc1MzU1MzMzNTQyMDUzMzI1NzMy
MjIxMjIxMzQ1NTc1NDQ3NDI1MjIyNTg3ODg0NTg3NTM1NDI0MjU1NTQyMjI1MzAyNTU0NTIxMzcy
ODU1NDU0MTczNTQ4NzQyNDIzNTMyNDQxMTMzMzg4MjU1MzMyNTE1NTUwMTQ3NDU3NTc4OjU3NTIy
LjQzNDU1NDQ4ODU1NTM0NTU0MjU3NS8yMzMzMzIzNTg3NDQ0NTU4NDI0NzQ1NTU1NDM1NTM1NzUz
Nzg5NzI1NTc6OjU1NTM5NTc4NTU5ODc1ODU3OTs3NTc1OTk8Ojc7PDo5NDU4Ojw7Ozw4Nzc1OTg6
Ojk5NTU3OTs9Ozg5NzU1Ozw6Ozs7OTk5Ozk6Nzc8OTc1Ojo5Ojk3ODg4OTg3OkA8Pjs+ODo6NTk4
ODQ6Nzc5Nzc4ODs6ODU0NDg3Nzo7OTc5Nzk6MzU4Ojk5OTc3OTU4ODk1OTo1NTo3NTM1NTU1MzM5
OTc1OTc1NTU0MzU1NTc1ODc1Nzg3NTc1MjQ1NTU3ODo3NTk5NDU7NzU1NDU1NTc1NTQ1ODU3NTU3
NTM1NDIzNDU6OTc6ODg1MjU4NTU1NTc1NzU1NDg8OjU0NzU6NzU0Mzk4ODg0NzQ1NzM1ODk3NTQ0
OzUzNzc5OTU1OzkyMzc3Nzk8NTQ3NTQyNDU1Ozo1Nzk4NTQ0ODs7Nzg1NTo5NzU4OTc5NTU5OTg9
Ojg1NDU4NTU1NTg5Ojs6ODc3NDU1ODk5ODc4NzQ1ODk1NTU1Nzc1ODk3NTc4NzU4NTU1NDU4ODQ1
Nzg0NTk6PTcyNzc3NTk3Nzo3ODU3NTQ1NTg3ODQzOTg0NTQ3Nzc3NzQ0NTU3NTM0OjUzNTQzOTk3
NzEwNTU1NTQ3ODU5OTk1Mzg3Mzc1NDQ1NTM1NTU0MzI0NTczMzEzNzc4NDk4ODg5OTc3NTU1NTQ5
OTo5ODo4ODozNTU5NzU4ODk3NTU3OTczNTg5Ozc3Nzk4NTo5OTk8ODU4ODU1OTk5ODg1Ozs7Nzc1
NTQ3ODo5Ozg1NTU4OTI1ODw5Ojk5NTU3Ojw1NTs7ODs6NTk4ODQ3OTU1Ojo9PDw+OjU5Ojc5NTk3
Ojk4Nzc6PDc7Pj05ODg5NTk8Pj04OT08Nzo6OTc4OTw6OTo6Ojs7ODU6PDo4Nzg5Ojs+OTc6Ojg4
ODg9PTs3Ojs7OTc3ODo3Ozk5OTo8ODUzNTU4Ojc3ODk3ODo5Ozs7ODc4Pj44OTs1OD04NTg6NzU9
Ojg5Ojg4ODU1OTc3NTc5OTg4NTk4Nzk5Nzg3NTk8ODk4Ozo6ODk1Nzo1Nzo1NDU5NTU7Ozk1NTg4
OTc1PDs6Nzc3ODM0NTc1Oj06ODg6Ojs5PDc0NTU1NTg3Pj43NTU5OTg3Ozs6Nzg4Nzk7NTk8Nzk7
PDc6NTg5Ojg5Ojs6Ozw9OjU3OTk3NTc9Ojo3Nzs3Pjw+Ojs7OTk8Ojo5PjxAPTg4Ojo5Nzw9PkA8
PDo5PD48Ozw9Pj07ODc8Pjs9PDs7Oz49PDs5PDk6PUA9QD46Ojg5PTw7OTo+Ozw8PDk+Pjs6OzQ6
Ozg4OT09Pjw+Pjg3ODo6PDs8PDw6OTtAPj0+OTk7PDg5PDw8Ozw8PTs6NTg5Ojs4OTw+OjU9QD49
PDo8PDg7PDo6PTw8PDo8Pjw8OTpAPDo5Ojo6Ozs7PDo7PT48PDw8PDw+Ozo4NTw9QDs7Pjs+Ojs5
Ojw8Pjw8Oz09PDw6Ozk8Pjs6OTg6Ojs8OTk7NTg9PiwwMTEyNTMwMjArLzIxMTMxLjMxMi40MzMz
MTEyMzIxMS4wMjIzMzEyNTc1NTQyMDMyLzIvMjg1NDAyNDMwMDMxMzM0NDQzMTU1MTMzNTIyMjI1
MDI0MDI1OjU1MjQ0LzMvNTMvNTU1MzU0NDQ0MTEwMzQ1NTU1NTUzMjI0NTU0MTU0Mi4vMTUzNDE1
MzM3NTExMy8zMzMxMzA0MjEzMjExMjAzMjEyNDI0MjIzMTMzMjMyLjUzMTE1NDUwMjIxMjEvMzQ0
MzExNTUyNTUyMjM0MzQxMjc0MjM1OTEyNzEzNzMyNzkvMzM0NDUzMTE3NTQzNTQzMzQ0MTEvLzIz
NTMyMzUzNTU1MTQyNDU4NTU1NDM0NTU0NTExMjMyNTAvMjM1MzAyNTAxNDc0MzIyMjAzMjMxMS8z
MjMyMDE1NDQ0NDQ1Nzc3MTEzMzAxMzMxNDQxMzEwLjEzMjMzNTEyMTI1NDIyNTU1NTIxMzIzMTQ0
NDQwMTUyMDEzNDExMTIyMzcxMzAwMS8vNDUxMDAyNTU1MjEzODg0LzQxMzMyMzE0NzU1NDM1NTMy
MjE1NTM1MzEzMzo3NTUyMzE1NDMyNDIxNTU1NDI1NDc1NzQxMjIzMTc6NzU1NTQxMjU4MjE0MzQ0
MjAzNTQyNS8yNDM1NTEyMDQ3MjI0NTU1NDU1NDM1NTQ1NDQ1NDQ1NTA0NTEvNDUzNDQ0NDMyMTMx
MzU0NTQ1ODU3NzU1NTk3MzU1NTU0NTU1NTg1MjQ3MTM0MzIzNDUzMzQvLDI1NTM0MzI1NTM1MTI1
NDU1NDQxMy80MjM1MjI1NDU1NTg1NTE0NTMxNTU1NTk3NDQyNzU3Nzo3NzU5NTAzNTM0NTU1ODU1
NDM1NTQxNDI1MjQzMjQ1ODEyNDU1NDQ0NTMxMTQ1MzU1MzMyNTc1NTc0NTIyNTU4NTEyMzU1OjU3
NzUxNTU1NTQ1MTQ3NTM0NDI0NTU1MzU0MjQ1NTc4OzQ0NDI0MjQwMzM1NDU0NTc1MTMxNTc1NTIx
NDQyNTMxMjM1NTc1MzQ0NTU3NDU4Nzk1NTc3NDU1NzAxNTMyNTU1ODUzNDMxMDM0NDc1NDU4NTQ3
NTIyNDM1NTU4ODk3NzU3MzQzNzc0MzU1MjQzMjM1NTc1MzU1NDU4NTMzNzM3MzM0NTQxMzU1NTI0
NzQ1NTc1NDQ1NTUyMTEyNTQ1OToyNDc3NDIxNTc4MzU3NTg3ODU3NTo6NDM5NDU1Nzc0NDU1NTU3
NTMxNDU1OTg3OTg6OTU1Nzc5OTU6Ojc4NTU5Ojk3OTg5Ozw6ODs9OTc3NDk9PTw5NTk4OTU0NTU0
NzU4PTU3OTk3OTk5Ojk4NTc3OTg5ODo1NzU5Oj03NTk+Pjw1NTU3OTU4ODk5OTs5NDU5PDs3NTo5
OTU1NzU6PTU3NzU6PTo4NTQ1Nzc1ODk4NTU1NTg4NTM1Nzk3NTs4MzM0NTUzNTk5NTU6OTQ0NDQ1
MjQ0NDk4NzU5NTU1NTk5OTc1NTI1ODs3Ojc6Nzg3OjUzNzk1Nzg3ODk0ODk4NTc1NTQ4NTU4ODk3
Ojk6Ojo3NTU1ODg4Ojo3NTU3NTQ1ODw8PDk6Ojo5Nzg5NTU4ODk4Nzo3Nzc4NTs5OTU4NTg1ODk7
Nzk3OTU6ODg0Nzk3NTc1Ojs6OTQ1ODo3NzUzOTc1Nzk4OTo7NTQyNz05NDI1OTMxNTk4OTg5ODc3
NDg1NzU4Ojo5NTU6OTU1ODc5ODU1OTg1NTU1NTU0NTk4ODc0NTc1NTo4ODg3NTQ1ODc3NzU3OjU6
NTg3NTQ5OTc4NzQ1NTU1NTU4NTczMTg4NTMzNzczNTQ3NTU1MTQ1NDQ1ODc5ODMxNTU1NTQyMjE0
NDk0MjU3NTMyNTc4MzUyNTM1NzUyMjQzNDczNTU3OTU1NTUzMTM1NTk1OjU1NTU1NTc3NTU7ODQy
NDM4ODUzNzk3OTs6NTU7NTQ3Nzg4Ojg3Nzo5PTc1OTc4NTU4OjU6NTc3NTc7Ojk6Ozc3NTU0NTU1
NTc4OTU4NzU3OTo4NTo6Nzg1NTU5ODc3ODo4ODk1Nzc0Ojs7Ojw6Ozo7OTg4Ozs4NTk7PTs6ODg4
Ojk5OzxAOTo4PD49Ozo5NTc4NTg5Ojs4Nzg6PDw8Ozs4OTo9Ozg4Ojo8Pjs1NTc6Ojg1NTk6OTs6
ODw7Ojo5OTs9Ozk6OTg5PDk3NTc4Oz47Nzc3Nzs6ODc5OTk4PT0+Oj08Ojg4ODs6Ozk5NTc5Nzg6
NT09NDc5ODg5Ojc1NTk4ODs4Ojk1NTU0Nzk5Ozs6ODU5NzU3ODg6ODc3NzU6OTg7ODg5OTw9ODo5
ODU5OTo3ODo5OTo3NzU6NTc4ODo5OTk4OTk6ODU3NTU8PDc6Ojw6OTo9PTs4OTo1Nzs6OTg9PTk6
Ozk8PDs6Nzk+PTw7Pjw5Oz49Ozg7Ojk8OTs+QDs6PTk8Pjw6PT08PT05PTs+Ozo5PDw7Oz07Pjw7
Pj5AQD45OTo7Ojk3PD09QD45ODc5Oj49Ozk+Pjs8PTg6OTw7PDg3OTo1ODk5ODpBPDs6QDs6PDo8
Oz04PD07Ozk4OTo5Ojk8PDk5OTo5Ojk7Nzo8Ozg3ODw8PDw5Oz47OT4+PTw7Ojo6Oj08OD47Ozo6
Nzo4Ojo9Nzg5Ozk+Pj48Pjs9OTc6PDw7Pjo3Oj08Ozw7Oj4+Ozw8QD08PTxBPDw7Ojs5PT06PD08
PD06Oz48Oz48Ozs8ODw8Oz08OTs8Pj07ODo5MzI0MzU1NTAxNDM3MzIvMzUyMjEwMzIyMi8zNTc3
NTAuMDUzMCwxMjI1MSwvMDM0MzQxMCwuMjEyMDIyMjEwNTMzMjA0MzQzMDE1NDIxNTUxLzEzLzE0
Mi4wNTM1ODQ1MjQ1MzM1NTU0NDA1My4sNDk4NDEvMzEzNTM3NzMxLzI3Mi4zMzAyMzEzNDMyNTEy
NTczNTE0MDI0MjQzNDUsMTU1MzI1NC8xMjEyNTUwMjUyMjUwMDQyMDMzMjMyMjMzNTU0MzI0MjIy
NDQ0NTU0MC8wNDUxMzQyMzEzMTEyNDM1NzUyMDM0MzEzNDUzLzIyNDI0NDA0MjM0NTU0NDQ1MjEx
MjExMTM3MjAxNTMyMDEyNTIxMjUzMzQ1MTE0MTMyMDU3NzU0MzExMDMxLzMxMjIvMjEvMDAzNTEz
NTMxNTU0NC8yMzMxLzAzNDMxLjA0MDAyNzU1MCwzMzU0NzIuNDU0MDAyMjI0NDMyMDIyNDU0MS8x
MjEyNC8vMzQyMDEwNTQyNDMxMDI1MzIyMzM1NTQ1ODUyMzM1NTMyOTc3Nzg1NTU0NDM1NTUzNDM0
NzQ0MjU0MzMwNDU4NTU3NTMzNTUyMDM0Nzc1MzMxNTIxMDIyNTUyMTc0MTMwMjAyNDQ1MjM3MzI0
MTEwMzQyMjMzMDAyNTQ1NTUzNDg5NzU1MjE1ODg6MjQ0NDM1NDE0NTg1MDAyNDMzMjEvMjAzNDQ1
MTAzLzExMTMyNTQyNTU0NTUzNTU3NTU1NTU0MzAxMjMzMjMzMzI0NTQzMjA1NTM1NDU1NTQ0MjQz
MDQ3NTUzNTUyNDU5ODQ1ODo5ODc1NTM0NTk6ODUzNzc1NTUzNzU0NDQ1NDc1Ojs1MDU0MzU7NDU1
MzAxNTU1NTU1NC8xNzM0MjI0MTM0MjM0Mi80ODUyNDU0NDIzODQ1ODc0NTM1NTI1NTU1NzU0ODU1
MzEyMjM1NTI1NDU0MTQ0MjU1NTMzNTEyNTQ0NTQyNTU3NzU0NTo0MjQ0NDIyMjg1NTgzMjAyNDk1
NTc3MzQ1NDMzNzU4NTQzNTIxNTg6OTcyMjcyNTgyMTM1NTQxNDU1ODU1NTc0NTc1NTUxMzM1NTU1
ODU0NTE0NTM3MzE0NzU4NTU0NTUzMzUyMjIzNTc1MzMyMzU4MzE0NDQ1MzI4ODU0NzUzNTg1NDU0
MzU3OTcxODU3NTQ1MjU1ODQ4NTUyNTU0NTU1NTUxNTc1ODQ0MzQ1NTUzNTU3MjQ0NDU1ODc3NTk1
NTQ1OTo3NzU1Nzw6Ojg3Nzo6ODk5Ojw3Ojw9OjU5PDw6ODU7PDk1Ojs1NTg4Ozs8Ojs5NTg5Oz09
OTo5ODk8Ozg6Ojs6Ojw9PD04NTg8Pjs8Ozo8Pjo4OzU0Nzo6OTg4OD46Nzo1Nzk1ODg1ODo3NzU3
ODo3ODk7Nzg4Ojk6NzU1Nzg3ODg4OTc7Ojg3Nzk1OTw8Nzg1ODc5ODk6NzU1NDA0NTQzNTk0NDc0
Nzk1NTs5OTUyNzU5Nzk5OTc3NTU4OTgzNTUyODU1NDQ1NTU3ODQ6NTM1NzM1OTUzMzU4Ojo3NTQ1
MzU1NDU1NzUyNDM1NzM1OTo6OTc7NzU8ODg3NTU1Ozk0NTk4NTU3NzUyNTk5Nzg4NzU3NzM1NTo5
NTg3NTU6OT05NTQ1NzI1Nzg4OTs7ODc3MjU5Nzg6ODU1NTU5OTo1NTg4NzU3ODo5NzU3NTU1ODU5
Nzo5PTc1Ojo+ODo3Nzc4Ozk1NTU3NTo5MzU5Nzw9OTUyOTo1Ojs1NTc3NzU4Nzc3NTQ3Nzo0NTg4
NTQ5Nzo6Ojk1NDM3MzQ4NzQ0NTc1NTc1NTU4NTo3NTg5OjU1OjUzNTQ0NzU0OTc1Nzg1NzU1NzUy
NzUxMDc0NTU4NzU0NDUzNDk6NTc1NDU3NTU1Mzc1NDc1NTc3NTQ1NDc3NTM3ODU1NDQ1NzU3MzAy
MzM1NDUzNTc3NTg1NDU3MzIyNTg3ODU3Ojc3OTg0Nzk1NTM1NTU4PTU5ODU1ODc1NzQyNTk6Nzg5
NzU1NTU0NTU4NTU6ODo4Ojk1NTc6Ojs8NTo5NTw5NDM3NTg4Nzc5OTc0NTc0Nzc1OD08ODw8Nzs5
NT07OjU6OTg7Ojc0Ojg3Nzg1Nzg8Ojw9PTs8ODg5Ojo7Ozc4ODg4Ojw6PDw7ODg7OTo6NDg8ODc6
Ozo1Ojo6Ozw7OTo8Ozg4NTo8ODk+Ozo9PDs6PDo7Nzc6NTU3NTc6Ozg5Nzs5OTw5Ozk1NDw8ODo4
Ozg4ODs7Ozg4Nzk8OjU1ODg1NDc6Ozs6NTg6OTg1NTo5Nzs5ODM4NTQ3Mzk6ODo4NTU0Mjc1NTc6
OTc7Ojg5OzgyMzc4NTU6OTg6ODs4Nzk7OTc1Ojs3ODU1PTo4Ozo6OTo6Ojs+ODU4Ojk8Pjk3OTo5
QTs6PTg7Ojk7Ozs8Ozg4Oz48PDc5Oj4+Ozo4NTg7Nzs5OTw+PTs9OTs9PDk9PT4+ODs8OTo6Oj0+
OTU7PDo5PD47Ozo3OTk5PTo5NTw6Ojc6Ozw1NTg6OTk4Ozs8PDk7Ojw9PT49ODk6Ojk6PD47PkA8
OTw7PTs5Pjs5Ojg5OTs6OD4+OkA+OT0+OTk1Nz0+Ojs5Ojk7Nzg3PDo7PT49PTw4ODw8Oz05PDw7
PDw8Oz06Nzo7Oj07PT05Pjw9OT47PDk4PT4+Ojg3NzU4ODw6OT48PTk1OTw+Oz06Ozw6Pjo5PDs6
OTo5OTo9Ojc5PD0+QDs3Nzs9Pj06OTw1MjAzMjMwMDM1MzIyNTQxMzMvMjExMzUyNTQxMDAwNDI0
LzIzMjU0NDIwMzMwMDMzLi8yMzAvMTEyMzIyMzMyMzIwMi81MjEwMTIxMzU1NDEwMTIzNTI3NS8y
MzMyMjExNTUyMjE0MzIyNTQyMjI1NTAvNDUxMDAyMjE1NS8zMTc1MjEyLzEzNTIwMTUxMTQ1NDU0
MzEyMjMyMzM3NzUzMTQzNTI1MzQ1MzUzNTM0MjMyMDAzLjUwMDEvMTIwLjExMjQyNTUzNDQyMTIx
MjM3NDQxMDE0LjAxMTUxLjEyMjQvMTEwMDQzNTMwMjU1MjQxLzAzMC83ODEsLC4yLi8zNTU3MzEv
MjMzNDQ1NC4uLzEwNTUxNDM3NTAwNDEzNTU1MzExLC4xMDIwMjEzMzIxMS8xNTUyMzUxMzEyMjMy
MzQzNzQvMDM3NDEyNTUzNDQyNDIzMzMyNDA0NDIyNTQ0MjIxMzUzMjEzNDMyMC81NTI0NDU1NDIw
MzQwMjM1NDM0NTk0MzMyMjA3NTU1MjI1MjI0NDQ3MzIyNDM0ODU3MzMwNDQ4OjUzMzMwMzU1NTMy
MzIzNTM0MzQ1MzI0MzM6MzAxMTQuNTM0NTMyMzo1MjEzNTo0NDk6NzQyMzQ0MjQ1NTQ0MzIxMzI1
NDIzNDUyMzMxMjU1NTU1NDU5ODUzNS8wMzMxMy8xMDQ3MzAyNzU0MzI1NDI0NDE0NDU4NDI0NzU0
NDQzMTI0NTo3NTU4MTI1ODQ1NTA0NTUyNTQ1NTMzNTU0MjQwMTExMzU3NTQyMC40NTI0NDU3NzUy
MzIzMzIwNTEzMzM0MDIwMjU1ODU0NTc0NDc1MjQ5NTIxMzQ1MzM0NDQ1NDEyNDM0MzM0NTc0NTU1
NTU3NDQzMzUzMzU1ODo1NTQzMDMzMTM1NDQ0NTU3NTU3NTQ1ODg3NTUzMzU3NDQ0NDk3NTU1LjI1
NTQ0MTM0NTU3NDU3NDM1MzQ1NTM0NDUwMjE1NTUwMzQzMzM1OTQ1NzM0NDUzMjQxMjAvNTUzNDI0
MjI1NzcyNzUzNDIwNDc0NTUzNTU4ODM0NDMyNDU4Nzc3Mi8yMjAxMTQ4MzMzMjI4NTQxMDU1NTM1
NzUxMjM0MjU3NTQ0NDQ3NTU1MzQ0NDA1MzEyMzIzNzk1MjU3NTc3NTE0MzIyNzQ5NTQyNDUxNTU1
NTU1MzI3NTQ5NTU0NTUxNTQyOTkzNTc3NTg1NTU1ODc3Nzo3ODg1NTQ3NTUzMzc1NDg5NTU3OTk1
NDc6ODU4Ozc4NTg1NTc4NTU1NTk1Ozs1Ojk3ODU8PDs3NTw9PDg8ODU6Ojo4Ozk8Ozw5NTg4NTU4
Ojs7PTs8Ojs8ODs5PTs4OTs3NTc3Ozs4ODg1NTg4Ojc3NTU4OTo7ODc5Ojc5Ozk1Oj06MjQ3OTs6
MjU1Ojg4Pjk3ODk6NTk7NzU5OTc4Ojw3ODg1Nzc4Ozo4NTc0NTc7PDo4NTUzNTU5ODU7Nzc4NTM1
NTU1NTQ1ODUyNTc0NTU0NDU1NTo6ODU1Nzc4ODk1NTU1NDU5NTM1OTQ1NTU4OTk6ODU1OTQ1ODk4
OTs4NzU0ODs1NTc0Mzk1NDI0MzU1NzU0NTg5NzU3Ojo1Ozg1NTg4NTk6NTQ0MzU1NTg4ODc5NTU1
NTg9OTk1MjM4NTk1NT07NTg1NTc1OTc1NTk4ODc4NzQ0MzUyNTs4Ojg1Mzk1NDc1Ozk5Nzg3OTc3
NzU1NTo7ODM3NzU1OTU0NTc7OjU1NTU1ODUzNTg1NDQxLjE5OTgzNDU1NTc4Ozk7ODU3ODU3OTU0
Nzo1Nzk3OjU1ODU1NTU3NDU0ODUzNzg4NTU1MzA1Nzk1Nzc4NTc3OTk0ODU1NTQzNDk1ODg4NTU3
NDI0NTQ1NTQyNTU5NDM3NDU0NDM1NzU3NzQ1MjU5MzMyNzc3NTo6NTU1NDk3MzI3NDU1NDc6OzU1
MTQ1NDUzNTg3NTg1MzU1NTU1NTI1ODo6ODc4NDU1NTc4NTQ1NTU5NTU1NTk5NTU4OTk7OTo5NTc5
ODk5NTg1NTc3Ozw6ODg3MzU6ODo4Ojo7Ozg1NTo1Nzg6Ozw5OTs6ODs6PD01PD05ODo6PDg4OTs6
ODw7PTs1OTo1Nzo4NTg8OjU4OTU6ODc8PkBAPjc3Nzo8OTg1Nzo7ODg5Pjs7PDs6Nzc4Pjc4PDo3
Ozc1ODg6Ozg5Nzc8Ojk1ODk4ODc1OTo6Ozw6OTk6Ojo4ODg5Ojo5Nzg1OTw9PTQ1Ojc3Nzg4NTo5
NDQ5OTc5OTg1NTs6ODU1ODo6Ozw4MTg1Ozo5NTU7Ozo3ODo7OTc4ODQ6OTg6ODk4NTc9Ozc5OTg4
OTo6ODo8PTg3Ojs3ODs7Nzo7OTk4Nzk7Ojc5Nzg7ODo5NzU6Ojk1ODs+Ojo7Ojs5ODo6PTs4PDw7
ODk3Oj08PTs8OTs5PT05Ozw5PT4+PT47Ojk8PTw9Ojs5ODw7PT09PkE8PTk9Ojs7PkI+PTk5Ozs7
QD46Ojo7PEJAPjw8PTw6OTs5PT07PTs6OTs7PDs+PTg6PDs9Ozs6OT07OTw+Ozc4Ozk4Nzo6OTo6
Ojs8OT07Oj09ODo7OTs4Ozk5PTo6Ozk6PD08Ozo6OTw8QD47OTo5PDo+Ozk8Ojc9Nzc5OTo4NTs8
Ozo4PT0+Ozk+PTw6Ojg4PD47PT08Ojo8ODs6OTs6Oz08PTo6OT4+ODk8PTs+PTk8OTc5OT07Ozk6
Pj49Ojg6Nzk7OTk8Pj0+Ozw+PjIxLzAyNDQzMzM1NTMyMzU0MzE0NTQwLzIzNDA0NDE0NTQyMTUz
MzcyMTUyMjMwMjAxMjM1MzI0MDExLy8vMi81OTg1MDAyMDMxMjc1MjI1NDUzMDM1MjAxNTUyMzI0
MjUzNTU0NTUxMDIyLzEzMS4zNTQzNDQzNTExMjIwMTc1Li80LzA0MzMzMzEyMjEzMy4wMjMwMjc1
Mi4yMTEyMTUxMS4uMTIyMjM0NTQwMDU1MjEuLzQzNDIwNDQ0MTA1MTAzMC4vMi8wMzQ0NDM1NTQ0
NDMyMTIxMzU3My8xMzQzNDMuMDExMC8yNDU1MzIyMy81MzMzLzEuLzEvMjA1MjQ1MC8yMjIyNTUz
MSwzMDAzMTA0MC4xNDU1ODUwMzAzNzUyMjUzNDQzMzA1OjU0MzIvLzExMjM0NTQyMDIvMjI0NDQz
NDc0NTUxMjMyLjI1NTU1My8xMTMxNTM0MzEwNTc1MTM1NTE0NTQyMzAuMjIzNDM1MzUyNTU0NTUy
MzE0MzMxMzU1My8zMzE0MzU1MjI0ODU1NDI1MTEzNTM0NTUzMzI1MjIzMTI3NzM0NDIwLzA1NzQz
MzQ4NTQ0MjI1NDMyMzU1ODU0NDU4ODk0MzU1NTU1NzUzNTg4MjQyNDExMzE1NTg4NzQ1MzI0NDQv
MTIvMjkxNDI3NzQwNDQ1NDMyMjU1MzMwMzc1NDQ0MjMzMDc5NTQ3ODU4NTU4My8zLzIyMS8zNDM1
Mzc3NDQyMC8vLjEzMDI1NDQzNDc5NDA0MzUzMTE1NzIzMjA0NDMyNTU1NDM0MzM0NTQ0MzQ0NTUz
MzM3NDM0NDUxMTM0NDU1MzMzNTMzNDE0NDAzOzgzMzczMjU1MjU5NTQ1NTc1NTQ3NzIzNzMwNDQz
Mzk1NTU1ODQ0NTMxNTUxNTU1MzM0MzQ3OTg3ODQzMjI0NDIyNTg3NTM3NTU3ODU1MDQ1NDU1MzMz
NzQxNDQ0NTU1NTQ4NTQ0MjM0MjU1NTIyMDIyNTU3NDU1NDQ0NzQ1NTc4ODM0MTM1NTQ1MzMzLjMy
NTU0NDQ1MjEzNTEzNDU3NDU0NTU1NTU0MjM1NTUzNTg4MjEwMjM3NTIyNDUzNT03NDU0ODc1NDI4
MzQ1NTs1NTc1NTU1NTUzNTQxMTI0NTEzNDE3NTg4MzAyMzU0NTU0MzI0MjQ1MzQ0ODQzMjU6NzU1
MDIzNTcyNTU1NzUzMzc5NzU1MzE1NTU6Nzg0MjU0Nzc1OTU3NDg1MjQ4PDk1MzM1NTc1MzU3NTU0
NDU1OTg4Nzc3OTo1NTg1NzQ1Mzo9PTs1Nzc4OTc3ODk8NzU3Nzk5OTU4ODU4Ojk6OTc3Ojg4NTM3
OTU1Ojs5ODo8OTU4Nzc5OTU6PTg7OTU3OTw6ODo7PTk4Ozs3MzQ4PTs1ODg4OTg5ODk3NTUzNTk3
Nzg7NTk3ODc5ODUzMDc5NzUzOTs1NzU3Mzg5Ojs5NTM6Nzc5Ozg4NzU4ODc1ODo6NTM1NzU1Ojs5
NTk1ODk4NDM3NDQ4Nzg3Ojc1NTg1ODg4NTk6ODQ4NTM4NTU5ODo5Nzo7OTU1NzQ3ODk4OTk0ODc3
NTU6NzM1MzU1Nzs1NDU1NzU3OTo3NDU1OTk3NTU4OjczMzM3OjU4NTQ3OTc1NDc3NTUzNzU0Nzs4
Ojk6NzM1OTo1NTc3NTc4Nzc3ODU1OTk1ODg7Ozk4Ozg4OTc1NzU0NDc3NTI5Ojc1OTg8ODk4PDo1
ODs1NzU1Nzk3Nzg3Pjo3MjI1NTc5ODg1NDg3NTc1ODo3NTU1NDk1NzUxMzU4MzM1NzU3OTQ3MzQz
MjEzNDQ1NzM0Nzk0OzQyNDQ1NTc1NDcyMjIwNzg0MzU0MjM3NzQ1MzQyNTU1NDU1NTM0NTQyNDU4
NDU1NTU1NDI0NDU1MTU1NDc3NzQ0NTU1ODU3OTU0NzQ0NDU1NzQ0NzU1ODs3NzQ1NTk3NTQ0NDc1
OTczMjU7NTUyNDQ0NTk4OTU1NzU1NzM0NTU5OTs4NzU1NTg1Mzg6ODU4OTU1NTQyMzk7PTk4ODU1
NTc4NDg4Oz04NDE4ODUzNTc1ODk3Nzk4OTg1OTs4NTc1Ojg6Ozc5PDs1ODg4ODk6ODs7Nzk6Ojg4
Ozk6Ojo6ODU4NTg7OTU3OTg5ODk6OT07Ozw5Ojo5Ozk6Ozk1ODo5Nzs6OTg6Ozs5OjQ3OTk9PDo3
Ozs5Ojw7OTk5ODc8Ozg3ODs7ODk5ODg6Ozo1NTg4NTo7Ojs3Nzg3OTw5OTo7PDo7Ozg6Ojw6Ojg0
Nzo6NzUzNTs3OTw4NDc1ODc6Ozo1NTU1Nzo3Nzs9Ozk7Nzc4Nzc7OTc3ODs6ODU0OTk9Ozk4NTc7
OTs5PTc1NTU1ODw6Nzk5Ozk3ODg5ODs5NDg5NTk7Ojo+ODU8OTo7ODc3ODU1Ozo4OTg5Pjg7Ojs3
Ozg4ODo6OT09Ojc5NDc9Ozk4ODg+PDs6Nzs6Ojo5OTc3Ozs6Ojk4Ozo7PT08OTk9Ojg3Oz0+PDo+
Ojk6PTo6Pj46OUA+Pjs6Oj4+PT48PTo8Ozo6OD08PUA6OD47Ozk7QD46Ozw8ODg4Oz46PDk1Oj05
PTs8Pjo4OTs7Pjk6OD47OTc5Ojg7Pj4+PDw6PTs5OTs+Ozs5Nzo6Ozg6Ozs7PTs7Oj08Pj49Pj04
Oz08Ojo6PUA9PDs7Ozs5OTw8Pjw7Ozw+OT0+PT07Ozk3Ojo9Pj48OTo6OTk8PDs1Ozw9Ojw8PD47
Ozs5OD46Ozw6Ojw7PTk7MTEvLCwuMTQvMjE1MzIzNTEzMzA0NTIwMjIxMTMvMDAzNTUzMTEyMTA0
MzMzMTEyMjA0MzQyMTIyMDMwMTIxMzIyNDQwMDEyNTAyNDQyMDIwNDM0NTAzLzM1MjIwMTUzNDE0
NTEyMTIyNTIxNDU1NTI1NDMxMzQzMzIzMjE0MjExMzIzMzIyMjM1NDAxMDMzMDE1MDM1MjEzNDUx
MjQzNDEzNDAxLDAuLjQ1MDI0MzI0MjAwMzIzNzUxLy4yNTE0MzIsMzIxMDI0NDMzMDMyNTIzMjAy
MDIyNDI0MjU1NDEyMzQ4NTQwMzIzNTMvLjE1MC8yNzMuMzIyNTQzNC8yMzUvNDQvMjAxMjMzMzIz
MjIzNDQyMDM1MTA0NTM0MjUxNTQxNTc1MDAwMTM0NTUwMjQ3MS8yNTMzMzQwNDg1MTU4My4vMjQ1
MDMzNDQ4NDMwMzU4NTIzNTg1NTc6NDMyLjQzMjQwMDIxNTMyNDUyMzc1NDM1NDAyMjIxLzQwNDU1
NzI0MzMzLzI0NTQ0Mi8xNDIzMzI1NzQyMTMxMzAwNDQ1NDQyNTQyMjAyMzI1MzU1NDU0NTMwMjMz
My81NC8yMjI4Nzc0NTM1NDkzMjU0NTMxNDEzNzQzNDU3NTQ4NTUzMjIyNDQ0NTMyNzU1MzAzNDM0
MjU1MjQ0NDQ0MzAwNDQyMjEyMzU3NTIzODQyMjIwMDU3MjM1NTMzMzM1MzU1NDU0MzQ1NTQ0Li8u
MjQ5NDEwMDIzNTQ3NTIvNTQ1MjEvMDMxNDQ1NDU1MTEwLjEyMTUyMy8uMjM1NTQ0MzMxNDIyNDQ4
ODAyNTI0NDM1MS8zNDU3OTU0OTU1NTU4MzQyNDQyNTU0NTQ0NTc3NzU1ODEzMTQzNDc1MDIzNDM5
NzIzNDIwNDU0MDEyNDA0ODg4OTU1LC4zMjU0NTQxNTU0NDg6NTU6NDQ0Ojg4MjE0MzI1NTU3NTU1
NTUzMjU4NTQ1MTQ1NDQ1NTg6NTU1NTg0NDM1MzU1NTQxMTIyMjQyMjUzNTU1MjU0NDM3NTI0NDQ3
NTQ3NDUyMzM0NTMzMzc1LzQ0MTI1MzU1NTU1NTUyNzk1MzIyMTEzNTc1MTQ1NDMyNDU0NzU0MjMz
MjMyNTk1Nzk3OTc1Nzc5NDI1OTU0NTk1MzM1NzU4NTk7ODg1NTU1MzU1NDU4NTUzNDU1MzUzNTQ4
NTc1NTQ0MTQ3OjEuMTQ6NTc0NTQ1NTU1NTc6OTU4OTc5NDIzNDg5OTUzNTU0NTU3NDc6OTc0Nzg3
Ozg1Ojc1Ojk3NTU3ODk3Nzk8PDk0Oz03NTo5OTU5Nzo9Pjo6Nzg7OTk7PDw6PDw+ODg3Oj07OTg0
OTs6Nzo5OTU7OzU1NTg9ODo1NTg1NTw8Nzg5NzU5Ozo4Ojc4OjU3O0A7Nzc3OTM1NTM1ODk6PDo1
Nzk8OjU1NzUzMjMyNDU7ODg4Nzk4ODs1NTQxNTg4OjU0NTEyNDQ3NzU1NDc7OTc5NTU1NTU3ODU1
NzU0NTg6NDQ1NDMzMjg4Ojc3NTU5NzM3NTEyNDQ0Nzo0NTw6ODc5ODc1NzU1Nzg3MTU3NDU6NTMy
Nzk5OTg4Ozo1NDU1Nzc4NzU3Ojs1ODQ0Mzc3ODc0Mjc7NzU5NTU1Nzc1Mzc3Nzc4OTk1Nzg0Nzs4
ODU1NTQ0NTU4OTs6Ojg1Nzk3NTU5ODg4NTU1Mzc1NzU4PDc4Nzg5ODk3NDU5ODU1NzU0Ojg1NDE6
ODg1NTU0NTc4NTM0MjU3NzQ1NTU3OD07ODU5Ozk1ODc3MzI1NTU3NTc1MzM1NDU1Nzg5MzM0NTQ1
ODU1NTU3NzU1NzIyNzkzMjU0NDc1MjUzMzQ0MzM1NTc1NDU1NTMwMzU5MzI0NDM0NTg4Nzk1Mzc4
NTU4NTU1ODs3NDQzMzU3Mzc1NTo3ODk4OTU1NTc1NTg0OTk5ODMzNzU1NDc3NzM1NDU1NDU3OTc1
OTg1NTk1NTc3NzU1Nzk9OTU0MzU3NTU0NzQxMjU4MzU4NDM1NTQ1ODU1NTU4NTk1NTk1Ozc0ODc1
NTg1MzM1Nzc3NTU1ODg4PDU4OTo1NTc3NzU1NzU3ODc7NTk9NTo5ODU4NTg7ODU5NTk5OjQ6OTg7
OTU5Ozc4Ozk4ODg4Ozk1OTo4NTo6ODg6Nzk6OTg6Ozk7Ojg3ODw7PDs3ODo+PDk6ODw9Pjo6Ozs7
Ozk5ODs6OzQ6PTk3Nzw3ODs4OTg3Ozw6OTU1OD49ODg6NzQ4Ojg8OzU5OTg7Ojs6Ojk1NTc1NTk4
ODk3Nzg1NzUzOTU7Ozc3NTc3ODQ4ODg4NTs7ODU5Ojs6Ojg6OTk4Ozg1OTs5ODs6ODU5ODk7OTU1
NTg8Ozg5NTc1NTc3Nzc7Ojo5NTM1ODk5NzU1ODU3Ojc1ODs6OTg1OTs9Nzg5Ojs9Ozg3PDs7QD03
ODo5Ozk4OT47ODo7PDk5PDs6Pjk8PDw9PDs9Pj07PDs7PD46PTw7Ozk+PTs5OzlBQTw9PkA9O0A9
Oj09OT49OTs9Ojw9Ozs8PD47Pjw5PT06PTg5Ojo4Ojs7PDw9Pjo4Ozw+OTc6Pj5APT07Pjw5Ojg8
Pj4+PTs9Pjw+Ozg8PTg5Pj47Ojo4Ojo9Ozw7OT08Pjk6OTw+Pj07Ojk7OD5AOjs6Ozk9QDw6Mzc+
Pjw8Nzg3Ozs6OTg4PT0+PDw9Oz4+Nzg5PT47Ozo8PTo+Ozk7Pj07OjU8Ozs7Ozk5Ozk4PD4+PT0+
Pj4+PTk5PDw9PTwvMjMuMC81MjA0MDAvMTEwMzEwMTIvMDIyMTEzMDAyMjMyMTIwMjMxMjMzMTU1
MzAvLDAxLDAwMDAvLDMvMTExMDIwMC8xMDAzMy4wMTEyMzIwMzQyNDEvMjEyMzMxMTQyMjMxNTQy
MTIyMTEyNTMxMTQyMi8xLywuMDAyMzM0NDUzMDA1MTIyMjUxNTQ0MzIxMjMxMDE1MzIwNzc1MzIy
MjAwLjQ1NDA0NTg1MzczMTEyMjIsMDIzMTA0MjU1MzM3NTM1NDMxMzU0MjE0MDM0MC4vMTM0MTAx
MjQ1MzIwMzMxMDc3NDAxLzI1NTMzMzEvMjEwMjQvMS8zNDI1NDM1NDExMjM0Mi8sMTMxNTQ0MjAy
LzA0MzExMTEzMjIxMTMyMSwvMC4xNDIvNDU1NTM0NTQyMzQzMjUzMDA0MjM1NDExMjUzODM0NDQ1
NTMxMzUyMzM1NDMxNTo1NDAzMzU0MjUzNTUzMzIzMzUxMjUyMjQzMTIxMDQyNDQzNTM0NDIzNzc0
NTU3NTU3MTQzMjE1ODg1MDEyNDAzNzQyMDQ1OTM0NTI1NTIzMzMzMTQ3NTI1NTMxMTA1OTQzMy80
NDQ3NTUzNDc1MjMwMTI3NTc0MjU1MjAwMTM0NTU1NCwyMTA0MzU1NTU3MTU1NTU0NTQ1MjIyMjc1
MjU1MzM1MC80NTIwMTEzMTU3NTU4MjIzNTU0MzEyMDQ1MjAyNDQyMzU1NTMzNDU4NTM0NTIxNDU4
OTUzNTUzNDU0MzUxMzIyMTA0NTQzMjU3NTMzMi8xNTUzMjQzMzM1MzIzNDUyMDA0MjQ1MjQzMzUz
MjQ0ODk1NTM1MzU0NzM1NDU3NDUzMjU1NTk1MzU4NTU0NDU0MjQ0NDk3NDM1NTQyNTU4Ojk1NTQx
MDI1ODc1NDI1ODM3NTUzNTQzNTQ1NTU3NTc1NTQ0NTU1MzI1MjE1NTc1Li8yNTQ0MjUyMDQzMTc5
NTU1NTU1NTQ3MzMxNDUwMjI1NTc1NTQ1LzEzNTQ0MTU3NTA0NS8zMi8xNDU1MzI0MzM0MzQzMjQy
MjI4NTM0NTIzMjEzMzU1OTU0NTUzMjM1NDM1NTQ0NDMzMzAyNDU3Nzg1MzU1NTM1NTUzMzU1MjE1
NTU3NTIvMjQ1OTg5Nzc3NzU0NTg1MTE1NDU1NTIyNDc1MzI0NTU3NzU0NTU1NTU1MzE1NDUzNTU1
Nzc0NTU4NTQ1NzU3NTU0NzU1Mzg4OTUzNTI0NTQ3ODU3NDU4MzQ1ODs3Nzg1NDg6OTg4ODU3OTUy
NTg4OTk8ODU0NTg4NTU4ODc5NTU1NTc7PDw5OTg3Nzs0ODo5Ozo4Ojk4Ozc1Ozo1ODs7Ozo1OjU5
NzU4Nzk7OTo4NzgzODU4OzU1NTU5Nzw7OTk4PDg5Nzo7Ozk3ODo5Ozk5NTU3Nzo8OTg3NTQ3Ozk1
MzU1NzU3OTs7PDg6PTo4ODc1OTs3NDc6Ojk7Nzc4ODc1NTU6Ojc7Ozk1ODg3ODg7Ozg1Nzc5Ozw4
Ozc1ODo1NTo5ODc0Ojo6Nzk6Nzg7OTc1MzUzOjg5ODg1NTc1ODc4NTU0NTU1NDQ4NTU1NTU0NTk1
NTU1NTU4Ojg3ODg1NTc3NzU3NDc3OTgzNTIyNTQ0NzQ1NDU4NDU1ODk1ODc1NTc1NTUzNTg4OTg1
OTk3Nzc3Nzg7OTU1NzU3ODs6NTU6Nzc1OTg6Ozc1NTM5Ojs0NTs6Nzg1NTg8ODc5ODk4ODg4OTM1
Nzg5Nzg3Ojw3OTo3Ojc3NTU1NzU1Mzg3NTU1Ozk7OjUyNTc3OTU1NTc0NTg4Ozg4NzU1NDg1MzU4
NTU4NDM0NzUzNzc1ODU1NDMzNTg3MjM1NzQyNTg1NzA1NTU1Nzc0NTU0NTg3NTQ1OjUzMzU1NTU0
MzU4NTI0NDU4NTQ3NTUzNTQ1NDU1NDc3NTU3NTU1NTc1OTc3Nzg1NTIzOjk1Nzc0Nzk1NDk1NTU3
Nzg3ODU0MjU3NzU1NzU1NDQ3ODU4NzU5NzU3ODczNTc1NTUzNTU0Nzk6Pjk4NTU3NDc1MjU1NDo1
MzU3NTk5OTU1NTk3Ojs5NTg8ODQ5PDk5Nzc4OTc5OTw6NDg4Oz1AOzU5NTU4OTs7PDo6Ojg6PDs4
OTo4NTg1OTw3NTc5ODg8OTs7ODo6Ozw6Ozc7Ozo5Ojc5OTg5PTw5Ojo4NTc8Ozs8PTg5ODg6Nzk6
Nzg5PDc6ODs7Ojo4ODo1NDU5ODk6Ozg3NTo4Nzc+PTo4OTo4Ojc5NTg3OTw7ODs3NTg1ODg4ODg6
ODo4NTs9ODg6NTU4Nzk1OT04NTU4NzQxNzk5NTU1ODU4Ojg1NTU6Ozg1Ozc5NTc1Nzo5ODc4OTk8
OzU1NTg6Nzc3NDU1OTg4ODg4Ojo5NTU6NzU5ODk6ODk7ODc5ODg7QDw5Ozk5ODU7Ojw6OTw9Pj06
Ojs6Ozo8OTk8PD09OTw8Ojo7ODo7PTw7Ozk6Ozg1OTk6Pjw6Ojs8PkA8PTs5PD47Oj08Ojg9PDw9
QD44PDs4Ozw6PDs7OT47PDo6PTw8OTo+Ozs+QDs6Ojs7OTg8Ojk7Ojw6Ojw8Ozo+QD49Pj06PD46
Ozw5Oz49OTo8Pj08Ozk4NTo+Pj4+PkA8PD08Nzk6Ojo+PDw8NTk9PTw9Pjg5Ozw8PDw+PDg8PDs7
Oz49Pjs8PTs7Nzk3ODk1Ozo4Ojo5NztAOjg7PTc3ODw9OTw7Ojs9Pjo6OTk7ODo+Ozs7OTw6Pjw5
OTo8PTo5ODMzMTMwLzIzLzI0NTUxMi8yMjQzMjMxNTQ0MjEwMjIyMDExMTIxMzE1MzQ0MjAwNTU1
MjMzMzEyMTE0MzEzMy8wMzIwMDE1NS4zNTI1NDMvLzI1NzEzNDQxMjQ0MjQzMDM3NDUyMTMyNDIy
NDQ1NDEyMTEyMDM0MjIzMzAvMDE1NTMxMTAxNTExMjc0NDIyNDUzMDIxMjMxMzQzNTIwMTA0NTIv
LzAyNTU1MzIyMzQ0MzQ0MzAwMjMwMTIyMDMyMSwwMzIyMTQxMTAwMTMyMjIyNDMzMzIyMTQyMzIz
NDU1MTAxMzEyNDI1NTAyMzMvMDU3MzQ3NDAwNDMxMzU1NDIzNDE1NTUwMjIzMTUzMzAxMzUzMC8z
MC4xMjU0MjIwMjIxMTEzMzIvMzU1MjAzMC8vLjA0NDI0MzAwMi8zODIxMDEyMjM0NTI1NTAzNTQu
MjQxMzM0NzIyMjE0MjI0NDI1MTU3MjUxLy8zMTMyNDU1MzIxMTIyMzEyNDQ0NzU1MzIyMzIxMzUy
MCw0MzIzNTUxMjM3MjMzNTU1NTUzMDIwMzQ1OTMxMTAuMjMyMTQ4NzUzNDQ1NTQvNDczMzM0NTQz
NTMyMjc4NzQ1NTMyNDQ4NzI0NzQ0NTc3NTM1MzQwNDM1NDQ1NDIyLzM1MjUzNDM0NDM1NzQ0NTc0
NDUzMjQzNzQ0NDU1NDQ1MjU1MzM0NzU0NTc4NTUzNTU0MjI0MzM0NzU1NTQyMzUzMzM1NTcxLzEw
MTQzNDM0MjI1MTMyMTU0MzEsLDAzMjIvMTE0MTMzNTAwNDw5NzEyNTczMTM1MzMzMzk0NTgyNDU0
NTU1ODQwMzM1NTU3NTU1MjI3NTc1NTU3NTU1NTU5ODM1Nzk1Ojg1NzUxMzg4NTQ3NDM1ODc0NDU1
Mzg1NTU1NTU1MjAyMzMyMzg1NDIxNDM1NS8wMjU1MjI4MTMyNDQ3NTI0NTc1MzU1NDMyMjc1MzM1
NTQ1NTMwMTU1ODUwNDM1OTU1ODUzNDEzNDM1MjM1NTU1NTU5MTM0NTM1NDQyNTM1NDI1MzU1NTU1
NzQ0ODk4NTU5NTI1NTEzNTQ1Mzg5NTc6ODc1NDU4NTU3NTU1NTcwLzM1NDU3NTU1Nzc1NDQ0MjQ0
NTU3MjMzNTc1ODM0MzM0NTMyMzI1NTQyNDQ0MzM1NTI0NTQ1ODc3NTU0NTQwNDM1NzMzMTUyNzQ1
MzM1NTQyMjM1MTAzNTU5ODU3NTM3OTgyNzUwMjg5OTc1ODU1MzI1OTg5ODo6Ojg1NzQ4OTczNTg7
Ojg3ODk3NDw9PTg3NT04Nzk8Ozk6Ojk1NDU1ODk9PDg1Ozw1OTo3OTs5Nzs8PDo7Ozw+Ozs7PDg6
OTs5ODg5Ozk5Ojw8ODk5OTk5NTQ5OTU5Ojo8Oj09Ozo5OTo3Nzg8Pjk3NTU4Ojo3Nzc1NTg6PDs8
PDU5Nzg4NzU1NDU1Nzs4OTQ1NTg4MzU1NTk1NTc3NTc0ODk1NDc6ODcyNzk5OzgzMjk3NTUzNTI3
NTM1Nzo1MTU6NDM1NzU3NTU1NTg3NTU1NTg0NTM1NTM1NDU1MzQ4NDU4Nzc0NTg1MzU1Nzk6NTMz
NTc6NTQ1NTUzNzg5OTw4NTI1Nzc3OTUyNzo3NTg3Ojc5ODU5NDEzNzg5OzU3NTQ1ODk5MTM1NzU0
NTk6Nzk1Nzk8NTg5NTk8ODg5OTg3NzU1NTU5Nzw4NTQ6NTg4OTUzNzU1NTg4Ojo5NTg5NTo3Ojk0
NTo3ODw4Nzk3NTo3NzQ1MzUzMzQ0MTQzNDMyNDU1OTc6NTU1NTU1OjU0Nzc1NDQ3NTc0MTM0NTc5
NTU0NzU1NTU0Mzk3ODUzNDQ1NDEyNDM1NzU0ODg5NDQ1OjkyMzQ3NzQ4NzM0MjUzNTIzMzM1ODIv
MTU0NDU1MjI3NDU1NTU1NDc4NzU1NDU5NzM0NTQ1MzU4OTU1NzkzMjU3NDQ1OTc4NTI1NTU1NDM1
ODUzOTU3NDU3NzU4OTg7ODU3NTg5ODk3NTQxODc3OTk1NTU1NDU3Ozo1NzU1ODo5ODg5Nzc7OTc4
Ojo4NTc4OTU7ODk4Ozo4ODU7PDk4OTg5Nzc1NTU6Ozk4Ozs3Ozs9Ojg3Ozk5Nzg3Ojs7Ojk5NTU4
Nzo6Ozc3PDs8ODo6ODo1OTk3Mzg5Ojs1OTc5ODg9Ozk3OTU3Ojo7Ozs3Ojs6NDU6ODg6Ojc4PDw4
NTc4ODc5ODc3NTg7OTU1MzU6PDk7ODczNTU5Ozs6PDo6Ojg3Ozk5Ozo5Ojk4Ojs4NTs5Ojk3OjQ4
OTc4OTo7Nzc1NTc0Nzk3NTc5NzM1Nzk4NTU3NTUyNDs4OTc4ODU5OTk5ODk4ODs3NzU4Oj06NTc5
ODs5ODk5Ojs5Nzk4Nzk5OTs7Ozw6Nzk3Nzg8PTw5Nzk1Nzg4OTU0NTg6Ozs9Ozc5Ozs6OTo6PTs3
PDw9OTk5PDo9Ojk5PT48Ojo5PDo7Ojs8PT44OTpAPjo7PD49Pjs6OT08ODg3OTo6Ojw6Ojo+PDc+
Pjw8Pjo7Nzw8OTc5PTo5Pj09Pjw8OTw6PTw1NDs9Pjo8Oz07PDs9PDw5NDk4PEA7ODk9Ozs9OTg8
Pjw9ODw6PDk3Ozs8PTo9PT05PDo7PDw9PT08Ozs8PD0+PkA5Nzk9Ozo8PD45PTw9Ozw+PTw6OTw7
Pjo6PDw+PD47Ozw6PDo9Pjs8PDs9PDw6Ojs8Ozo7PTw9PDs9Nzs6Ojw6PD09Ojs+Pjs8Pj47Ojs5
PD47MzEyMjI1MzAyLjAyNTM0NTUxMjIvMTIwMzAvMTMzMTQ1NTQzMzQwMjMxMzEvMTMzMzUxLy8y
MjEzMjE1ODI0MzQ1NTMvMi4uMDIzNzMyLzAzMjMwMzQzNCwxMjIzMTU1MjMzMzMyNDU0MTE0LjE1
MDA1MzQxMzEvMTAwMzQ1NTgzLDA0NDMzMjQzMjQzMzAxLzAwMzM0NTU1MzM0Ly80NTQ0MDAwNTEz
MTIzMy8vMzUzMzIzNDMyNDU1NTM1NTUzNTIxMSwwMjAwMTEwMzEyLzExMjEyNDMyMjMyMTI0MzMy
LjIyNTUzMjIzNDUyMDIyODIyMjEvMDAzNDQyNDMvMzEyNDU1OjMyLi4xMzQ0MTQ4NTUyMzMyMjM0
NTU4NTIzMjM1NTM0MTIvMjU1NTczLzc1NDM0NTQ0MjUzNTQyMzQ1MjEzMTg4NDMyMjc3NDMyNzc4
NDMyNTQ3OTUzMDU0MzM1MTI1NTQzMTMyNTU0MzI1MjQyMC8zNTg1NTEyNDAxNTMyMzU3ODg3NDM0
MzU4NzUzMzMyMTc1NTUxNDMzNTU1NTQ0MSwxMjIzNDU0MzM1MzQ0Nzg1LzM1NDU4NTQyNTMyMzQ3
NDI1Nzc1OTgxNDczNDgzMjU1MjU1NDQ1MzQ1NTU1ODQ0NTg1ODgzNDg1MTI0MjQ0MzM3NTMxNTU0
ODIyMzQ3ODU1ODc4OTc1NTU1ODU1NTQyNTo1MTIzODc1NTUzLzM1NzUzNDc1MzMxNDU1NzUxLzU1
NTU5NzM1NzM1NTUxMTIxNDU0MzExMDM1NDQyNDExMzIyNTM1MjIzMDIyMTU1NTQyMzM1NzQ0MjI1
NDMzNDU1NTUxMjI1ODM0Nzk0NDU4NTU1NDM1NDM0MjQ1NzU1NDU1NTU1NzQyMjgzNTc0NDUyMzI1
OTc6NTU4NzU1NDUzMzU4NTUzNTIzNDc3NDI0MzM0MTI1NTQ1MjI3NDM1MjMyMzQ1MzEzNTU0NDUy
MS4xMjE0ODUvLDIzMTUzNTMzMjU1NTIyMTQzNTU0MzQzMzU0MDQ0OTc1MDE0NzMzNDk6NS4yNzUx
NDU0MjU3NTU1ODQ0MzM1ODUyMTU1NTU3NTQ3NTM1MzMzNTM0NDc4NTM1NTU0ODU1NTM6NzE1NDM1
NDU1NzU0Nzk1NTU1NDU4NzU3NDQ3NzU5ODc0Mzc1NTg1OTs4NzQ1Nzc3ODU1NTU1NzQ1OTMzNDQ1
NTk4NTQ1ODU1NTo5Nzc5ODg4Nzk5NzU3OTg1Nzo3NTc4NTg5Nzg5Nzg3Ozg5ODc5ODc1Ozg6ODw3
NTg6PD08PDw7OzU5OTk7Pj46Ojw5Ozo6PDk4OTo8Pjw5NTU6Ozs4Ozk3Nzw+Ojo6Oz49Ojg3Ozk3
NTk1OTg6Ozw8Nzs8OTo1ODw6NTc5OTU4ODk5Nzg9NzQ4OTU3Nzg4NTU6Ojg3NTQ1NTg1Nzc4NTU4
NTU0Nzc1ODg0NTU4ODU1NzU4NTU0MTk6ODc5OTg3NTc1NTg1NTc4NTU5NzUxMzU6ODc5Nzg4OTs5
NzU5NTg1NTU0NTU6OTk1NzU1Ojk6Nzk1OTc4ODc3NTk1NTU3Ozk4NTc1Ojk3ODg6ODo1Nzo4OjU4
Nzk3NTU1NTo4Nzk6NTg0MTU1Nzk7ODU1NTk5NzQ4NTMzOTU1Nz05OTg3OjU1NTk3ODk5NTk5OT05
Nzc0ODw1NTo5OTk4Nzk8Ozg3OTU3Ojo4NzQ4NTc1NTk6Ojc1NzQ1NTQ1Nzs3ODk6OTo3NTg4NzUz
OTs6NTg3OTc3NzU4ODQ7Ojk4NDg1MjU4NzQ3ODg0NTg3NDE3Nzc3NTU3OTUvMzk1NzQ4Nzc4NzU1
NDQ0NDM4NTU1ODc0NTk3NTM1NzU0NTU0Nzc1NDU1NTQ3NzQzNTQ1OTU1NTc1ODc0NDk3ODQyMDU3
NzU3ODM1NzU1NDU4NzQzNTM1NTQ3NDEyNTQ0NDU3NTc3OTU1OTo4NTU1NDc3NzU0ODg1NTc3ODU4
NDUzODc7OTU4OTU1NTU1MzQ1NTg1NTU3NTk5NTg3ODg3NTk4PDg1Ojk3Ojw6OTU4Ojg3NTg4Ojs6
NTc6Ozs+Nzo7ODc7OTg5Oz48Ojg3ODM1NzU3ODg7OTw4PD04NTo7OjU1ODo6Nzo3NTk5PDs9Ozg1
Nzc7Ozs4Ozw9Ozs6Nzk4ODk4ODo3NzU3Nzw4Nzw9Ojs7Ojk3OTk7Ozc5Oz48OTk4Ojg0NzU1OTk7
OTk4NTs3OTc1Ojg1Ozc3NDU3ODc6NTU1Nzk5Nzs5OTo5Ozk5NTU3ODc7ODc5ODc0ODU4PDU4OTk3
NTo3NTQ1OTU3NDU3ODg3NTc7OTg4OTg3ODg4Nzc3OjU4NTk8PDUzODc3ODg6Ozk5OjU4Ojk4OTk4
ODs6OjU5Ozg3NTg8NTc5Ojs6ODk8PDc6ODc8PDU5PDs6Ojk8PDw+ODo4ODo9Oz49Ozw6PD45Oj46
ODw7ODs5OT46Ozs9PTw7PD47Oz06Ojw+Oj45Ojs4PDs7Ozs+ODg4PUI6ODw+Ozw+PD47Pjs1PDs1
OTg6PD06Ojk8Pjw6Ojk8Pjo6Ojo5Ozo7Pjs7Ojc4OTs8Oz4+QDw8Nzk9PDk6Oj05Pjs4OTs7PT4+
Ojo9PD07OT49PT46Nzo8PT5AQD49Ozk6Ozs9Ozg7OTw6PT46OTxAPj49Ozk8PT08PUA9Ojk7Ojo7
Ozk1ODo6Ozw+PTw8Nzs7PDc1OTg3Ozo4ODg+Pjw6Nzg5OTk7PDw5Nzo1NTs7PDk8PUA+Ojo8Pjox
MDIzMzUxMDAxMTM0NDQyMTM1NTczMjIvNzUxMDMyMTIyMjMyNDMxMzQ3NTUyMTIyMjIzNDMyMTQz
MzQ0MzMxMjQwMzI1MzMuLjI0NTI0NTMyNzUzMjMzNDIxNTUyMzEzNTMyNDQyMTU1MzQyMCwwMjEx
MjA1NTU0MjMzNDIyNDIzMzMvMTMzMzI1NDEyMTIzMjIxNTU0MDEyMzM0MjIyMDAzMzQ1NTE1MzMx
NC4xMi8vMzc1NTQyLzEzNzczNDEyMTIzLzIxNDIyMDAwMjU1MTAxMjU3ODI0NzUxMTQ0NTM0NDAu
MDIyNDU3NDMzNzUzMzMvMDAzMjEyMTUxMjQ0LzAwMDQ1MzUxMzIzMjUzNDQ0MDI0NDU4NTQzNDMy
NDQ1NTEsMTM1NTIzMzUzNTUxNDQzMzUzNTMzMDQ1MzU5MzMxMzIxMjc0MzE0MTE1MjE0NTI0NDU1
NzIxNTU3NTMvMDI1MjM0ODU1MjAyMzQ0NDAxNTU0MjQxMDEzNTU0MzMzNTQ0MzE3MjIyODM0NTU0
Nzc0NDQ0MzQ1NTMxMjQ1NDM1NTQyMzU5ODEzNDMyMDIyMjQxMzExNTc3NTUyNDQ0NzkyMzk1Nzcy
MzczNTc1MTI1MzM0MTM1MzQ1NDMvMzg1Mjg4NzU3NTQ1NTQ6NTQ1NTU1NzUwMzEzNTc0NTQ0NTAx
MjI0MjMzNzQ3NzQyNTU3NTAxMzI1MjIzNTczNTIwLC8yNDMvMjc0MjQ0NDQ0MzU0MjMzMzU1MTQ1
NTgwNDUxMTQ0MTE0MzMyNDQxNDM1NDEzMi8xMTM1NDEzNDI1NTM0NDU1NzM1NTE3NTc1MzUyMzc0
NDk1MjU1NTI0NTI1ODc0MjU1NTc1MjI1Nzk3NzU4MzM1NTIzNTQ0NTEzNTczNTQ0NTg1MzU3NzM0
NDU1NDM1NDU3MzU4NTo5NTIyNTU0NzQ1NDMwMzMzMi80NzI1MjUzNTQzMTMxNTU0ODU0NDUzMTI4
NzUxMjg1Nzc1NzIyMjU0NzIvMjQ4Nzg1NDMzNDQzNTU0MjQ1NDUzNDQvMjM1NDIwLjM1NTQ1MjQz
MzU3NTU1NzU0NTMxNDU0NzczMjU0NTU1NTAxNDU3NTIzNDU3NTQ0NTQwNTg1MzU1NTUzNTg1NDEw
NTc1NTIyMjIyNTU0NTIzNzU1ODc1MzU1Nzo1NzUyMzQ3NTEyMzQ0NTU1NDU4OjU1NTc6NTE1NDU3
ODU3Ozg1NzU1NTIzNDU1Nzo1NzQ3NzU1ODk4PDk5OTk5NTU1NTU1NDc1Nzk6Ojg6OTg3ODU3ODg5
Ojw3ODo7Ojo3Ozg4PDk6PDk3OT04ODg5OTg4Nzg4Nzg6PTc4Ojs4NDI3Ojk5PDg8Ojw5NTs5Nzk3
NTU1ODk5Ozk1Ojo8PDg5NTU5Ozo5NTc4OTc4OTg1Nzc1NTU4Nzk5NzU5ODQ3OTk3ODk1Nzg1OTs5
PDs6NzcyNzg4ODg6NzQ4NTQ1NzQzODc1Nzo7NzU5NTk7Ozk3NzM5OTg5ODk3Oj01Nzw8NTo3Nzc1
NzU1Nzg3NTU1ODUzNzc6NzU6OTk3NTU1Ozo1Mzg5Ojk5ODg3NTQ3Ojs1NTg5ODU1OjU3ODw3NTU3
Nzk4ODg4NTMzNTQzMTc7NDQyNTc3Nzc1NTU3OTk5MzU3Ojc5NzU4Ojg3ODc1ODs6NTk4ODc1NTU1
ODc1NzU1NzU1NzQ3NzQ3OTk3Nzc1Nzw1NDg5OTU1ODc4OTs4NTU4NTU6Ojk1NzQ3Nzw4NTU3NzU1
NzU4OTs5NTU1Nzg1Mzk7Ojg1Nzk4NTM4ODU4OTg1NTQ0NDU1NDIyNDU1NDM0MTEzMzU5NTU0OTU4
NTM3NTU0MjcyNTc4NTUyMzU1MzA1OTo4NTI1Nzc4NTc4ODU7Ojo4NzU3ODU3OjMvNTc1MTUyMDMx
NDM0NDQ1NTQ3NTQyMjI4NTIxNDQ1NTc0Mzg1MzI1MS4zNzczNDQ1NTU1MjU5NTc4NTc1NzUzNDg0
ODo6OTU1OzU0NTQ1Nzg3NTU1Mjc1NDQ1NzU6NTU3OTc5OTU5Ozk6OTQ4ODg1MjU4ODg0Nzc5ODo1
NTo+OTk7ODU5Ojs5OTc6Ojk6OjU3NTU7PTw4Ojg5ODg5OTo5NTU4Ojo4OTk5Pjo7NzU5Ojg8Ojg4
Ojk0NUA+Ozc3Nzs7ODc0Nzc6PDk8NTU4NTg5Ojs5OTs5Ojk6PD07OTc4NTg3NDQ5ODo5OzU1Nzk1
Nzg4PD04OTo4NzU4Ojg1NTg4Nzg5OTc4OTo5NTs3NTc3OTk1ODU1Ozw4OTk4NTo5Ojg5PDg5Pj43
NTQ1NzU4NTs+Nzo4OTs8NTc3ODc6OzU3Ojk4OTc6OTw9Ozg3Nzg5ODc1NzU0Nzs3PDw6Ojs7ODo6
OTk5OjU1OTs7ODs3PDg6PTs8OTc3ODs5NTw7PDg4Ojw7Ojs9PDw5OTo4PDw7Ozw8PEA9ODg8Ozo7
PTs7QTk5PDs+Pjg6Oj09Pj47Oj47Oz46OT49PT0+Ozk5OTo6PUBBPjs6Ojw6PTs7ODk7PTw+PDo6
Pj46PDs7PD48Pj09Ojs+Pjw9Ozs5Nzo5Ojw7OT4+Pj47Ozo4O0A8OTo5Ozw6Ojs3NTs8PDo7QTo1
PTk7PD48Ozw7ODk6Oj46Oj06ODk1Pjo5PTw8PT07PT1APDs5PDs5NDk+Ozk4PTw+PDs9Ojk+PD4+
PTk4OTo4PDk8PDg3PD06Ojg8Pjw9Pj09Pjs7OTc5PDg5ODk9PDk7PDs7PD44PD44OTk6NzM0MzQ1
MzMxMzU0My8yLjAyMTUzLzIzNzU1MjIzNTU1MjAwMCwwMzQvMTcyMjIwMDIxMzUxMTQzNTk5NTEx
LzExMTAyMjIwMjEvNTMxNDQyLzAxMjMxLzAxNTIxMzQzMS8wMTIyMzEvMjEvNTQ3MjQ0NTMzNTQy
NTAxMS4wMzQ3NzMxNTUzMjEyMzIxMjAwNDM0MDMyLDI1MzM1MDMyMjQwMDI1NTIyNTUwMTUwMjQ1
MzI0MTEyLjIyMzM0MzUzNDA0NDEyMTAxMTIyMDIxMzQwMzc1MTExLjQ1NTMzMzAxNTIxMzc0MzEw
LjUzMTQxMjQzMjU1My4yMTIxNDA1NTg0NDQ1MTIxMzMyMzEyMjEwMzU1NzQzNTQyMTUxNTgzLzE0
LDAxMDA1NDQ0MjE4NTc3MjMyNTAyMzMzMjMxMjIxNDEwMTE1MjEyNTUzMzQ1NDc0MjAyNzUzNTAx
MzExNzUyMzM4NzUzMzI1NTM0NDQ1NTE0MDIyMDI0NTIvNTg1NDQzMjAyMjAzNTM1NTExMjE1MzQy
NDUvMTM1NzQ1NTUxMTI0NDMzMCwzNDQ0MzMzMjM1NTU1NTUzMzAzMjU0MjIwMjQzMTQ1MzIzNTU0
NDU3ODU1MjMyNDU1NDM0NzU0MTg1MzMzNTQxNDU5NDIxMzQxMzU3NTU5NTU1NTMzNTMxMTU0MzI1
MzU1MjM1NTU0MDA1NDU1NTU4NTU1ODU1NDQ0NTI0ODg1NTQzMTEyMjI1NDQ1NTI1NTQ0MywvMjQ0
MjQyMzUzMTQzNTQxLDExMTM1MjMxMjEyNDA0MTIzMjQzNDIzNTMzNTczNDQyNTU3NTU1MTMyMjMv
NDM1NTUyMTUzNzc3NDQ1MzU1MzU0Nzg1MjU0NTU1Nzk4NTM1NTMzMzMzNTczNTk4NTU5NzU1NTU1
MjQ1NTU0NTc0NDU0NTQ0MjQ1NDEyMzI1NTMyMDM0NTM0NDU1ODUzMjE0NTQ0Nzw4NzQvLzQyNzk3
NTUyMjMwMzQzNDQ1NDU0NDQ1MTQ1NTc1NTQ0MzI0NDEzMzI3NTU0NDQ0MjI0MjI1NDQ1ODU3NzI1
NS4wMTU0MzM1NTc1ODQzMjQ3NTIzNTU4NTIzNTU1NzUzMjU4NzQzNDQ1Mzc4NTIyOTo3NTA0NTUz
NDU0NTc1NTU1NDU1NTk3NTI0OTU3NzI1NDU3NTQ0MjQ1NDQ3MzQ3NTI0MzA3NTI4NDQ1NzU1NTMx
MzU1NTQ3NTQ1NDI3NDU1ODM1NzU3ODc1NzU5OjU3NTc5NTg7NTU3NTo6Ojs5Ojk6Ojo1NTU1NTUz
NTc5OD46NzQ5PDg4Oj03ODs8Ozg3OD08Ojo6Ozk6OTw6OTg6Ozo1OTU6OjU1ODo7OjU5Nzk6Ojs7
ODU8NTo6OTc3OTs6PDg1NTg6OTs9PDU4Nzs3NTg3OTg3NzQ3ODg4NTU3ODg1Nzg3NTg6ODg6NTM3
NTMzOTc6OTkzMjU1NTQ5OjU1NTg1NTc4NzQ3NTc5OTo1NTo6OTc1ODU1NTg4Nzg4Nzc7ODU6NTI3
MjM5ODo1NTc6Ojw4NzQzMjQ3ODk6Nzk1ODU1ODo1NDU3NDU1NTc5NDk3NTg5ODk1NTU0Nzk4NzUz
NDs4ODg1MzQ1NTQ4Nzo9Pjs4NTg1NTU1OTo6ODc6OTU0ODg3NTU4NTk5ODQ1Ojg3ODg3NTU3Nzc1
ODU3OTg4NTU1NTk5Nzg5Nzg1NTQ1OTk1PDc4NTk5NTg3ODk5OTk7NTU5OTk1NTs1NTk1MjU0NTU5
Nzk3NDc4OTUzNTU6NTI1ODg4ODU3OTc0NDI6Ozg1NDc3ODU0Ozc0MzU3NTU5NzczNDU3NTM1NDIy
NTI0NTcyMjM3NzM1NDMzNDMzNzk1NTQ0Nzg5ODQ1NzU1ODU1NDc1MjIzMjc1MTU1ODU1MjI1NTU4
NzU0NTU1MjI1NTMyNDc1MTI0NDU1MjI0ODU1OjU1NDMzMzQ1NDMyNTc0ODc1NDU1NDI0MjQzNTo4
Nzc3Nzk4NTU1MjU1MzU3NTc3NTk6Nzk7PTk3OTU0NTw7OTk5NTc4NTQ5NTU1NDk7NzU1Ojo4Ozc0
NTc4Nzc3Ojo5OTw1NTs5NTg1Nzc3OTo3Nzk6Nzo4ODc4Pjo4OTg7PDk6Ozo6Ozw8PDo5OTk4PTo7
Oj4+OTk9OTc6PD47ODs5ODc9OTc4NzU5PDU3Nzg4Ojo6ODk6OTU5Ojk7OTo6ODs3Nzs4OTc3NTQ3
Ojk7Ojg1Nzc6PDc1OTg4OTo6Ojs6ODczNTo5PTs6NTU1PDs6OzU1NTg4ODc1ODg5ODk5NzU4Nzc3
NDU0ODc6Ozk4Ozk3OTo5Nzk7NzU1NDg5OTg4Ojo6Ozs6OTk8OTo6OTU1Nzg6ODU1OTc4Ojg3Ozw5
NTk5PD46OTU8ODg3OD0+QTs6PDs6OTM6Ozw6Ozw7OTk3PD49PDg5Ojo4PDw+PT09Ojc5PDs5O0E+
Ozk7Ojo7ODg8PD46Ojw5PTo6Pj49Pj46Nzs9QD09NTo9Oj49OTU1PT47Ozo5Pj1AQT46PD09Oj48
PT09OTk8QDs6Ojo6OTw7Pjw5PDk7Ojk6Pj07PTw8PD49OzU4Ojc5PTw7Ojw4Ojs5PDs8Pjs7Pjo9
Pj05OTo8Ozs7PD09Ozg5Ozk1PD05ODk8OT0+OTo5ODw7PTw9Ojs8PD0+Ozg4ODpAPj49Pjg7Pjw9
Pjk8Oj0+Pjw6PD4+PD0+PT48OD08Ojk5Nz0+PD48PD48QDs6ODo8OTo+PTw+PTs7MTExMzMvLC4w
MDEwMDAvNDk1MzEwMjk1NTMyMTMzMTAuMDExNDIzNTQ0MjQxMTEwMTIzNTQwNTMzMy4wMC4uMDA0
NTUxMzMyNDA1NTIzNTU0MjEwLzEzNTUyMjMwNDcxMTMxNDMwNDIxMzQzMzAwMjQ1NzI1NDI1NTUz
MjQ0MzM0MzUxMDU1NTUyLzIyMzMzMTQ0MjQ1MjQ1NDQ0NDEwMjU0MzMwNTQ0NDQzMDMyLy8xMDU0
My4xMDEyMzIuMTE0NTMyMzQyNTMwNTAxMTAxMDIzMjIzMTAvMDI0NTUyNDQyMTAzMzM0NzIxMS8y
MDAvLi8yMywuMTIzMi8yNTI1NzUyNDQ0NDM1MzI0My8zMjExMjMzMzMzMjEyMjM0NDEyMzM0NDM1
NDM0MjAzNDUzMDU1MjAsLy8xNDQ1NSwxNDAxNDU0MTUvMDAyMDU1MjUyLzExNzczNTQ0NDMzNTMy
MjI1NTU0MjQwMTUzNDUzNDEyMjM1MjM3NDczMDEzMjc0NDU1NzQzNTMyNTM0NDU1NDMzNTQzMzI1
NTM0NDM0NDUzNDU1NTM1ODMxNTU0NTQzMjM0NDU0MjM1NTIyLzQzNTUyLi40Nzc0MzQzNzg0MjMz
NTQzMTEzMzIwMjQ0NzQ1NTk5NTUzMzQ3NTg3NTMzMTQzNTQzNDU1NTU3ODQvMzQ0NTU0NDM1NTUz
MTc3MzQzMzIyMzIwMDI1ODc3MjIxMTM0MzMyMzQzMzU0MzI3ODc1MzE3NTUzMDI1MTEzNTU0NDMy
NDU3NzM1NDU3NTU1MjI1NTUyMjUxMTIzMzQ0NTc0MTE3OzcyMTIyMTM1ODc1NTQwNTU1NTQzNDM0
NzMzMjMxNTcxMjUzNTg1ODg4NDM3NzU4ODQ0NTg1NTc1NzU3MTMyNzU1MzU4NzQ0MTU1MzU1NTEy
Nzc1NzUyNTQ7ODAxNDU1NTc1NTMwNTU1MzIyMzMvMzUzMzQzMzE1NzU1NzUzMTQ1NTUwMDM1NTMz
MTI0MjQzMjMyMjMzNDMxMjMzNDIyMzU0MTM1NTg4NzI0NTc1Nzo1NTQzNzc3OjMzNTc5OTg0NDQz
NDc1NTMxNzczNDQ3OzQ3NTg6NDUzNTE1NTU0NDEyNTUzNTc3NDcyNTw1NTEwNTc1MDM1NTU1NDU1
MzQxMDI0NDU1MTIyNzc1NDc1NDI3NTgzODg3ODIzMzM1NDQ1NTI3OTszNTU4NDQ1NzM1NDM1OTc5
NzQ5NzAvMjU3NzU1NTU1NzU7OjgyNDU5ODg1NTk3NTg5OTo3ODUzNTk4NTk5PTk4OjU3Nzc3Ojo3
PDw8PDs5ODU8OTU4PDs5OTk7Nzk6PD48Oz0+PDg6Ojo1NTc6NTg4OTk6PDw6ODc6Ojk4Nzk8ODg3
NTc1NTw7Nzg5PDs+OTU1NTc1Ojo6Nzc3OTU1ODg1NzQ1NTc3NTU1OTw5NzU5Ojc1Nzw6Mzc4OTU3
Ojk3OTU3NTU1NzM1ODk1NTU4Ojg5OTg7ODQ1Nzk1NTg5Nzg6Ojc3OTg6Nzk1Nzg7Oz04ODU5ODg5
Ojc4OTg1NTU3ODU5OTQ1ODo4OTQ6OTMzNTg6Ozc3ODc7NTc7ODc6OTU1NTg1NTc5OTU4NTU0NTk1
NTQ3OjU4OTc1Nzc4NTk1OTo1Nzk5ODU5ODU0ODc0Mzg3NDQ1NDU1ODg0NDc4Nzg1MzU4NTU3ODk3
OTU4OT04MzU1MzU4ODU1NTk8NzU0NDU8NTQ3Nzk8Ojg4Nzc1NTQ5ODU3NTQzNTo3NTU6OzU0NDg3
Nzg3ODo9OTUzODU4OTQzNzk5NDEzMDM0NDQyNTcyNDk1NTU1ODg1NDI1NDAuNzM3NTMxMzUyNDU1
NTU1NDc1Mjc6NzIyNTMzNDU0ODU0NTUyNTM0NTo3NDc3NTU0NTo3NTI1ODg1MTU4NTQ1NTU5OTQ1
NTE1NTUyNDQyMjQ0NTQ3NTQ1Nzg1NTU4NTU0MzQ6OTU1NzQ1NTU3NzQzNTk0NDQ4MjU0MjQ1NDk0
NTU1NTc0NDg1Mjc1ODQ1NTU0ODU3NTM1OTg6OTc3Nzc1NTs5NTk6OTk4NTM1ODg3ODU1ODU5Nzg3
NTg1NzU6Nzc4OTo5Nzg5Ojc0NTg0NTU5ODc1ODc3ODc5OjU7Nzc5Nzc4ODo1OTs5ODQ1ODg5Nzg7
PDs6OTU1Nz05Ojo4ODk9Ojg5Nzk6ODU1NTw8OTg3OTk7Ojo5OT05NTc6PDk4Nzo8Ojk5ODU3OTg4
NTQ5OjU1NTg4OTs1NTU0NTo6NDE3NTU3Ozo1NDU1ODo4NTc1NTU1ODk5NTU3OTU4OjQwNz05Nzo3
Nzc1NTU1NzU4NTg1OTg6OTk1NTU1NTk7PDc4Nzk6Ozg7ODg1NzU4ODU4OjU1ODo6OTg5Ozw8Pjo3
OTs5Ojk6NTU9OTg6Pjw5NTg7ODo3Ojc7OTg5Ojo6PDc4Ojs7Ojc5Ozg+Pjk6Oz07PDw6PTs9PTk6
Pj47Ozo9Pj05Nzc7PEE8Ozo5Oz5BOTo+Pjk4Nzw5Nzo4NzU5Ozk5PTs8PT48Oj47OTk+PUE7PT4+
PTs5Ojs5PT44OTo5Ojs7PT0+Ozw9PDo5ODw4PTs7Pjw8PD05OT09PTo5PD08PkBBOjk7Ojo6Ozk4
Pj09Ojs9QD08Pjs7Ojo8PTs+PTs7PDo8PTs5Oj48Ozk6Ojo5Ojg4ODk5Nzo8Pj4+QTw7ODk8Pj49
OTk7OTg6Ojs6Ozw8PTs6Ozw+ODk4Ojc3PDs5Ojs6OTs+PDw5Oz06Pj09PjswLjMxLjAuMTExMjMw
NTEwNTU1NDU1MzQxLDEzLzE0MTMxMzEyMS8uMTIuMDAyMC8xNTIwMS8uNDIxMjAvLzAxMzAuMS8x
MjAxMTIyMDIzMjIzMjEwLzIyMS4zMzIzMjMzMjI1OTUzMzIyNDUwMDU1MjQzNDczNDQ0NDMyMzMz
NzQyNDgvNTQyMi8sMTExMTMwMjAxMzM1NDUzMDAwMTUxNDMxMjQyMzQ3NDIxNDQyNzQyNDUzNDQy
NTEuNDQyLi8yMzIzMjQyMS8zMjczMzAwMjEvNDIxMTI0NDU0MzA1NDQ1NTUxMzUxMTMyNTMyMjIx
NDM0MDI1NDIzMTI0NTIxMjU1NTQ0MjE1NTEyMTEzNzU1NTc4MjQ1NDEzMTA0MjM1MzM0NDIyMjMz
MjM1ODU0MDU5OTIvLzMzNTU0NDQ0NTc1ODQyNTQxNTMvMjMvMTQ1LzM1MzIvNDU1MTM1MzM0ODUz
NDMzNDM0MjQ1MjQ0Mjg4NTAyNTc0MTM1NDI0MzQyNTMwMzIwMTQ1NTUxNTUyNTQ0MDMyMDIzMzUy
MjM3NDM0MTU0MTMzMzUzNDIwMjQ5NTMyMjI0NDQ1NTU0MjQ0MzEzMzIyNDQyMjI0NTUwNzc0ODQ0
MzczNDUyMjU0MjM0MDQzMDIvMDc3NDIsMDM1NDQ0Mzg1NTUzNzU1MTE1NTU1NTU3NTU1NDM1NzU4
NTMyMTIyNDUzNDg0NzczMzIzNzUwMzEwNDE1NzQzLzEzMzU3Ojg0NDMwMzo0NDUzMzc5NTUzMzU1
ODMwMzQyMzIxMi4yNTM1NTE0NTM1NTA0MzQzMzUzNDIxNTM3NS80NTAxNTIzNzU0ODU1MTQ0NTIy
MzM1NTQ3NTExMTQ1NDUzMjMyNTU1NzU1Nzg1NTM0OjUvNDg3NTUzMzU1NTIzMzQ1Mzc1MzQzNTU0
NDQ1NTUyNTQyMjc1NTMzMTU1NTQ1OTUxMTU0NTU0MjU3NTU3NTc1NTU1Nzk1NDQ3NTMzMTMzMjUy
NDEvMzU0MTQzMzE3NDU3NTUzMjUzNTQyNzQ0NzU0NDIwNDIyNDQyNDU3NTU0NDMxMzU1NTU0MjIx
MDExMjU4NTU0NTU0OTUzNzU1MzQyMzQ1Nzg4NzQzMDM1NTk1NTM1NTU0NTc1MTIyMjM3Ojc1NTQy
NTM4MzM0NDg1NTMxMzU5NTI1NTUyMzI0Nzc0NTc0Nzk0MzMyNTQwMjE0NzgzMjU1OTU1NTU1OTo3
NTUzNzU3NDU1ODU4Nzg6Nzg6NDU6ODo1Nzk6Ojo1NTc3NTU3OTU8PDg4ODw4OTs4ODU1NT08OTs5
Nzw7Nzc5Pj48PDs7ODs7Pjo5OTk3Ozg6NzU3Ozo1NTk5ODk6ODg3NTg5OTw5ODg7OjU1ODo5NzU1
NzU9Ozw5NTk9NzM1NTU4Nzk1NTg8ODc1NDs7OTU6ODs1OTc6Ojo4ODU3NTc4OTg4NTM4NTg1OTs1
Nzg1NDU3NzQ3NDc4MzQ4ODk3Nzc4Ojk6NzU3Mzg5Nzk6PDs7Nzc5NDc8ODc1NTg4NTs7NzU4OjU0
NTo4NTg4PDk3NzU3Ojc3NzQ1ODg1NzU4Nzc3Nzg4ODs7NDk6OTo6OTc7Ozc1OjU5Ojg1NzU3ODU0
Mzg3Nzo4NTU1Nzc5Ojg5ODU8OTk4NTM1Ozc7PDs4Nzo3Nzc3NDM3ODk5OTk4MzM0NTk5NTU1ODc4
NDU4MzQ5PDs8Ozk5NDU1NTk3ODg7ODU1NTM1Nzg3NTU1NTU1NDU0Nzg1ODQ1MjU5NDM0NTUzNzU1
OTc3NTU1NzU3Ozg0MjU3NTg1NTczMTAxNTczNTg3NTQ1OTc1Nzg3NzU1MjU1MjI0NTIzNTo3NDQ5
MjM8Ozk3ODc3NTU3NTU1ODU1NTU1NTI3NTM4NzU1ODk1NTU0MjU3NzM1NTQ3NzU1NTU3NDc1Ojo1
NTc1NDU1ODc0NTc0NTk1NTk1NTU0ODo1NzM0OTk3NDUzMjU4MzQ0NDI1OTUzNzc1Nzk3NTI1MzI0
ODo0NTM1MzI0ODc4OTk5PTg3OTU1Nzg3Nzc1Nzc4PD46Nzc1ODk1ODk5PDw5Ozg3NTg4OTc4NzQ3
ODk4NTg1ODc1NTM1Nzo1Nzs4NTg1ODo1OTc1NTc1ODc1NzlAOzk4Nzc1OTo6Ozk7NTk5NTg6ODs3
NTc6OTc3Ojo6NTczODg7OTk4NzU6NTU3Nzk6NzU4NzU5NTc5Pjw5NTc1NzkzNzo4ODU0OTo6Nzc1
Nzg5NzU5NTc3NzQ1ODc4NzM3NzU5ODU3Nzo6Nzc4Nzc3NTgzNDc6OTc4NTg4ODU1OTk6NTo4ODk1
NTU5Ozw5MzU1NTw4OTQ5Ojk4NDU5Nzc3Ojk4NTU5OT05NTM0NDk3NDU1Nzg8Ojg8Ojw6ODU1OTo7
PDw5Ojk8Ojs3OTc6PDo4OTw5OTw7PTw7OD49PDw6O0A6OTg9Ozg4OTc3Ojk6Pj45OTk9Pjw8PT07
OjxAOzs9Pj5BPj4+Ozs4ODs8Ozg6PT48PDs9PT4+Pjk9OTpCPDw+PDo1OTs6PTs5OTo8Ozs4OTs6
OT07Pj06Oz48PDk8PDo8PT07PDw3Pjw5PDw5Ozk6Nzs8PD0+Pjs8Oz0+Pjs6ODo1NTg8QEE8PT48
PDg9Pj09Pj49Pj49Pjw6Pj09OD09Nzo9Ozo4PD47PTo7PDo+PTk6OTw8OTw+PD47OTo4Ozk7PTk6
Ozk5Ojo6Pj44PDo6Nzw8OTs5OTw5Ojs7Ozw6ODs7Ozs3Nzs+Pj49PTMxLzM1MS4yMjE0MjE1NzQz
MTE0MjAuMDQ1MjAzMTI1NzQzLi8xNTU0NTQyMTEyNTMyLi4uLzA0MzEwMDMxMjAyNTQzNTUyMDAx
Ly4yMTIyMzExMS81NTU4MzQzNTUxNDI1NDM3NzUzMjIyMjEyMzU1MjA0MCwxMDEyMzEyMTIyLy8y
NDg1MjEwMjU3NTQ1MTI1NTM3MjEwMDEyMS8uMzIwMDEwMjQyMzU1NDMwMTM1NDU1MzIxMzMzMDEz
MDE1NzIzNTUyMzIxMDQ0NDIyMzM3NDAxMTE3NTMyNTk0NTIyNTE0MjMzNTQ1MzA1NTU0ODM0NDIx
MTc0NTExMjQzNDMwMTIzMjA0MjE1NTQzNTcyMzc1NTU1NDQwMTIxNTQyMTMwLzIxNTU0MTUyNTQy
MzU0MzU1MzQzNTQvMjIzMzAxNDU3MjUzMzQ3OTU1ODQ0NTU3NDQ1NTg1Mzg4ODUyMzMzNTU1NDQz
NTQ0MjMzNTUyODQyMzIzMjAuMDM5ODc0NTU1MzIxMTI0NTM3ODcyNDMyMDUzNTUyMjIzMzQzMTQ0
NDU0MTQ1MTA1NTMyMzI1NDUyMjU1ODQ1NTU1NTEwNDQ0NTUzODk1MzIxMzMyNTM1NTUyNTg1NDU3
NTc3NTc1ODc0MzQ3MTI0NTs1NDU3NTc1NDMzNzU1MzE1OTU4MzM1NzQzMjM1NTUyLzE3ODM0NTc3
NDUyMDc5MzQ3NzU1NDMzNTUxMjQ3NTMvMjM1NTU0MzIxNTU0MzIxNDU0NDU0NC80NzU1NTU4OTgz
NDc1MzU0NTQzLy8yMzM1NzQzNTU1NTIxMjU0NDQyNzUwMTEwNDc1MDEwMTM0MTMxMzQ0MTQxMzU0
NTUyNTIyMzIzMDEyMjQ3NzU0NTk1MzE0NDc0MjQ0NTA1ODU1MzI0NDQ1MjM1Nzo6NzU0NzQuMTU1
ODU1NzUzMjU0NDU3MzIzMzU4ODUzMzAxNTQ4NTU1MzU4NzMyMTE3ODUzNTgzNTIzMzMxMjI1NDM1
NTQxMzM0Nzc1NzQ3NTU0MjMyNTU0NTUzMjU1NDM1NTIwMzU5NTEyMzc1NTU4NzU3ODQ1NDIzODU1
NTQ0MzQ0NTUyNDg4Ojs0NTQ0NDczMjM6OTQ3MzU1MjMsNTUvMzQ1OTUxMTMzNzU5Ojc1MzIzMDU1
MzU1MjMzNDg1MTM0NzQ0MjM1MzM5OTU0NTU0MzU5NTIyNzgzMTMyMDc6OzU1NTU0NTU1NTc4ODc1
ODg1OD47ODc4OTU6ODU3NDU7Ozk3Ojw6Nzg1OTo4OTk4NTg8PTk5Ojw7Nzo8ODk7PTk5ODU9Ozg4
Oj03NTg4Nzg3Nzk4OTs8ODU1Nzk6PDs5Ojo6Ojo1ODg5Nzc7Ozo4Ojo6ODc7OTo1Nzk4ODg4PTs9
OTk4NTU6PDc3NTU4ODczOTo1NzU1Ozk3NDc1NDc8PTk1NTc5ODc4Nzo5Ozo1Nzc4ODo1MzU4ODU3
OTk3NTQ0NTg7Ojg5OTg5Ojg1NTQ3Nzc4NTM3ODQzNzU1OTo6ODg1NTU3NTc3Nzg1NzQ4Ojg6OTk4
Ojk5OTo5NTg3Nzc3NTQ4Ozc4NTo1MzU1NDU1NTg5NTc4OTk5ODk5ODU3NTM1Ojo3NTI1MzU6OjM1
NTc4OzcyMzc3NzU0NTU5Nzg4NzU4OTk5ODU4Ojo1NTc4Ojg0Mzk3ODc3NTg5ODg3Nzk1Nzc5Ojc1
NTU1Ozg4NTU4ODc5ODU1Nzg3Ozk5Nzg8PDk8PDU3NTQ5NTQ0NDU5NzI3NDg3NTs3NTU1NTQ0OTs3
NzM1NTQ1MzQ0NTA1NTo4ODUzNzk1NzQ1NzU1Nzk6NDIxNDI1NzU1MjQ0ODk4NzUyNTQ1MjIzMzQ4
ODU4NTQ1OTU5OTU4MzQ1NDI0NTU1MzQ1NTU1NTk1MjIzNzU0NDUzMjU1NTMzNTQzNTcxNDIzNTI1
NTUxNDU1Mzc1NzM1NzU3NDU0NTg0MzU1OTU1ODU3NTU4ODU1NTgzNTU0NTo1NTQ4OTgzNDQ4NTo1
Ojs3OTQ1ODczNDc4OjU1NTc0NDc1OTc4ODU1NDQ3Ozc5NzU1NTU1Ojw3NTc1NDc6OTk1Ozg4NTU6
Ozk5NzQ4ODU1ODk1NzQ1OjU0NTc3NDg7OTc1NTU3NTg1NDo6ODU3ODg1NDU1NDc8OzgzNzU3NTk9
Ojc6PD46NTk5NDU0NTk4OTo5ODc3OTU4ODk4NTk5NTc5ODg1Ojw4Ozo6ODg3Nzg4Nzk1NzQ1NTk+
Ojw4OTo5ODk4Ojc3PDw6NTg6NTU4ODk4ODc7NTU5NzQ4OTg6NTUwNTg1OTk3NTI0Nzk5OTk3OTk6
ODc3OTQ1ODg4NTQ1OTw5Nzs7ODk6OTU3NTU9PDg4Nzg1NTg1NTo6NTU5OTU4Nzg4ODk6PTo7PDs5
Ozk6OTo5ODk4OTw6Nzk4Nzs8Ojg7Pjo3NTo6Ozs6Oj05OTg8OTc6PDk4OTw3NTk+Pjk5PTw6Ojw4
PDk7PDo7Ozw+OzpBOzg4ODc6ODs6Pjw7Pj08Ozo6ODo+OTo3Ozo6Ojg7Pjo5PkA+Pjw6PT48PDg5
OTk9Ojk8PDw8Ozs3PTs7PDU6PT08Pjk3Oj0+Ozg1Ojg7PDs6Oz48PTw8Ozg4OTw9Oz08PTw5PT04
OjtAPTw5PDs5Ojk9PTo5Ojk5OT09Ozk4Pj46PTo3Ozg7OTk9NTg5Ozk7PTs6Oj08Ojo4PUE+OTk6
NTk5NTc8PTk4Ozk8Pjo+Ozo8PD0+Ozw8Ojk9Ozk7OTw6Oz48MjIyMzEyLzA0MzMzMzQwLzUxNDM1
MjAvLDEzNTIzMTIxMTEuMTI0NDAyMTExNDQzMjMwLzAzMTIyMjAvMTIyLy8xMzQwMjUzNDQvMzEz
Ly8vMzM3MTQ0NDAyNTM0NTEwLzAyMTU1MTEzNTIwMjE1MzQyMDQyNDQ1MzIwMzE0NDMxMTMzMjAy
NDIyLjAxMTIvMzIwMjQyMTAzNDMzNTIyMC4xMDEvLjIzNTQ1MzIzNDU3MjEyMzQyMjQyNTAxMjEz
NTIvMjIyNDQ1ODMwMzAuMTU3NzMxMSwyMjIzMjIyMjAyMDEzMjQzNTUzNDUwLDI0Li8yMzIxLjAx
MTQyMjAwNTQxMzEyMjQ1NTIvMDI1NDIzNTU1My8zNTg1MDEzNTMvMjIzNDExNDg0MDE3NDMxMTE1
NDMwMjI1NDQyNDQwMjQzMzMzMzM1NDQ1NTc1MzQ1MzUxNTc1MzUzNTQ1NTEyNTMzNDI1NTM1NTMx
MjQzMTEyNTM0MDIxMTMzMjA1MzIwMzU1NDQ0NzQzMjUyMi4wMzIxMjU3ODU1NzU0MzM0NTMxMzEy
NTU1NTIyLDA0MjU1MDI1MzU4NTU0MzIvNDU1NTc1MzU1Nzg0MjQzNDM0Mzg6OTcyMzE0NTM0NDQz
NTg1NDIyNTU3NDUyMjEwNDMyNTMzMjM3NDU4OTcxLzAwMjc6NDQzNDA0MzE1NDU0NDIyMjMzMzIx
MDEzMjU7NDQ5NzU1NTMxMzQ0NDU1MDI1NTQ0NTM1MjIxMTIxMzAxNDUzMTQ1MjQzMjIzMzI0NzI1
MzIxMjEzNDEyMTAwNDczMjUzMjI1NTEzMzI1ODMxNDU1NDIzNTEyMDEzMzAxNDIyNTc1NDM1NTQz
MTI1NDM1NTQyMTQ1MjQwLzIzMTI0NTU1MzU1NTQzMjUyMzc5NTQ1MzAxNTczNDQzNTU0NTU1NTUy
NzQ0NTU1NzQyNDA0NzUzNzc3NTUyMTIvNTI0NDMyMzQyMjg5MzQ1MzMzMjMvNTc4ODU1NTU0MjI1
NTU1NDM1NTM1NDU0NTU0NTM0NTQzNzc0MzE1NzU1ODk3NDU1NTU0NTU1NTM3OTU0NTg1NTU1NTc5
NTI1NTc3Nzg4NDg4NzQ0NDU4NTIzNDQxMjQ1NTI1NTU3NzM0NTc1NTU5OTUzNTQzNTM0NDU1NzQ0
NDc4NTU0Nzc5NTc0NDUyNTU1NTUzMzIzMjI0NDI0NDk1NTU1MzUyNTU1ODUzMzQ3NzUzMTQ0NTcz
NDU3ODU1OTg4ODg1NTg4Ojk1ODU4PDo4NTg8PDw5ODc7Ozk9PDs7PDw8PTg1MzQ0ODg3NTk5ODg6
Oz05OTQ4Ojg1Ojs5OTg3OTk7Nzk5Nzg8OTw9Ojk1OTo6Pjs1OTg5NTc5PDk4MzQ3ODc4MzU1Ozo5
ODQ0OT05NDc1OTo4Nzo5NTQ3PDo5NTIzNTM4ODczODg1Nzw6NzQ3NzU3ODc3NTQ1NTc0NTk3OTo1
Nzc1ODUzOTk0NTg6ODc4NTU5ODs4ODc5Ojo4OTk4ODg1NTg4OTc1OTo6ODQ5NTg6NTo3OTk1OTk1
Nzg3OTo4ODU1NTg3ODU7Nzk1MzI1NTc5ODk1Mzc6ODU0ODU3OTU0NDM0NzU4Ojg1NTU1MzU4NDU3
NTg3NTU3ODgzODs5ODU1NTQzNTc1OTc5ODU4OTk6NDczNTg3NzQ7PDs3NTk1NDU5NzU3Nzk3Ojc5
Ojc1MzIxNzc3MzU1NzUyNDc1NDQ1OTs1NDU5NTc7OjU1OTs5OTU1NTQ0ODU0OTc3NTc3NTM1MjQ1
MzQ3NTQ0NzQ0Nzc1NTUyNTM1Nzc1ODM1NDI4NzQzNTU1Nzg3NTU1NTMzMjQ1Nzg1NTU1NTM3NTM0
NTQ3NTQyNTU4NzU0MzU1NTU1Mzg4NDM1MjQ1NTU1NTM4ODg4MzIvNDg6NTg1NDQyMzU3MjU5NTU0
NTU1Nzg4NzM4MzQ1MzU1NDQyNTk5NTIwMjMyMDI1NzI3NzczMzU1ODk3ODc0ODg4Nzg1NTg4NDU3
ODc4Nzc3ODc1Ojc3OTU4MzU3Nzk6Ozk4OTU1Ozo4NTk5NzU5ODU3Nzk3NDU1NTU3NTc1Nzo4NTc1
NTc8ODc4NTU1NTo4NTc4NTE4NTQ1NTU5OTs6NzI6Ozk3Nzo6Ojk1NzU1OTc1NTo4NTU1NTU4Ojk5
PDo4NTI1NzU6Ozk5OTU0NTg6Nzk3NTc4ODo5Ozs7Ozs6Oz06NzU4ODk6ODo7OTg4Nzc6NTU5NTc1
Ojs9Ojo4Nzc5NTU4OTc1ODg1NTc1NzU5OTU1NTU5NzUyNDQ4NTk3Ozo5OTs5NTk3NTU1NTg3Ojs5
NTQ1NTU0Nzo5Nzc4OTk3NDU6ODg1NTU6OTU5PDU6Nzc1ODU1Ojk3NTU7Ojc4NTk3OzU3NTg7OTw6
ODU1Ozs5Ozg1Nzg4Ojw6Ozg1Ozo5Ojo8Oz04ODk3Nzo8PDo5NTU7PTk8Pjg7PDk4Ojo+PDg1OEE+
OjU8Pjs+Pjs6PDo7PTw5Ojo6Ojk8Pj0+OTg9PTk7Ozs7Ojo7Pjo6PEA6Ojw9PDw+Ozk4Ojk6OTc4
Oj47Ojk4Oj47PT1APjk4NTk7Ozs6NzU4Ojg5OTk6Pj07ODg7PT46Ojw9PD48PD46Pjw7PD07PTs5
OTs9QT06Ozo4Nzk8PDs7Ojw8PDw9Ozo8Pjs6Pjs6Ojk6PTs6Nzk4OTs+Ojc6Ozo5ODs+Ozk3PD5C
PT4+PDw6PUE+Ojw8PDk6OTo9PDs7OTs7Ozk8Pjw5NTs1LzMxMjExLzAyNTU0MDIyNTQwMC4xMDQz
MzI0MTI0MjQzMS8yMjExMjMwLzExMTQ4MDIxNTQzMzIyMC4xNTIyMzA0MjI1NDU0MTE1MS8wLjAx
My8xMjMxLzEyMTEwMjIxMTExNDAsLy80MzEwMzU1NDE0NTM0MTE1MTA0NDU0MTI1MDMyMi4zMzEy
NTQ0MjEyNDIxMzIyNDEwMjU1NDUxMC40NTAwMjQwMjMuLzIyMzUyMDM1NDAyMS8vMjIwMzAxMi8w
NTUxMDAzNDQyNDUyNDM1NDEuMzMzMTExLi4wNDMyMzcyMTMvMTA0NDU1NDIzMjA0MzEzMzMyMzIw
NDExMDExMC8xMS4wMTUxMjIvNzc1MC4vMjIxMTQ1MTIzMDMzNS4wLzEvMTQ1MDIyNTU1NzczMDQ1
NDExNDg4MzMzMzUzMjMyNDIzNDIyMTQ0NDQxMTI0MjAwLi8zNzk0NTU1MzEvMDM0MzM0MDE0MzUz
MzEzLjAyMTQyMzQzNTUzNTUzNzQ1NTI0NzU3ODU3NTI1ODMzNDU0NTU1MjE3OTk4NTI1NTU3NTU1
MTQ1My8xMjMwNDU1MjQ0MjU1MzIzMzM1ODMxMzIyMzQ1Nzc1MzMyNDczMDI4NTQ1NDIzNzg0NTM0
NDUyMDE1MTMyNDM0MDEzMzI1NDg0MjU0ODMzNTUzMjQzNTc1MzU1NTMyNTUwNTU0NTIzMzM1NTU0
NDAzMy4vMjU1NTQzNzU0NTczMzc1NTMwMTQyMTUyMDIuMTMxMzU0MjAyNDEzNTMxNDIyNzMyMzU1
NzUxNDQ0MzEyMDU1NDM0MTU3NDMyMzE1NzU1NDU0MjU0NDU1NTE0NTU1NzUyNTc1NDQ1MjM0NDUy
MTI0MTc4NTU4NzU1MzQ1NDMvNDc4Ojg1NTMzMjM1NTQ0NTIzMjQzNTEyMzQzNTU1Mjc3MjU0NTQ0
MzU0NDUzNTUvMjQ1MjA1NDAyMjExLzI1NTUzMjI1NTUzMTIyMzc1NTcyNTkyMjQ5NTAzMzU3Nzk1
MjU1NDcyMjE0NzU1NTQ1NTU0NTU1ODMzMzExODU1NDM5NDMyMjUyMDM3NTU0NDI0NTM1MzEyMjUz
MDEzMjMwMzUzMTIzMzQzNDI1MTM0MjQ4NzU1ODg4ODU1ODg1Nzc3NTU5NDQ1NTEyLzM0NDQ1NTMw
MjM0NzUzMjc1NTU0MDQ1ODUxMjM1NDU1NDQ1NTQyNDg5MzI1OTUxMzQ1NDU3NzA1OTc1Mzc1NTc3
NTI1Nzk0NTU4OTc0NzQ0NTc3NTc3Nzg3Nzk1NzU1MzU3OTk5OTo6NTU3ODo5Ojg6OTk3NTg3NDU+
Ozg5Nzs+Pjg1ODo6ODc3Ozk0NTU4Ojs+Pjw3Ojw4NTg5PDs3Oj48ODk7ODk5OTc7OjQ3Nzw5OTo4
ODg3OTo3NTU1Ojs6OjU1Nzc1OTg1NTg1OTk6NzU3ODU1NTU4Ojc3ODg7OTg8OTk3OTU0ODg4Ojc3
NTU3PDU5Nzc3ODo4Nzc3OTU7Ozk4NDM3OTk4OTU4NTo4Nzk6NTg5ODc4NTc1OTk5NTQ1NDg1Ojo3
NzQ0NzU4ODo6OTU5ODozNTk7NTU1NDQ1MTk5ODU3NDg4NTc5NTc1Ojc3PDk5OTo4Nzk8Pjs8OTc1
OTs4OTk5NTc3OzU4OTk1ODk7NzU3Oz06Ojg1Nzk4Ozs5ODQ3OTk5NDU5OTk4Ozk1NDQyODgyODU3
NTU5ODk6OTc3NTU1ODU1Nzc3NTg3NTc5Nzk5NzU5Ojg1ODc1MzU1ODk7Nzk5NzU1Nzo3NDE0NzU3
ODU0MzU3NzUzMzI1ODk1NTU1NDEyMzM1NTU4NzQ1ODUzNDU1NTU4NTQ1MzM1NzU1MzQ1ODU4MzM6
NTQ0ODg4ODUzNTQ1NTcyMjU4NDQzMjQ1Nzk1NTM1ODUyMDU1NDcyNTM4Nzc1NTQ1NTU1MzU1NTg3
NTU3NTU0NTUzNDg4NDAzOTo1NTQ0OTg3NTUxNDQ4Nzc1NDQ5NzU1ODk1NTU6OzU4ODs3OTc1NTo5
OTU0NDU1ODg3Nzc1ODU0OTU1Nzk1Nzc3NDc1NTg4Ojc1NTU1NTc1MzM3OTU1OTU1OTs1NTc5NzU8
OjUzMDM1NTc7PDg5NTU6Pjk9PDc3NTQ1NTc1NTg4OTo3NTg6OjU1NzQ3Ozk5ODg5Ojo3Nzg3OTg6
Nzk5Ojs7ODg5Ozo8NTU1Ozs+OTczNTo1Ozo4Nzk5Nzk4ODM1OT08ODc1NDQ5NTc4Nzc4Ozo3Mzc1
Nzg1NTU1OTo4NTc4ODg1NDQ1NTU3OTg0NTQ1NzczNzUzOTU3NzU1NzU0NDc5Ojg1ODo8Ozg4Nzg1
Nzg5ODk4Ozk3PDw7NTU4Nzo3Nzw7NzU6NTU3PTs6Nzg5OTo5Ojs5NTo4NTE1NTo8ODw9Nzc6PDw+
QTw+PDs6NTg4PDs+Ojc3NzU+PDs6PDo+Pj04NTk7ODo6NTo9Ozo7Pj09PDs6OTs5Ojc5Ozs5Oz07
Pjw1NTw8Oz06OD05OTk9PTo+PTc6Ojg7PTs4Ojw8Ozw7Pj08Ozk6PDs9OTg4Ozw9ODc6Oz03Nzs7
Ozw3Nzc1ODo7ODg5OTg5OTk6Ozs7OTg7OT4+PT5CPjw+PT48PTw8Pjw8O0A+PDxBQD47Ozw7PDs5
Ozs8PTk6PD48PD4+Oz05Pjo7Ojo7PTw7Nz48QT4+PkA4Ojs5ODw7Oz04Pjs1Ojs8ODw7Ozw5OT0+
Pj09Pjg6Ozw7PTw6Oj45Ozo5PTs4PTc5Ojo+OjMuNTQ1Mi8xNzMwMjQ1NTQyMjQ1MzIzMTczNDQx
MDI1MzMyMTEyMzIxMTQzNDczMjIzMzIvNDM1NTQ0MzMzODEyMTU1MjUzLzMyNTUyMjQ1NDMxMTMy
Mi80MjMwMjMvMTEyMzIxLDI1NDQzNDUxLzEwMDIyLzEyMjI0Ly8xMzU0MTMyMjI1ODU0NTM1MTM0
LzM1NzIxNTU1NTIzMTIyMDM1NTUzMTEzMzEyMTAvMzE3NS80NDM0MzIvMC8wMjIxMC8zNTQyLzAz
MzIzMS8vMzU0MzI0MDEvMDIxMDIyMS8sMzU1NDIvMTEzNTc0MjI0NTUwMDMzMzQ1NTMxMzQzMzQx
MzIxMTE0NDQwMzczMTUvMjU3NDAzNTUxNDQzMTIwNDg1MzAvNTMzMTQxNDMyMTI1MTI1NTMyMTAx
MzQwMDE1NCwvNTg7NTMyMTQyMjExNDU4NzQyNDM1NTQzMzMzNDg0NTU3NTEzNDMwMTEyMjU0Nzg1
NDMxMzcxMzU0NTU0MzU4NDU1MzQzNDUzNTU0NzczNDUyMjIxMjAxMzIxNTUvMjUxMjMxMTEwMDE1
NTc3Mzg4NTI1NTMxNDcyMjc1NTU1NTU1NTc0NDU3NDU1NTI4PTc0NTUzNTU4NTQ3Nzg0MzM0Mjk4
MzQyMzU0LzI1NTM0MzU1MzU0NDQ0MjQ1NDUzMzU1MzMzNTo0MzI1MzQxNDU3MTQzNTQzMzM1MjEz
NTU0MzIzNDQ5NzoxMzQ3NzUzNDMxLzE0MzE1NDQ1NDEwNTAyMzQzMjAzNTMyNC8vNDMyMTM1NDUw
LzQyNzU1NTg1NTg1NTU0NTE0Nzo0MzQ0NDc1Mzk1NDQxMTU0MjQ3MjIxMTEzNDk3NDQzNDU1NzE0
NzU1NTQ0NTUyNTg1MzU0MzE4NzE0OjUxMjQ1NDQ1MzI1NTQzMjMxNTc1NDAwMjIyMzQ0MSwwLjIy
MjQ1NDUyMjQzMDA1MS8wMDUyMDUzLzMxNDUyNTczMTQvMTQxMjM1NzU0MzU1MzU3NDU1NDc1MzQy
NTc1NDM3NTIzNTQ1NzI0MzUxNDc3NTU1NTM1NzU4NDI3NTU3OTc0LzQ0Nzc1MTE1Mzc6NTA0NTIz
Nzo4NDc1NDU0MDIxNTMzNTQ6NTU3NzU5MzUzNTg0Nzo5OTU1NTc1Nzk3NTc1NDk5ODk1MjU5NTI0
NTMyOjc3MzU5NzU1Ojc1NTU1NTU0MjQ1NDc5NDk6NzUyNTc4NTc1NDQ0MTQ1NDUzNDg5Ozc1ODU1
NTk3ODs3ODc1NTk1NTM0Mzo7OTgzNDg5Nzo1OTg1Ojw4ODk6ODc1NTc1OTo8Pjc1Ojs4Nzc6Nzo8
PTs7Ojs6Ojs7OjU+PUA+PDs6QD48PTo4Nzc3OTw8Nzg3NTc4ODU3NTc3Mzc4OTo3NzU4Ojs5Ozk5
OjU1Ojs7NTk5Nzc7Ojk3ODc6OTk1NTs4OTg5NTg4ODg4ODc3ODU1OTU1NzMyODk4OTk1Nzg5NTgz
Mjc4NTU5OzQyNTk3OTc6NTg4Nzg3Nzg1Nzo4NDU1NTU4ODg0NDU1ODU1Ojc1OTU4OTg6OTk1OTc1
NTU3Mjg3NTo6OTk1NzU3ODU3OTc1OTU1PDk1NTg0NTg3Nzs5NTg4Ojg6OjU1NTk4OjQ3OTg6ODg1
NTc1NTk4OTUyNTc3Ozo6MzU1NTc5ODg4ODU1OTk1NTU3NTk3Nzw4Nzg5Nzc6PTo4ODc6Ozg0NTk3
Nzo0OTU0NTU1MzQ0NzU3Nzk3OTc0NTk1NTc8Nzc5Nzc1NzU1NDQ3ODg1NTk3NTU5OjU0NDg1NDUz
Mzk5NTU0Nzc1NTU3NTU5NTg3NTMyNzg0MzU1ODc4Nzc1NTg1NDc3NzgzNDQ1NTU0NDE3NTczMzgz
NTc0NTU0NDI1NS4xNDU0NTU1MjQ0Mzo1NTo5NTIxMjEwMjU3Nzg0MjU1Nzk4MzU0NzUzODQ0NTMx
MDg6NDMwMTQ0NDM4OTU1MjU3NDU1NTc4NTM1ODk6NTE1ODU5NTU3NDg5OTw6NDU6NTczNDU1NTU4
ODgzNTg3NzMzNTc1Nzc7OzgyNTU7OTo7Ozk+Ojo5Nzg7NzU1NTg1NTU5ODU1NTw6ODk5NDI1ODg3
NzU1OTk3Nzo6PDszODo1NTg3OTk4Ozc4Ojk0Nzo8OTg0Nzs5Nzk4NTU3ODc6OTs6ODo5Nzc5NTQ3
Ojk6OTg1MTQ1NTg5PD46NTc6OTU1Ozg3OTU1Nzg1NTc5ODU4Ozw5ODU3OTg1NTc4NTo4ODU0OTk1
OTg5ODc0NTo3NTU5OTs5NTU1OTk1NTE1NzU1ODk1NDc5Nzg4NTs5NTM4ODU1Nzg0ODc3Nzc5Nzg4
NTc4Nzc4NTg3Ozo7NTU1Ojs4OTk4ODs6NTU0NTg4ODk1ODQyNzU4PDc4OTw4ODc6Ojs6Ojk4NTU8
ODs6ODk4NTU8PUE9PTo6PD09PDs8PDo4PDo5Ojw6ODk8PTo4Oj06ODw7Pj05OTw9ODs8OTk7Ozg7
OTo7PTk9PT4+OT49PDo7PDw+PT1AOjc6ODg6PTs8PTk+PT07OTo6NTs9Pj49PDo5PTg7PkA+PTw6
PD04Ozs7Ozk8OTk9PDk5PDs7PD07Ozs6Pjw3Ojw+QTs6Ozs5PDw9Ojw+PDg6Ozs4PDw+Pjw9Qj49
PT4+PTo4OTk8Ojs7OTU5PEA8Ozo6PTo4Oj46PD0+PD46O0A7OTs9NTw8PDk+Pj1APDg6Ojk4PT4+
PD48QDw7Pj09Ozo6Ojw+QDw8ODo5ODc6MzQyMjM0MywxMzAwNzExLzExMjMwLy8wMzMwMTEyMDU0
MTIvMy8zMzUxMTQ1MzExNTIwMzAzMjMzNTIyNTQzMTM1MzIxMjIyMTMyMjM0NTMwMzM0NDk1Mjcz
NTIzNTExNDQyLjMwMDQzMDEzNTU3NzIwMDM0NTQ0MzMyNDQyNTU0NTUxLDEzMjIzMy8wMTQ0Mi4x
NzMyMjUzMjIzMjM0NS8yNTMyMzI0NTMxMDEzMjIwLzEzMjAzMDQ0MzIwMzIwMS8wNDE0NTUzMDAy
MTQxMTQ0NDQ0NDU1NTQyNDMzMzU0MzM1NTQyNTU0MTE0MjQxMi8xMzMvNTQyNDQ0MDQyNTM1MzQy
NTQ1NDQxMjAwMzg0MTE1NTQxNDUzMDIyNTU0MzAzNDE0ODIxMjQ5NTA0NDM0NTUyMzU0NTkzOTQ1
NDU3NTQzNzIvMzg0NDQ1MzE0NTIyMjEzNDUwMjUyMDM0NTMyMjQxMTUzNDQ3NTc1OTMzNzcyLjA1
NzQzMzMyMzU0MjAyMzQ1NDU0MzE0Nzg1NDc1NTQyMjMyNTM4NDM1NTIxMzI1MzQ1NTI1MzMzNzQ1
MzQ1NzU4NTk3NDQ1NDU4OTUwMjUzNTM0ODczNTQ0MzQ3NTMzODs0MTM4NTc4Ozg1NzQ0NzUxMjQy
NDQzMzI0NTozNDQ4NzIyMjU3NTMzMDIyNDUyLzI0MTIzNDU1MzE3NzU0MC8yNDc1NzU1MjEyMTEz
MzQwNTI1Mzg1MjIxMzQyMjExNTQxMzU0MjEyMzM0ODcyMjIzNTU1NDAzNDMzNDEwMzQwMDE0MzUz
Mzc1NDM0MjI1NzU1Nzk4MTE0NDUzMzM1MTIvMzU0NTQ1NTQ1NDg0NDU0NDIyNTU1NTQzNTU0NTU1
NDA1NDE1ODU1NzUzNTU1NDU1NDQzMDAxMTEyNTU1NDUzMjM0NTQzMjUzNDI1NDMzODU1NTU1NTI3
NTIwNzM1NTM1Nzo1NTUyMjQ1MS8zNDI0NTMwMjQ1NDMyMjIvNTU3NDEzMjIzMzU0NDMwMjQ1MjIx
NTc1NDI0NDMyNTUxMTI0MjQ1NDQ1NDM1NTU1NDc4NTQzNTU1OTc3OTU1NTM0NDUzNzU0MTc4NTA0
Mzc3NTc1NDIxMzM0NTgzMzg1NTI0Mjc0NDQ0NTU6NTU1NTM0MzU1NTQ0NDUzNTUzNDU0NTU1NTUz
MjI1ODM1NTU1MjEyNTg3OTc1ODQzMzQ3MzM1NTUzMzU3NzUzMzU1NzU3MzQ0NTEyNTc7NTcyNDQ0
NDQ3ODkyMTQ1NzU1NTg5NTU3NDU3NTc5Nzc1ODs7Pjw6Ojk4OTk4Ozk6Ozw9OTs7OzU6OTs7PDc4
NTc7PDg3Ojo9Ojo3ODk1Mzc4Ozo4OTg4NTU1OUA+Ojo5Nzg6OTc1OTs5NTg5NTg8ODU1NTk4Ojg5
Ozs8PDc1Nzg1OTo1MzU1NzU0NDU1NzU1Ozc5Nzc3NTU6PDk7PDk4ODU0NTc8Ojs5OTU0NDU4NDQ1
NTc3Nzc1NTg4ODs4Ozg7ODo7ODU1NDg6OTs4Mzg4Nzk1NTQ3Ojc3NTU0MzU7NzQ4OTUyNTU4Nzo5
Nzo1ODg3ODQ3ODQ5NTQ1NTU1NTQ0NTs7ODo6NzU1NTU1Nzk3NzU4OTg1Mzg5NTc0NTU0NTU4ODU1
Mzo6ODQxODs6NTU1OTUyNTI1OzU1ODk3PTczMzc4NTU3OTg4NTU6Nzg5OTg1Nzc4NDk5OjczMzM1
NTc4NTU3OTk4NzU1NzM3ODc1NzU1NTQ1ODQ1NzU5ODc1MzAyNDUzODU3NTc0MzM0NTo3MzU4NTM1
NTUzNTU1MzczNDU0NzQ1NTU3Nzc1ODk5Nzg1NTU4ODU1NTczNTQ1NzU1NTQ1Mjg1NDM1NTU3NTcy
MzU4ODU1Nzs6ODw4ODU1NTg1MDE0MjM4ODU4MzU1NTc4NTU1NDg5NTU3MjI1NDM1NTg0NzUzNTc4
NzQzNzg1My40Ozc1MjQ3MzQ1NTU1NTc1NzU5OTU1NDU1NDQ1NTU6Nzk5MjQ0NDQ0ODU0Nzk7OTc3
OTo7Ozc6ODg3Nzg1MzU1Nzc1ODc1ODg5OTg3NTQ1NDQyNTo6ODU4Ojc0OTU4ODk5NDc3NTc1NDU4
NTc7OTU1NDQ1NTo7Oz07OTk6NTk3OTU1NTc4Nzg1MzU4ODg4OTg5NTU4ODc4Nzk4NzU0NDk6NTU1
ODU3Nzc3Ozk6NzU1NTU1NTk6OTg4Ojk3Nzk1OTU4NzU3ODs4ODg0NTc0Nzk4OTc3NTM1NTc3ODM1
ODMzMzU4NTU3NTo6OTg6OTQ1NDQ1MzM0Ojc3NTg6ODU4NTc3NTU0NDU0NTg1NTU1NTg6NzU1ODg5
NDc5NTU5Nzk3NDg4Ozg1Nzg1ODk4ODo3OTs6Pjs6NTc3OTs6NTg8OTs8NzU7PDk5Oj09Ozo5Ozo6
OD09ODo6PDg5OTQ1ODk8Pjw7OTw5Oz4+Ozw9Pj06PDs5Nzk7O0BBOjg4PDs4Oj49PD08Ojk7Ojs+
Pj4+OT09Ozs8PDk7Ozw6OzU3Ojs8PDw6Ojs4ODk8Ojk6PT09Oz46Ojw6QDs8ODg8Pjs8PT47OTc3
Nzg5Ozg6Ozo8PT49PT4+PD07Nzs7Ozs8PDw8PDc8Ozs7Ojo5Oz48ODk6OTo6Ojg6PT49PTw5Oz4+
Ojg6Pjk5Ozw7OTw7OTs7PD45Ojo9PTg4PT49Ozg6QT48Pjo5ODc3OTs6Pjo3PDs8ODs+OT48PTw9
OzxAPjs7OjU1ODk+Ojw+OD48Nzc0LzAuNDAzMzQ1NDQ1NzIyMjc1NDQyNTIyMjAxNDIuMDIxMDMz
MTEwMS8vLjEzMjMyMzM0NTU0NDQyMjU4NTMxLy8xMjAsMTMwMTEyMjEzLDEyNTU3NTIxLjIyNDMv
MTM0MTEyMjIxMzMxMTIyMTU1NTUyMjQvNDU3NTU1OTUxMDIzNTUyNDU1MjM0NzMwMTA1MjQ0NTA0
NzUzMzIwMTMzMTU1MC8vMDQwLzAxMTAyMzIzMTEzNDAwMTEwMjU3NTU1LzIxNTUzMTEzMjI0NTIu
LzE1MzQzMzIyNDU1NDQ1NTM3NzUzNDU1NTAxNDEwMTIyMzE0NzMwLy4vMDAxMS4yMTQzMTIxNTUy
MS8xMzAxNTMyMjQ0Mi83NzUxMDIyMy8yMjQxMjc1NDQzNTc0LzE1NzMyMzQyMzE0NTMyNTU1NDU0
NTMzNDUyMTAyMzQ1NDM1OTIwMjAwNTczNDIwLjMzMDM1NDU1NTI0MTExMjE3NDI1NzAwMjIzLzAy
MTAyNTIzNDIzMzIxNTU1NTQ0NTMyNTk0NDc1NDU4NDUyMjU0NDUzMjI0NDUzMy8vLjExMDMyMjAx
NDU1NTQ3NDUxNTUzNDExNTEyNDMzNTU3OTQ1NTU1Mjc4MzUyNTU1MzUzMjQyMzMyNDU1NDU1NTI1
MzU3NDUzMzM3NTM0NzM1MjQ1MTQ1NDM1NTAzNTQzNDc1MjU1NTUzNTM1NDQ1NzI0NTM1NTIzMTIz
NDQzMjU1NTc0Nzc3NTg1NDczNDUzNTMwMzU1MjI0NDQzNTUzNDQzMTQ1MTAzNDI1MDcwMTIyNTUy
MzEyNDUzLzIxMzQ0MjQ0MzM0NTQ1NTE0NTMxMzk1NDMxNTU1OTQ3MjA0NzU1NTQzNDQ0MzU0NDU1
NDQzODg1NTIyNDU0MTM0NzUyNDIyLzA1MjI4NDQ4NTUzMzQyMi8yMTI1NzUwNTczNDUxMzQzNDMy
MTIyNTQzMTA0Nzc1LzEyMjQ4NTU1NDQxMzUyMDU1MzMyNzc0MjM5NS8yMzQvMTMyNDQzNTQyNDE0
NTI0NDI1NTc1NTIyMjI1NTUzMzU1NzU1NTM1MjQ1NDM0NTAzNDQyMTU0MjIxMzU3MzM1NTMwMzk5
ODQyNTg4NTc1NDU1NDU0NDU0NTUxMzIyMzU1NzQ0NTM0Mzg1NDM0MjUzMzU3MzU4NTU1NDI1NzUz
NDQ0NDk0NDQ3NTg7OTgzOTg3NTMyNTU3Nzg1ODg1NDU1NTc3NTU4OTk3NTc4Ojg1OjU0NTk4NTU3
NDU0Mjc3NTg4ODg6PDc0Mjc3NTk6OTk6NTg5Nzc1ODg6PDc5PDg4NzU3ODs4Ojk5Ojg5Ojg7OjU7
Ozk4OTg5OTk7OTs6OTo7Ojo6Ojs3Ojk5Oz06OTg3ODo1OTo6Ojk4Nzg3Nzc+ODc5OTU4Nzk3NTw4
NDQ1ODg1NTc1ODczNTg3Nzg6Ozw3NTU4ODc3OTk5NTg4NTQ5ODU4PDU3OD05Nzg5NTU3OTc4OTs7
Ojo5Ojs4Ozk3OTo6OTc1OTU0Ojw1NTo3NDM3NTU1NDU1ODs7OTg1NTs7Ojo4Ozk6ODg4Nzc3OTo5
Ojc3ODo5NDQ3NTU4NTg3NTg5NTo3OTk3NDo1Nzo3NTU1NTc1ODo4ODg0Nzg1Ojg8ODc4NTU4NTQ0
Nzw3NTc1Ojg3NTk6PDw4ODc4ODg3Nzk1MjU1NzQ4ODc8Ojo4Ojs5ODU4NzU1ODU0NTc3NTU4OTU0
NTM0ODs5MzU3Nzc1NTo4OTU3NzU3Nzs6NzM1NTU1MTQyNzU3MjMzNzU1NTQ1NTk1NTU0ODg1MjU1
NDQ4NTUxODk1NTQ1NDg0NzU1NTQ4NzQyODU0MTE1NTQzNDM3NTI0NTMyNDQyNTg3NzUxMjQ1NzU1
NDQ4NDU3ODMxMjQ0NzQ1NzQ1NTc4OTkyNTQyMjUzNzU5OTUzNTg1Nzc0NTc1NTczMzc1MzQ1NDAx
Mjc3NTc4NTUzNDU1MTE0MjEzNDU1NDU1MzU3NTU1Ojk4NTQ1Ojo3Nzg3MTAxNDg1NTIyNzc0NTUy
NTg6Oj04OTg1ODo3NTQ1NTU1OTo5Mzc4NDc4Nzg1NTQ1NTg6Nzg4ODc5OTo5OTo4Ozs6Nzc3ODUy
NTU1ODo1ODo5NzU1NDo6ODg5ODU4Ojg8OTg4OTk5OTc4ODg7ODc4ODc1Nzo7NTQyNTs6Nzg6NTg4
NzU3ODU8OTg5OTU5OTg1ODQ6NzgzNTQzOTMzOTs1OTQ4OTk3NTU1NzUyMjQzNTk3NTU5NTU1Nzc3
NzU1NTU0NTQ1ODk0NTU3NTg4NDc6ODQ1MzM1OTg4ODU3ODg3NTU7Ozk4Nzg4OTo1MzQ1ODgzNDU3
NTk7OTk3NTU1NzU0NTc0NTU5ODg1NTU1Nzg6NzU1ODg5ODc4ODg4Nzc4NTU1NTg7NTg6Ojw6ODo6
Ojk9PTo6Pjs8Ozg5PT4+Ozs8ODk+PTw8Oj05Ojs1Nzo8NT5APD07Ojs7QD04Pj5BPjs8QDk5Pj1C
PkA6OT46OTs9PT0+Oz49Ojg6PDo7PDk6Ojk4Nz5AOT47PDs6PDs4PTo4Ozo8OjQ5PDo+PTo1OD05
Oz09OTk5NTc9PD08PTw7Ojw5OT5AODg6PD46Ojk5Ozs4OT49Pj5BOzo9OTg6Pj07PDw8ODw5Ojw8
PDg4Oj09Pj0+Pjs7OT49PDk6Pjo7ODw5NTs6Nzo5ODs9Ozs4OD09PDo+Ozg6ODo+Ojg8Ojo9Pj08
Ozo8Oj48PTo6Ozo6Ojk+PjU1NTM4NTIyMjQ0NDMzMjUwNTIxMjM0MjE0MTMyMTI0NDEzNTIwMS4x
MjIwMS4rMzQwMDIyMjU0MjMzMjIyMzIzMTEwMDIzNTMzLzM0NDEuLi8zMzo0MjAxMTI1NTczNTU1
LywuMjIyMzEyNDQyMi4xMjQyMjIwLzAxMDIxMjE1NDExMzIzMTQ0NDU1NDI1NTMvMjExMDMwNDI0
MzI1MC8xMDExNDEzMjAsMDMxNDIyMTIxLjEzNDEwNDIyMzAxMjI1NTExMTMwLzE1MC8wMS4wMTU1
NDEwNDQyNTU1NDI1MTQ0MjE0MzEzNTUxMzUzMTE0NDQyNDU0NTExNDQ1NDEzNDQzMjExMC8vLzIz
MjExMzQwMzExMTMvMzQyNTU0MjIzNTQzMjU1NDM0MTQ0MzAyNDU1NTUyMjQzMjU1MzIzNTUyMjU0
Mzc3MzU1NDgzNTU0NTM1NzU5ODU1MzU3NDIzNTUzNTk1MjE1NDQyNDU4NTM0MTUyNTU0NDEzNTMz
NDQ0MjQyNDU1NDg1MzIyNTo6NTUyMzUyNTg0NDU0MjMyMjE1NDM1NTgzMzU0NzU1OjU1OjMyMzQy
NTUxNDU1NDU0NTU1NTU4OTcyNTU0MTIyNDQ0NDQ0NDU1NTUxMDU4MzMzMTQ3NTc0MjQ1NTU1NTU1
NDU0Mjg3NDUzMzAyMC4wLzU0MjU0MzI0MzQ1NDQ1NDM0NzM1NTIyNDMyMTQ1OTUzNDIyMTM0NzM1
NTM0NDUzMTI0MTIzMzUyMTIxMDMzNTA0NTU1NDU0MzQzNTUzMjUyNTU1NTU1MC8uMTg3NzU0NDg1
MTI3ODM0MjE0MS8wNTU1MzI1NTUzMjMyMzAzOTUyNDg0NTg5MzM1NTU1NDg0Mjc1NTM1NTc1NDU3
NTQ3MzI0NzU0NTMzMzM1MzMzNTIzMC8zNzUzNDU1OjQxNDU1NzgzNDc1Nzk4NTU1NDQ1NDQ1NTQy
NTUxNzw0MjQ4NTQ0NzUzNDcyMTU0MjQ1NTMyNDMzMDE0NTU1NTU0ODg3NDM4NTozMjMxNTQzNTU0
NTc4NTU1NDU5NTU3NzU0NDQ0MTo1MjI0NTQ1MjM1NDU1NTU1NzU4OTUxNDU1NDUzNDc1NDQ0NzUy
NTg1NTM1NzU0OTk4MTI1ODU0ODUxNDU3ODg1NTU0NDQ1OTg6ODQzNDU0NDI1MzI1NTI0NTU1NTQ1
MzIzNzc5Ojg5NTM1NDQ0NTU0NDQxMzM4ODMzNDk3Nzo3ODUzNTM1NTg4ODUyOTc5MzE1OTg3NTU3
NTc1Nzk4NTc1NzU3ODc1OTc3Ojs5NzU3OTo6Oj49ODc9ODg5NzU4ODU4OTs7NzQ1NTk1ODw5Ozg7
Ozk5NTg5Nzk5Ojk4Ojc5ODg5OTo1NTU7OTU4ODg4Ojo1OjUzOjg1NDU0NDU4Nzg1Mzc4NTU5MzU1
OTk3OjQzMzg6NTs6NTk7ODM0NTQ3NTU4NTc4NTQ3ODk1OTo6Ojk6NzU1NTg1OTc1NDU5Nzc4Nzg4
NzQ4Nzc4ODg1OTU4ODc3ODU1NTk4NzQ1ODs3NTU3NTU7ODU4OTc1PTU1NDI1NDQzNDc1NTUzNzc5
Nzo1ODU5ODU3Ojg5QD40NDU3ODg3OTk3Ozw6Nzc1NTk7NzU1OTk1ODQ1OTg1NTU1ODo0Nz04Ojo1
Nzg+Ojc1Nzg6ODU6OTg5PDs4ODs3NTI3NTU4Ozg1ODQ1NTc1MTM3NzU1NTQ1NTI1NTU1ODg4NzQz
NTU0Nzo6Ojg1Nzg7ODUzNTQ0NDM3NDU5NTIxNDg4NTUzNDgyLzIxMzU3NDU1NTQ4NzU4NTQ0NDQ1
NDU1Mzg6NTc1MzQ4NzU1NDU3NTgzOTU4PDU3NDc1MjU3NTU3NzM1NDU3NDQ1ODU0ODU4NzU1NDQx
MjM4NTU3NTQ1NzU0NDg4ODc3NDc1NDU1ODMwNTk6NTQ1NTU3OjU1NTU1NTI1OTU1NTI0NDU1NTUy
MDIzNDU0NDM4ODgzMTQzNzozNDg1NDU3ODc1NzU0NTQ0NDQzNTc4NzQyNzUyNTo1NTc0Mzc4Nzc1
Nzg5Ozc3NTU5ODA1NDIyNDc1OTM0ODU3NTU4OTg1NTQ4Nzo6NzIwNDc7ODk4Nzk6Ojs3NDc3Ozo3
Ozo5Ozc5ODc4OTo7Nzo5OTg1Nzc4NTk0NTQ1ODk6Nzo5ODg4Ojk5NTg5Ojs6NzU4NTQ4NzU1ODo4
NTk5NzQ3Nzc0MjE3OTU5NTU5Ojg3NTQ1Ozs7NDU1OTk3NTc4NzU6OTc1NTU0NDU5OTQzNTg5NTkz
NDc1ODs1NTc1NzM1MzI1OTo6NTU1ODk4ODc1MzQ1PDg6NTk6NzQ3NTU1NzU5OjQ1NTc5NTc4ODk6
Ojk1Oz47Ozk5NDc5OTs6OTc6ODo5ODc3NTc5PDw8Ojc7ODw5NzU3Oj03ODk6Pjk1Ojs8ODk1NDg5
Ozo5OUA+PTs7NzU5PDw+Pjw4OTw6Ojw6Oz07PD05ODg4Ojk6NTg4ODo5Pjw6OkA6Ozo7Ojc4Ojk5
ODs8PDo3PUA6PDs6OTk6Nzg8Oj4+Oz0+PTw8NTk6Ojg7OD09OTo8Ozw5ODw4PD46PD47Oz09PDs4
Ojk+Pj07PD06Ozo4PTs5PD47OTk+Ojg4Ozk7Ozo+Pjs5PD09Oz45Ojs9QTw6OkBCPT08Pjs6PT4+
Pj07PDw4OT0+Pjs9PTo1OTo6Ojw6PT47Ojo7PDw8PDs4Ozs5Nzg4OTg5Ojw7Ozc1Nzw6ODk5Ozs8
Ojg4Ojk8OTs6OTo7NTQyMTExLy8vMTE1MjA1NTI1MzIxMTIyNDA0NDQvLzQyMzEvMDE0NTUzMS8v
MC4yMzIyMjAxMjQxMDIwMDExMDQ1MTMvMzIxMDExMDIyMDAvMzEzNTcwLzMvMzMzMzI0LzIxMDMx
NDMzMzQ1NTQwMDI0MTMwMzMzMDQzMzUzNTUzNDEzNDIxMjUzMTE1NDM0NTAvLzIzMS8wNDExNDQw
LzIxMDEyMTA1NTIxLy4vLy8wLC8xMTE1MzQ3NTMyMjI0MjAvMTE0NTU3MjEzNTM0MTIwMDI0MTQx
MjAyMTAwMC80NDIxMjAxMDAvMTAwMDA0NTIzMzIuMzI0MTEzMzM0MzU3MTAxMy8yMTIwNDU0MTAx
MjEwMzU3NTUzMTA3MzM3NzE0NTU3NDUzNTQyNDQ1NTQzNTI0NDIwMjIvLzM0NTAyMDE0NTUyMzIw
NTU0MTI5ODQzNDI0NTUyMjM1NTQ3MDUzMjczMTQzMjMzMDQzMzIyMTI4NTMxNTQ1NDU1MjE0NDQz
NTU0MjIyMzM1NzI1NTQzMzUyNzUyMTI5NTs1NTEwMzMzMTM0MzU0NDM1NDc3NTU0MzQ1NTUzNDQ3
NzUxNDMyODcyMzMwLzEzMTUzMjE0NDQyMTQ1NTUzMzM3NTg0MzU0MjU6ODM0Mzc1MzU3MzI1NTM0
MjU1NTU1NTQ1MzU0NzU1NTU1NTUyMzMzMi41NDQ1MTUyMzEyNTUyMTUzMzU1MzMvNTc1NTc0MTQ1
MTQ1NDU1MS8vMjI0NDIzMzAwMjMyMjExMTMzNTMxNDIyMTMxNTc6NzU6ODU0NTU4NTI0MzIxMTI0
NTU1MzU1MzUzNTU5NTU0NDU1NTQ1NTUyNTU1MTU0MzQ3NTc1MS4xMjc1NTM1MDIzNDUvMjIxNTc1
MzM0NDQ1NzQ0NTU1NDM1NTU1NTU1OTg0MzIzODUzNDQ1MzA0NTIyNTQxMTUzNTg1NTUxNTIxNTQx
NTU4ODM1MzQ0MTU1NDAzNDM0MjQ1NTQ1ODQwMjU4NDU0NTc1MDQzMzMzNDE1OC8yNTQ3NDI0NDQ1
MzMxMDMyMjQ3MzM0NTU1NTQ0Mzc6NTU4NzU1NTM1Nzc1NDU5NzMyMzU4NDU1ODg5NzQ1MzU1NTQ1
NDQ0MzU0MjUyNDc3MjU1MjQ5NTQ0Nzc3ODs1MTU4NzU3NTg1NTU4NTE0ODs5NTU3Ozo1MzEzNTs3
MzMzNTU1NTc1NTc4NDc5OTU0Nzg4MzM4NzQ4OTc1NDU1Nzo5NTM4Nzk1OTUzNzc3OTs5NTg4ODU1
NTg7OTo+Ozc3NTc4Oz09OTk4Ojw+Ojw1NTw7Ojk4OTs6OTc4OT05Ozk4NTs9Nzo6NTo9OTk6Ojc4
ODw5OTs4NTo5Nzg5OT07ODQ3Nzg7Ojs3PTw6NzU4ODU3OTU3NDI6ODU0NTk4NTU4Ojg1Ozc4Nzg6
OTU1OjQyNTc4NzU3NTc1Nzc1Nzk6NTQ6ODg5NzU4NDg3NzU1Nzk3NTU5NzMzNDU7PTk1MzA1OjU1
ODc3NTc0NTU3NTU5NDU3NTU5OTU1NDc3ODw6Nzg4NTU3NTU1OTg1NTk3NTU1Nzk7NTk3NzU3Nzo4
PDg1Nzc1ODQ1Ozk4Nzg1ODU3OTs5ODk5NDc0NTg4NzU1OTg8NTQ3Ozk5NzQ3NTc1OTg3Ozc5ODU1
NTk3ODk3ODU1NTU6Ojo5OTc5Nzc6OTc7Ozk1Mzc6OjU3Mzo1Nzg5NTU1Nzo4ODk6Ojo6Nzg0NDU3
NTQzNzU4Ojk7PDg6NTU1NTo7NTU6ODU1NDU4Nzg1NTU1NTc3NTI1NTU1NzQ1NTU1MzQ4NzM0NTU1
NzMzNTM1NTU1NTg1NTU3Ojo6OTU0ODU0NTQzNTU1MzQ3NTUyNDg1MzU1NTU1NTQyMzk1ODk1NzU3
NTU1OTk1NTQyNzg4NDQ1NTM1NTU4NDAyNTc5NTQ0ODc1Nzg1OTg4NTM0NTc1MjU1MzU1MjU1NTQ7
ODM1NTUzMzU1ODU1NDc4NTM1MC80NDIxMzU6NzQyNTU1NTU0NTc1NTc1MzU4ODU1NDg5NTc6OTc6
ODM1ODo3ODUzMzU4NTI3Ozk4ODU3NTg7PDg3Ojo5OjU0NDc4NTE1NTU1NTg1OjU1Ojg1Nzc4ODc5
Nzk4Nzk0Mjg5NzM3OTU3OT07OTo3MjU5Oz45NTg3NzU4Nzk7Ojc4ODU1Ojg0Mzc7PDw6Ojk1NzU0
MzU1ODc8NzI5Ojo5PDc1Nzc3NzUzODk3NDM5Ojg5NTg5OTo5Ozo3NTk3MzI5Ozs4Nzg3NDk5NTM1
NzQ1ODg1ODQ3NzU4OTk3ODQ4Ojk7Nzk1Nzg1ODM1OTUzNTU4ODk6ODM3OjQ5NDM1OTk1ODU1NTU1
Nzc3MjMyNTk4OTw8Nzs3NDI1NTQ1ODo3OTs5Ozo3Ojk7Nzg4Ojo7OjU1OUFAPjk5PTw3OTs8Pjw8
PT0+PT48Ojg8PTw6Nzs8Ozs9PT47PDg1O0M+Ojg6PDk7OTc8Pjs4PDo+QD48PTs7Oz08PT0+QD48
PT07Ojk+QDg7Ojo7Pjw+PD4+PD4+PD4+ODo+PTo7PT09Oj09OTk9Oz49Pj5APjk6QD48QD47PUE6
Nzs7ODg6Ozg4PDo9ODk6Ojo9Pjw6OTg3OTk+Pjw9PTw+Pjo3OkA9PTs9Pj47PTs6ODw5Pj04PT4+
Pj0+PDk9PUFAQj47OjlAPj0+ODo5Ojc7Oz4+Ojo+PTw7Oj0+Pj48OTo5OTs7Ozw+PTo7Oz1BQDw5
ODw9Pj47QD0wMTUzMDUyNDUzNzk1NDMvMTIxMjcvMDI3NTQzNS8xNDMzMTMwMTExMTIzMTIyNDQz
MDEyMDQ1Nzg4Mzc0MTM1LzQ1MDIwNTU0MzIzMzU1MjIzNDUyMjMwLzE1MzAzMjAzMjE0NTQyMzU1
NTIyNTU1NDMwMS8zMzA1NTAwMzAyMjUzMzIzNTMwMTAzMjMvMTMzNDI0MzAxMTI1NDU0NDIwMTUz
MjQ1NTUwMDIzMDMyMzAwMzUzMzA0MzIwLzAzMDEyMzU1MjQ0MzEzLzIyNTIxNTMzMS8uNDUyMTAz
NTMxNTMxMzU0MTEzNTU0NDQyMzAxLi8vLjAxMjIwMTMyLzAzMjMyMjMwMzM0Mi8xNDMzNTI0NDQz
MzIvMDM1NTcyMzU1NTIyNDU1MzI3NDQzNTQ1MDQzNTMyNDQ1MjEzMjIxMzQzNTUxMjMzNDE0MzE0
NTU1NTI1MzAyMjM4NTMyNDMyNDE0MzIzMzE0ODU1MTQ0MzAxMjU1NDk4MTQzMTM0NTU0NTU0NTQy
NTczMjE0NzgxMjU1NTMxMzExMjIzNDAzNDQ6NDI3NzUvMDQ3NDIwMDU1NTo1MjI1NzM3NTUzNTQ0
NTg1MDI1MzEzNTUzMzMzMjUzMzU3MjI3NTUzMjQzNDU3NTI1NTg1NDQ1MzI0MTQ1NDc7NS8sMjQ1
NTAwMjQ1MzMyNDQ1MjM0NDQ1NTQ4ODU0MjIzNTQ1NDQ1NTc0NTQwMzUzNTQzMzUxMTUyMjMzMjU1
MzEyNDQzMzIzLzEzMjMzMjQwNTQ1NTA4NTMyMzU5NDMzNTU0NTUzNTI3MzMzMjU1MjU0NzU1MzE3
NTU4NTMzNTU1NDQ4NzUyNTU1NDU1NTc1NTU1NTU0NDUzNDU3NTU5ODUyMzU3NTU6ODQ0NTM0ODc4
NTU0NDM1NDUyMzQ0MzU1NTQ1NDM0NDUzOTU0NDk5NzQyNDAzNTU0NTM1Nzc1NTU1NTIyNDU3NDg1
MzczMjU1Mjc5NTAvMzUzMjE3ODQzNTc1NTQ1NDU0NDM0MTQ0MDEzMjEzNTEzMzQxNDAxNTU3MzQ0
ODc0NDQ0ODg3NTQyNTUxNDQ3NTM0NTU3NTEzNzc0NTU1NDQ1NTQ0NDMyNDU3NzU1NDQ3NTI0NTUy
NTQ1NzU0NTc0NDUyMzU3NTU1NTU0NTU1NTU1NDc4NzU1Nzc1OTU1MzU1NDc3NzU3NTc1Ojg5NTcy
NDU0NDc1NDQ0NTk0NTM1OTM1Nzc1Nzg4NDU4NTg1Nzo9ODg4OTU1ODU0NTc3OTc1ODU3Nzc4Nzk1
Nzs1Mjc4NTg4NzU1NTg4Nzg3NzU4Ojc8Ojk1OTk5Nzk1Nzc1Nzg1Oz05NTk5Ozk7Ojg4Ojw3Ozs6
PTo4MjM1NTk6ODQ4OjU4OTg6OTo3Ojs4ODg6OTo4ODk3OTo5OjU5Nzs7ODc4NTg3OTg3OTU1NDU0
NTQ3Oj05NzU5ODo6OTQ1ODg3NTU3Nzo1ODc4OTo6Ojo8NzU3Nzg6Nzo5Ozs3ODU3NTc5NTk4MjU1
NTk7NTU6OTU3NTU1NzU4NTk3NDQ1ODU5NTU0Mzk3NDo4ODpBOzU1NDQ1OTQ1OTo7ODk1NzU4MzIy
NTU5Nzk5OTk1ODg1ODc4NTI4OjUzNTc3ODk6ODU1OTo6PTc4NTU0NzU1OTo5NzQ0OTo6Ojk6NDU5
ODg3OTc5NDU5NTk+OjU1MzI1Ozo1NTk5NzU1Nzo4NTQ0OTk3NTc1NTg3OTk3Nzg3MjQyMzUzNTc4
NDU7ODk3NTU5NzQ1Mzg4MzA0Ojc3Nzc1MTQ1OTo3NTU4OTU1Nzc0NTU1NTMyNTs3NDQ4OTM1Nzc3
NTM1NTM0NTU1NzM0NzU6NTU0ODc4ODU1Nzg1NTc0MzI0NTk4NTMxMzQyODc1MjU1NTU1NTg4NTI1
NzU1NDI1ODo5NTc1NTQyMzQ1NzU1Mzc0NTU1NDQ3MTIxMjQ3NDc1MDIyNTU4OjUzNTMwMzg4NTQ0
MzQ1NDQvNTc0OTU1NTI4ODUzMzU1NTU0NTUyMzE0PDc1NTc1ODc4NTU4Ojc1OTs3MzU3NTg4OTc4
NTo1MjI3ODk7ODU6ODQzOTc1NTk1OTU4Nzg4Ozg1NTc5NTU1NDk6Nzc4Ozk0NTc1NTM1OTU1ODU5
ODc1ODc4NTg4Mzg6Ozo1NTczNzg4NTU4Nzk1ODg3NTk1NTU1Ojw5ODg4Nzc4OTc5Nz06NTc4NTk3
OTU0NTc4OTo1ODo3ODg1NTg6ODs4NC85NzU1MzU3OTs3NTc6NzU1ODk4ODc4ODU5ODg1NTU1NTc6
Nzg6NTU1NTI3OTk1ODo5NTU1ODU6Ozk3ODk5ODQ3NDc6OTk1NTQ1MzI1Nzc0NDM0NTU0NTUzNDc7
NzU3Nzs1ODs5OTU3ODU5OTo7Oj08Nzc6OTk7ODc7OTg4Ozs4Ojc1OTo5ODo6NTU3OTs5OD5AOTk9
PDg4Ojw6OTk5PTc1ODs6Ozo9Ozs6PDk6Pj48Ozo9O0A7ODo7Ojs9PDs5OTs7OjU6PDo9PDo3ODs5
Ozo5PDo3Oz1APDw7Nzk6Ozs+PDs6PDg5PTw3Ojs6Oz04ODg9NTo6PD49PDs1Ozo8Ozs5PUA+PD05
PDs5OD4+NTw7Ozo7Ozo8Pjw7ODs8Oz48Ozs9ODk8Ojo6NTs7OTg5Ojk4OTpAPj46ODw+PD48Oz0+
OT4+Ozs+PDg9PDc7PDg5NTU8Pjo8QD48PD07PT06Ojs7ODo6Ozs3OTo6Ozs5ODs7PUE+Pj49OTs7
ODo9OjIyMjMzMTM0MTE0NTMxNDU1NDIxMTIvMTAxMTAwMzA0NTMxMTAwMzU1MzQ1MDQxMDEyNDAz
MzEzNDEyMy4xMjIwMjAxMzQzLzA0MzIwMDMzNTEwMjIuNDU1NTMwMDAxMDMyMjMwLi8uMzUzNTIz
NDM0MzQ1NDMxLzU0MjU3NzUzMDI0NzIwMzU4NTIzMzU1MzIwMDU1MDMzMCswMjQzMTMvMjI1NzQx
MjU1MTEyMTQyMTM0NTExLjIyLzA0NTIzMDMyMzQzLy81MTAvMzMzMC80MTIwMTAxNDIxMjIzMi4x
MDMzMzQwMTMzMjUwNDUzLzQ1MjAyMjIzMC8xMTEyMTExLy4yNDMzNTQyMTMyNDIzNTQzMTU1MzM0
NDIzMTIwMDEyNTU3NDQ1NTQ0MDIyMjM0MDIxLjMyNTU0MzAxMjU0MzI1NDEzNDE1MjI0MDE0LzQ0
MzQ0MzQ1MzIzMTUyNDU3MzI1NTk1NTUyNTU1MjQ1NTEwMjU0MDEyMzI0NTU0MzE0NTMxMjQyLzE1
NTM0NTM1NTU1MTIzNTU0NTQzNTQ1NDUwLzI1ODg0NTU1NDU1NTc3NTU0MzU1MzUzNTU3ODU0NTIz
MTM1MzU1MzUxNTc1NzU1ODQ3NTI0NzUxNTU0Mzc1NTc1NDc1NDUzNDMwMjIvMzI1NzE1NDUzNS8x
NTk4NDExMDE1OTk1NDQ1NDQwMjEzNDUvMjU0NTM1MjI1NzMxMzI1NDExNTExMTEzNTc0NDM3NTQ4
NTMzNDU1MTMyNDU3NTU1NTU3NTIxNTU1MzU1NTIwMTMzODQxMzMyMzMyNTU1MzMyNDUzMDM1NDE1
MjI1NDU0NTM3MzM1NTU5NTQzNTI0MTQ0ODU0MzM1NTQzMjMzMzIyNTU0MzM1ODQ1Ojk4NTg1ODU3
NDI0NDU1NTIzODU0NTc0NTQ3NTA0NTUyMTIzMjEzNzc1MzU1OTczMzU1MDQ0MTQzNDU0NDI0MzMz
NDU1Nzk1MTQ1MzIxLzI0NDMzNTU1MjQyNTIzMjU1NDc0NDU1NzUxMDc1MzIyMTU1NTg0ODU3NzQ0
Nzg1NTg5NTU0NTk3NTc5NTQ4NTQ1ODIzMzc3MzU0NTU0MzU1NTU1NTQ1NTU3NTUzNTI1NzM1NTgy
MjU1NTg4NDU1NTc1NDU3OTk3NDQ1NzU0NDUzMzc6ODU3OTc1MzQ1NTg3NzU4ODU1Nzg1NDU4Nzgz
MzQzMjU1NzU1Mjc4NTQ0NDQ1MzI1OTU1MjQ6NTU0NTU1NTU3PDs4Nzc1OT06ODk4Nzo4NTk5NTU4
NTc6ODg3ODc1Nzo5Ojo7Ozg4OTk5ODs7OT4+PD49Ozs7OTg1Ozo6Oj07OTw8OTk5Ozg1NTk4Nzc5
Ojw+ODg5ODc6OTs9ODg4ODo4Ojg7Nzg4NTs7OjU1ODo7OjU1NTc6NTU5NTU1OTU1NTU1NTU4ODU1
OTo3Ojc5Nzk7ODU3Ojk1Ojs1NTg1NTk4Nzk4NTs4NTc6NT07OTk4ODg5NTQ1Nzg4OTs1MzU5NTU1
NDU3ODg1Nzc3NTc5OTU1MTU4NDQ5ODg4NTg3OTg4Mzg5NzU6Mzs4OjU1OjU0OTc1ODc0ODk4NTU1
NTU0ODg4NzU4NzQ3Ojs8Ojs5OTk1Nzo4NTg5NzU1NDc5NTg6ODU5Nzo9OTo3OTs5ODU1Nzk1ODU1
NTU4Nzg1OTg1NTk4MzE4NTUyODs0NDQwNDU1MzU5OjQ1NDo6Ozk4Nzk1NDs5NDU1MzU1NTQ4NDg8
NzU1ODQ1ODg5OTQ1OTk1MzI5NTk0NTU1Mzg4ODk1NDEyNTQxNDU3NTU3NTEyMzU1NTM1ODU3MzM0
NTg1MzU3NzQ0NDEzNDU3NDg3NTU4MzI3NDI3ODc1NzM0NTM1NTM1NzUzMzc4NTczNDg1ODU1NTg4
ODo1NTczNTc3MzQzMzU1NDEyNDU1Nzc3NDU3OTg1OjUxLDI4NTU1MzI0NDI0NDU0NDU3NTk1NDU5
Nzg3MzU0Mjs5NDQ3MjM0NDI3NTU0Nzk1NTc5ODk3NTQ1NTU1NTU1NTQ1Nzk7Nzg4OTU5OTg8OTUz
NTo4Nzs5ODc4Ozg4Ojg8ODU1NTU1ODc3NTc1ODg3OTg3Nzg1Oj01Nzg5OTQ4NTU7ODU5ODU3Nzc0
NDM3ODU3OTo5NTU0ODQ3ODU5NTM0NTU5Ozo1NzU5Nzk8ODU1ODg3OTc4Ojs3NTU1NTk4Nzg3NTU7
ODc4Ozk3Nzg3NTQzNTo4Ojc3NTk3MzU1NTU5ODU5ODc4Nzo1NDk3ODU3NTc6OTo4OTU1Nzc5ODk8
Ojc0Nzg3ODs5ODQ5ODw5NTc1NDU5OTs7NDg1Ojo1Nzg4OTo4NTU1NDM1NTg3Ojk5ODU5Ozg5OTU4
Ozg5Ojc5Pjo6Ojs+Ozg1OTk5PTU1ODw6PUA7ODg3NTk6ODc7OTo4OT07OTs9Pj47Ozo6Oz06Ojo1
Ojw5NTg8Ozw7PT49PTo5Ozw+Ozg6ODhAQDw6OTo7Pjo7Pjo9ODw8PT47OTs7Oz45Nzk6Ojk7Pjw1
ODs7Ojg6Pj43ODk6Ojk4PTg6PD45Ojo+Ojk3O0A8Ozw7PDs7PDs3PDk9Pjo5Ozs6Ozo5OT0+PTo1
OTk7OTg7Ozo6PDo8Pj09Pj05OTw+Ojk7Ojo6Ozw8Ojk8PDk4PT48PDs1Oz08Ojw5Ozs+QD4+Ozs5
PD09Ojc5Ozo4OD4+Pjw8PDw8PTw8PTg1PUA8PDk5ODo7Ozs7Ojw7Ojw8Ozo5PTk9PT44Nzo7PDs+
MTAuMTI0MjcyMDIvLCwuMDAvMjAsLzEsMzM1NDM0MC4xNzUwLzIxMTIzMDAxMDIzMDIwMjMzMjEw
MS4xMDAyLzQ0NDQ1NTIxMTEwMTIyMTAyMDM1MTMxMzMzMC8xNTIzMS8wMzMyMjUzMzI1MS8wMTIw
MDI0MzU1MzQ1MjE0MzQ1NTQyMzIxMzQ1NDU1MzMyNTUwMjMyMzI3OTUzNDM0MjIxMTI0NTU1My8y
NDQ3MjEwMjQxMzU0MDI0MjUvNTQzNTMzNDEyMjEzNDIyMzU4NzUyMjQyMzIxNTIzNTQ1MzE0MTEz
MDE0ODIxMTM1NDUzMTEwMjU0MjQ1NDM0NTEsLzIwLzMyMjc1NTA0NTM3My8yMzIzNDQ1MzIwMjMz
MjUyMTQyMjIzMjU1MzIzNTEwNDQ1MzExMzEwMzQyLzI1MTExNDU1NTI0NTgzMjMzMjUzNDExMzU3
NTU0LzM0MTM0NTU3MTMzNDU1NTQ1NTE1OTU1MjUyMzU4NTQyNTMwNDEwNDU1NTQ0NDI0NTQzNDMz
MjM0MzU0NTAxLjU3MDIxMzU1NTMxNTc0MTM0MjQxMTQ1MzAxNTIxNTU3NTIzODUyNDUzNTg3NTU1
MjQwMTMzMzQ0MzQ4NDI1ODc3NzQ4Nzc1NTUyMjM1NzU1Mzc1NTU1NTUzODI0MzU3NDE1OTU1MzQw
LzI3NTU1MjQzNDQzNTI0MjEzNTUzNzQ3NDMzNzQvNDgxMzQ0NTUzMS4xMzExMjQ3NTQ1NDM1NTQ0
MjQ0MzM0NDUyMjU1NTQ1NDEyMzU0MjU0MzI1MjM0NTU1NTU3ODczNDU1MzEyMjIzNTQ4OTUzNDQ0
MTU1NTQ1NTU1NDEzMjI0NTU1MzU5ODU3Nzc3ODk3NDQzNTU4NDUxMTMyODc1NTU1NzU1Nzk3MzU3
MzU1NDU3NTU1NDU1MjUzMzcxMDI0NTM0NDc1NTU1NTE3NDU1MjM0MzM1MzQzNDQ1NTEyNTc1MzM0
NTU1ODg3NDU1NTg1MzQ1NDU0OjU1NDIxMzI0ODk3ODU0MjU1NTM5OTc1NDI0NTU1MzI0MzU1NzU1
NDQ0LzU5NDg5NDQ1MzIzNTQ3MTA0MTMxMjE1NTIyNDM3NDEyNTI1NTU1NDUyMTQ1MDA0ODU0NzQ0
NDEyMzU1NTUyNTUzNDI1NTQ0Nzg0NTU0NzMxMTcyNC8yNTk0NDM5NTk1MjMzMjU0MzQ1NzMzNDc4
NTQ3NTU3NTQxNDc1NTUzNDg3Nzo5NTQzMzc1ODk0Mzc5NTQ1NTU1NzQwNTk5ODg1OTQ4OTk3Ojk1
NDc3NTc1Nzg5Nzg6PDs8ODc5ODg4Ojs0NTU4PDg1OTQ0Nzo1NDU5OTs8Oz05PTo6OTs5Nzg7OTo3
NDc9PDc1OTU0NTU8Pjo7Nzo1NDc8OTo8Ojc1Nzo6NTU3ODk4OTU5OTU5Ojk5OTo4Ojk1NDU1Ojg1
ODk1MzU1NTk3OjU4Nzg1NTk4ODQ3NTg4OTk7NzU0ODo5NTU0Nzg7OT04ODk5OTg1ODk4Nzg4OTU3
PDs8Ozs7ODc4NzQ3Ojk0NDg6OzU1OTs5ODg5NTk5NTU1MjU6ODU5Ojo5Nzo9OTo5NTg1NTU1ODc5
ODc3NTc3Mzg3NTw1Ojo3NTU3NTU4ODg5NzU3NTc1ODU1NTo5NTU1Nzk4NTU3OTg6OTg5ODU4ODU4
OjU1NTk4NTo7OzU6Ojc0NTU5Ojk3NTgzNTc1Nzk7ODg4Ojw3NDQ3Nzg8OTg1Mzc3NTQ1NDI0Nzk1
MjIzNTcyMzM4ODU1ODU0NTczNTUzMzM0NTg6NTczNTg5MjU6NzUzODc1NTU0NTg3Nzg4ODg0NTU1
NDU3NzIyNTg6NTU1MjU0NDU4MzQ1NDI0NTUzNTk3NTc3Ojc4ODs4NTQ0NzM1NzU1Nzg1NTU3NTgx
NTQ1NTI0NzUxNTU3NTgyMTM1ODU0MjQ1NTU3Nzc3NzMzNTM0NDU3NTQyNDQ1Mjc0Mjg5NTQzNTU1
MjQ0NTE3NTU4NTQ0NTU1MzIvNTk6NTQzNDU1OTg0Mzc1NDQ3NTc1NTU3PDw3NTU4NDI1Ozk1NTU1
ODg1OTk5Ojg1NTk3MzQzODk6NTc4Nzg1NzU4ODc1NTk6OTU1Nzk4NTU3NTczNTU1NTQzNTU1OTk3
NzQ1NTU1NTc0MTU4ODo6Nzc0NzU1ODo1NDo1Ojc3OTk1NDk4NTk7Nzg6OjU3OTg3ODg7Ojc1NDQ1
OTczNTg3ODU3OTg1NzU0NTU3OTU0NTQ1ODo3Nzs4NTc4OTk3NTc4Ozs4NTo6Ozk4Ozo6Oz43Nzg4
Nzw6NzU4Nzk4ODU4NTc8OTc5Ozk3NTQ4OTU0NTs6Ojk3Ojs1MzU4PT06Nzg5Nzo8PD01NTg1NTU1
ODU3Ojw8ODc6Nzo9ODw8PDU3Ojk7Ojo3ODU3Nzo6PD04PTw6OjU5PD06Oj0+PDk6Ojg6Ozs6PD09
Ozk7PDw6Pj43OTg4Ojg+PjxAPTk5PT0+PTw5Ojk6NT48PT49Ozw7Pjw7PDo5Ojo8PTk5Ozw5PDs6
Ozw5PD08PDw+PDs8OTtAODpAPTk+PTo5OjU5PD06Ozw+Ozg5NTtAPjc4Ojs7PkA6ODs+PD0+PT46
Ojo7PD0+Pjo5OD47Ojw7PTs5PDo+PDo6ODs9PTs6Ozo7Ozw9PTk6Oz07Nzk3Ojw+Ozg7Oj08PT07
PT09Pjw1NTk8Pjs3OTo8OTc1PDs8OTw8Ojo8PTo8PTo4PD45OD49Pj4+PDw6Ozw6OUA+PD0zMi4v
MSwxNDEwMDIyMDEyMjMzNDIxMTEwMC8wLzEvMTMwMDEyMjAvLjEwLzIxMjAyMTAzMzQxMzI0NTg0
MDA0MjEzNTQyNTMxLzIyMzAyMjM0NDQxODAyNDI1NTQyMjEyMTAwMDM0MTM0MzAxNDU1NTUyNDUw
MzcvMDA1ODU0MTIxMTQyNTIzNDM0LzMzNDQuMTM0MTA0NTI1NTQ0MjAyODMsLzAyMzEzMTIwMjUz
NDAvNDU0NDIxMTQvLCwyMjIvNDQyNTUzMzQxMTAzMjU0Mi8vNDU3NTAwMzAzNTU1MzExMTIyMjUz
NTQ1NTgyMTI0NTMyMjQwLzU1MzIzMzIvMS8yNTQ0NTUxMjM0MTQzMDI0MzAxMjAwMTE0My8xMzUz
NDUzMzQzNTc0NDUwMTU1MjMyMjQzNTUzNDAzMzg1MTQyNDEyNTU1NDIzLjI4MTQ6NTEyMTIxMTEz
NTQyNDUxNTUyLjM3NzQ1NDI0NDMyNDc0NDIzMTI0MTEzMzE0MjUzMjc1MzQzNDU1NDMxMDM1NTM1
MDIwMTQzMTM1NTQyMTM1MTMzNDQzNzU0NTMyNTUyNTQyNDQ4NzQ1NS8yMzMzNDMzMzIxMjAwMzQ1
NTI1MzEyNDc1NDMxMjIyMzUyMjU1NTU0MzM3NTg0MTQyMzQ0MzQ0MjE0NTI0MzQzNTUxMzUzNDU1
NTE1MzM0NDU0MzE0OTUzNDQyNzQ3NDUzNDMyMzQyNTg0MTI0MTIzNTMzNDU1MjM1NDU1MjM0MzIy
MTAzNTUyMjAwMDM1NDU1MzQxNDU1NTQ0MzMyNDUwMTIxMC80NDM3NDU1ODQzNTU3NTU1NDU4MzM1
NTg4NzM1MzU6MzI1MjQ0NDQ4NzU4NTUzNDc4NTI0NTQ0OTk1NTE0NTUyNTU0NTU1NzMxNTkyMjM1
NTUzMjQ1NTIxMzUzNzg1MzE0ODU0NDM0NTQ1Nzk1NTczNzU3NTc1ODczODUzNTU1OTUyNTU1OjU3
NTc1MzQ3NTU1MTM0NTQzNDQ1NTQ5NTQ0MzQ0MTA0ODU1NTU1NTI1NDU1NTQ1Mzc1MzQ1ODU1Nzc1
MjQ1NTU4NTg6NTM1NTEzNTc1NTk1NTQzNDU0NDIzNTk6NTE0NTk5NDQ4NTU0NDU1MjExMzU0NTU3
NTg1NTQ5NzM3ODUxMjc5NTIzMzg1ODk1NTQ3ODUxODg0NTo1MzI0NTQ1NTUzMzQ1MjM3NTU1NTM4
NTU1NDUzNzU5OzU1NTQ1OTQ1NDc4NTU0NTU3OjU1NTU5NDQ0NTg1Nzk3ODU4NDE1NTU1NTMzNTc6
OzQ1Nzs4Ozo4Nz48Ozo6Nzc8ODs9NTc1ODo1Ojs5Nzs4OTk7ODU1ODg7Ozs7PDU3OD04OTU7PTg6
PDo6OTo6Ojw8Ojo5OTg7PDo1NDo5OTg3Nzg6ODs4NTo1OjU1ODc3OTUzMzI1NTU0OTc5NzQ3Nzg4
Ozc4ODc1ODU1NTIzNzU3NTo4Ojg4ODU3NzU0NTk5Nzg5NTg4NDU4OzQ3NDEyNTk5NTU1NTg4NzQ4
Ojs4ODg1NTc1NDQ0NTk4NTU4NTU0ODg6OTs0ODk3NzUzNTg8OTU1NTU5PD05ODg3Nzo3OTg1Nzc1
OTU8PTo1NTQ3NTU6NTU5OjU4ODg1ODg5NTU4OTk7NzU1NTU1NzU5NTk4ODs7OzQzNzo3Nzg6OTw4
NDQ3NTg1ODQ5ODk7NTU1Mjg5Ojo4OTU0Nzo5ODk1NTU1Nzc1NTU3NTU3NTE4OTU3NTQ4Ojg4MzE3
NTg4NDQzODc1NTc1NDg4NDIzNTMyNTU1NTU4ODs1NTc0Nzc0NTMyNTU0OTczMjI1ODg0MjU0NTk1
ODg0NTc1Ojs6NzQ1MzM1MzU1MzU1NTU3Nzc1NDc1NTM1NTc1NDU4NTU1NTc7ODU3Ozc0Nzw3ODUz
NTIzNTU3NTQ1OTU1OjU1Nzc4NTU1OjoyNTI1NTUxNzk3ODczNTc1NTk3MjQ0MzQ1OTg1NDg3NzU0
MzU1NDU0Nzg3NTU1NTQ3NDQ3Nzk4Nzc0MDU1NDU1NTg1NTU1NTM1Nzc1NzU0NDU4Ozg1Nzo8Ojg4
NTU0NDg5OTU1Ozg5OTc6PTw3NDU3OTk5OjwzNTc1OTw7Ojg3OjU1ODU6PDk3Nzo5Ozs3Ojg5Oz03
NTU3Nzs6PDU3OTw4OTg0NTU5OTs3Nzo3NDM4ODU1Nzk3OTUzODs4Ozg3Ojk4NTc4NzU5Ojc4OD05
NTU3Nzk3NDU3NzU3ODU1NTc1NTc4ODc5Ojs0NDU5NTQ3OzU3NTM1MjQ4NTc0NTM1OTU4ODg6Nzk5
Nzg6Nzc3ODg1NTU3NzU3NTs8Nzg4NzczNDU6NzU1OTU1PDk1ODg5Ojk5OTk1ODw3Ozo4OTo4ODk5
ODU5Pjk8Ozs6Ozs6Nzg5OTg5OT46Ozs9Oz06Ozs6OTc6ODk9ODg3Ozw4ODs+OTk3Ojk3Oj06Ozw8
Pjo5ODg6Oz48Ozo8Ozs6Ojs7Ozo5OTo5O0I8Ozw7OTo8OTU7PD0+PTo5PD08Nz09PDo8Oz49OT4+
Nzo9PD48PT08PEE+Ozs6O0A9Pjs4Oz07OTo7Oj48PTs5ODs8Ozs+PT49OTw6PDw9PDw8Nzo8Ozw+
Pj46ODc8OTg6Ojs9Oz48PUE4OTo9PkA9Ojs9Pjs9Pj07PDs7PT4+Pj5BOjo+PDs+PDs6PT47Pj48
PTs5OTs5Oz4+Ojk5Oz0+Pj04Ojo7Ozw9Pjk6Oz5BOzw8Ojo9PT4+Pj4+Pjo7Pj49PjAzNDEvMi8w
LDAyMzMxNDM1NTM1NzQzMjQxMDMzMDAvMC8uNTMyMzUzNDU0MjIzNTI1NDUwLzEuMzcyNDUzMDEx
NDEyNDQ0MzMwLzUzNTEwLzIyNDMzNDExMDM1MzU3NTQ0NTc3NzU1NTMuMTU0MzEzMzIyNTU0NTMx
NzU0MzI1NDEvLzM1NTIvMzU1MDM0NDE0MC41NTgzMTA1NDQzLzM3NTAxMTEyMjIwMC8yMzQ0NDMz
MzAxMzc4MjAvLy8wNTIwLzIzMzM0NTIzNDExNDU1NTQxMTQ0MjM1NTEwLy81NTMzLDExMTEyNDIz
MjM0MzAxMzM1NDEwMjMyMjI0OTc0MzU0MzUzMTEuMzc1Myw1NTA0MTEzMDMzMzIxMDEwMTQyMzU1
Mzc1MzQyMS8yNDQzNDUzNTM0MzQzODcyMzU1NTU1MjIzNDQ1NDMxNTQzNTUxNzEyNTU1NDU1NzU3
MTI1NTM0NDMwLjQ1NDE0NDQxNDc0MjU0MjExNDMzNTg1NDEuMDUzNTQ0NTc0NTU3NTQzMzk4My8y
MzcyLjI1MzQ0NDIwMTUyNTk1NTU6NTc1NDU1NTQ0Nzc1NDQyNTU4NTMwMzUyNzU0MzQyNDM0NTU3
NzQxMC8zMzUxNDQ1NzIyMzQvMzU3NTMyNDIzMjUzMTIxMjM1NDM3NDMxMzE1NTMvLjMzNTE1MzQ0
LzUzNDE1NDIyMS8yNDU1NTQyMTM1MzM1NTQ0MTE3NTU0NDU4NDIyODUyNS81NDU1NTc0MDAyLzQ1
MzU1MjI0NTQyMzQxMDIyMjMyNDMuMDAxMzMzMjQzNTIyMzIzNDUyMzUzNTQzNTUwMTc1NTUyMjM0
MzU1NTU1NTQ1Nzg5NDQ3ODU1OTc5Nzc3NDM0NTM0NTM1NzQ1NTU1MjI1NTU1MzM1NDU1NDU1NDQ4
NzU1MzE0ODc4NTM1MDU1NTU1Nzg1MTEwMzQ0NDc6NDQyMzUyMS8zNTU0NDc0MzUzNTU3MTQ1Nzcy
MzM1MzQ4NTc1NTQ1OTU3NTI3NTQ0ODw6NTU1NTI0NTM1NDIyNDU3NTU0NzUyNTc0MzQ0NDQyMzQ1
NTM1NTQ1ODU1NTQ1NDI1NDUzMzQyMzE1OTozNTM1NzIsMzQyMzIwNDU1NDU0NTc1MTI0MjIzNDM3
NzU0NzgzNTk1NDU0OjU1Ojg3Ojg4NTM0Nzo1NTg1MTU1OTc1ODczNTs3NTU4NTg3MzQ1NTc4OTg1
NzU3Ojo1ODo4NzQzNTs4OTs6Ojc1ODo4NDQ1ODg4NTU3ODc5NDk8OTU5OzU1OTo5Ozo1NzU4NzU4
Ozo8Ojc6ODo6PDg+OzU4Ojo6OTk1OTo6Ozw6ODc3OTc5PTo8Nzo0ODg8Ojo3NTs9Pj04OTg7OTg3
NTg5OjM4PDs4ODo4Ojo3OTs4NzU3Ojo5ODg4ODg1NDI0NTU1ODg0OzU1Ozs7PTo5ODg4ODc6Oj05
NzU3NTk3NDU7OjU1ODs3NTg4NDc5Ojo4ODc4OTU1NzU3NTg7Ozg4ODk1OTc3Nzc9OTg5NTQ4NTM0
NzU3ODg4NTg7Oj08ODg+Nzk1NTw8ODM3OTU0NTc6ODU1Nzo4ODc3NzU4Ojo4OTo3Nzg1Nzk5OjU1
ODk4NTU4OTg1ODc3NTc4Ozs0OTo5NTc1NDQ1Nzc4NTk5OTU1NzU5OTU1OTU4NTU7Ozg4OjI0NTU1
NTg4NTU5OTc1NDgzMjU4PDc0NTQ5ODcyNTU4NTc1NTU5OTQzNzU1NzMyNTo1ODg1NTU1OTs5NDU1
MzQ1NDU3NTo6ODc4OTU1NDg0MTIxMjU4Nzc1NzQ1OTk0MzU4OTU1Ozg1ODU1Nzs1NDQyMzc0NTc1
NTQxLzM1ODU4OTU0Mzc1NTc1NTc1NTQ0OTk6Ojc3MzQyNTc3Nzc3ODk1MzUzMTM0NTQ0NDQzNDU0
NTIyMzU1NTM1MzQ1NTU1NTUyMjc5NDc7ODg1NTg1NTc1NTcyNTk1ODo3Nzc5OTc0NDI4NzU0MzM0
NTU1NTg0NDU0NTU1NTM1Nzc4OTU1NzU1NTM0Nzc5ODo1Ojw3OTc3ODs4Mjc5ODU1OTc1Nzk3NTU1
Nzc3NTM1MjQ4OTo5ODU5NzU4NTU1NTU1ODc3Ojk1NTc1ODc1ODc7NTk4OTk4OTk3NzI1Nzk3NTc3
NTk4OTc4ODc4NTU4NDg4NTc6Nzc5ODc0NzU1OTk1NTc0NDU4NDU4NzU0NTc3NzU3NTw7Nzk1NTQ1
NTU4NDUyODU0NTc4ODUyNTU1NTM0ODo1NzU3Nzc5NzU4NTc4OTk1NTM1NDk7NzU1ODc4NzUyNTQ3
ODc3OzU0ODg1Ozo4ODU3OTc4NTU1NDU3NTQ3NTs5Ojw4ODc3NTU7ODk6Ojc1NTg5Ozc3OTc6NTU4
Nzs4NTc4ODQ6Ojo4NTk6OTg6Oz4+Ozw4Ozg3Ojw+ODg7PTo6Nzw6Ojo8ODc1ODs5Ozk8Oz45Ozg8
Ojo8Oz0+Ozo5ODg9OT1BPT07PkA5Pj5COjs5Ozw8Pjw5ODw9Pjo4NTk8Oz4+PT4+Oz06Ojs+Oz0+
Pj08PDs7PT1APj4+Pj44Nzk8PT48Pjo9PTw4Ozw8QT04PD4+Pjs8Pjw5Oj0+PD47Ojs6Ojo8Ojs7
OTo4Nzs9PDs+Ozo8Ozs9PTw5Ojo6Ojw5PT07PkE8Pjw+OTw9Pjw6Ojs7Pjs7PTk6Pj47PDw9Pjo+
QDw9PDo8PkI8OD48Pjw+QD4+Oj4+Oz0+Qjk7PT47Ojs+PDg9QT05Oz06Ojs8MCwvMjU0NDEwNDIu
MDQ0MDIxNDExNDEwNDIzMC8zNDA3NzUyMi8yMzMxMzMvMTQvMjI0NDQ1NDUxMC8xMTMxNDMzMTU0
MC4uKzIzMzEvMjIyMTM0NDMyNTMzMzIzMjU1MzU3MzIwMjQ1NDU1MDIwMTQ1NDQyNTUzNDc1Liww
LzM1NzQwMTI0MjEwMTAzMTAzLjIwMzAvMDM0MjE1NDMuLzEyMjAvMTIxMjIxNTU0MzQwNTU1NTUz
MDI1NTA1NTU0MTI0NDQ1NDM1MzU6OTUzMzIxNDkyMDIxNy8vNTIyMjAyMjQ0NDEwMTI0NTU1NTU3
NDMxNTU0NTMyNDAuNDUzMjU0MzM0MzQzNTQ0MjU0Mi4wNTg0MzI1MTIxMzc5MzQzMjUzMS40MzEy
MzU3MjI1NDMzNDU0NTE0MjMwMjMzNDU0MjEzMjMxMjQ4NTI1NTMwMjU1MTMzMjI1NTIyNDAzNDEz
NTQ1MzU0MzU3MjM1NTQyMjU1ODc1NTAxNDMyMjQyNTU1NDU1OzUvMDIwMjUzNDQxNTQ0MzU5OzUz
MTI0NDQ0NTMyMjM3NTQ3Mzc1NTIyMzQ1NTIyMjU1NDU0NDU1MzM4OzUzMjQ1NTU4NzU1NTs4NDM0
NTU1ODU1MzIwNTQ5NzM0NDI1NTUzNTU0NDUyMjEwNTk1NTQyNTMyODcwMjgzMzg4NzU0NTk1NTI0
NTU3MzA1NTIyMzU1NTUxMTMxMTUwLjU1MzMxMzU1NTM1NTAsMDI0MzM0MTQ1NDIyMDIzMzE0MzE1
NDQxNDQ1ODQxMjU3MjI4NTU1MjE0NTA0MjQzNTQ1NTA0MzMyMzM0NTU1NDMzNDAxMjM1NDI1NTg3
MjQzNTQ1NTc3ODU4OTU0MzU4NTQ1NDU1NzU1Nzg3NTU5NTU0MTU7ODU0NDU0MjI0NTU1MjQ0NDUy
NTg1MzMzNDU0OTg3MjU1NDIyNTU0NTU1NDE1NzU0NTU0MzQyMjI1NTU1NTg4NDU3NTM0MjU3NTU1
MjU1MzQ1NDMzNDU3NDMyNTQzMzU1MzQzNDM3OTQzNDU3ODI0MzU0NTI5ODg3NDQ1NDQ3OTU1NTQ1
NDU3NDU0NTU3NTM1NDIzNTcxMDMzMzMyMDUzMjM1NDQ1MTA1NzczNDc5ODUzMzM1NTM0MTI4ODc0
MjI4NzUwNDU0NTk1MTg1NTUxNDc0MjQ1NTM3MzU0NTU1ODU1NTQyMzQzNTU5ODQ1MzI1NTk0NDc1
NDUwNTU4Nzg6NzU5NTc3ODg1NTc1Nzc8Ozk5OTo7Ozo5Nz03OTs7Ojg5NTc6OTs6OTo7Ozg4NTs+
Ozo7Ozg5PDg3Oz48Pj44ODg6OTU8PD4+PDg0PDw6Ojs3ODk9Pj06Ozo4OTk3ODM4OTk5Nzk5PDk9
OTU7PTk3OTg5NTU6Ojk0Ojw4Ozc4NDM5ODg4Ojo8OTk1Nzc0ODc1MjQ4ODU4ODUxODc3OTk6NTQ4
NTU4PDk6NTU3OTc8OTU3ODU5OzU3OTU6NTQ5ODc3Nzk4ODk6OTQ1NDo5Ojw7NzU1NTU3ODU1NTc5
NTQ3NTo4NTU1NTg6Ojo4OTU4NTU3NTU1ODg1NDU5ODM0NTU3OjU1NDM0Nzw4NTU1NTc4NTU4Ozc1
NTQ6ODIxNDk1Nzc1Nzc3OTc1NTk6Ozg6OjU1Ozs6NTIzNzU8Nzg1NDU9Ozc4MzU3OUI5NTg1OTg3
Nzg3OTo6NTc3Nzc3NTU1Ojc1NTg4Nzg1NTMyNTg1ODg1NTc4NzU5NzU1NTUzMzgyNDUyMjMzNTg3
NDU5OTQ3ODc1MzQzNDQ0Mzs4NTU1NTc4MzQ1ODU0Mjc0NzU1NTUzNDU1NTQ1Mzk4NDQzMTEzMjU1
ODs3Nzc1Mzc1OTQ0NzQ1NTc1NTc1NDU0MjQ1NTQ0OTgyMjUzNTc4NzU4OjUyNzc5NzIyMzQ1NDU1
NTc1ODc1NTMyMjI0NDg3NTk1ODU1NDc1NzU3ODQzMzQ0Ojg1NTU4ODc1NTc1NTQzNDk3Nzk3NTU0
MzQ1ODg5ODUyNTc3NzU1MjU1NTQ0NTo6OjMzNTc3Mzc6MzU0NTI3OTczNTo3NTk0NTU5Ojg5Nzc4
NTUyNDg1Nzk3ODc5ODU3ODc3Nzg1NDc5Nzc5Ozg4Nzc3NTU3ODo1OTg0NTo4NTczNDc5NTQ3NTk5
Nzk5MjU5Nzc0NTo6NzQ1Nzo5NTU1ODU4NTQ3NTU3NTk1NTc7NTI5NDc5NzU1ODg5Ojc1Nzg0NzU0
Nzk3Mzk4Nzc1NTU1ODg5ODk1NzQ1Ojg1MzM1NzQxNDg6OTUxMjU4ODc1ODc3OTU1ODQ0NDQyOzs4
NTM1Nzk4Ojg5NDM4OTc4NzM1Ojg1ODU0NTc3Ozo1MTQ1Nzk6ODo6Ozk4NDU0NTo4NTU6ODs3ODg1
OTk4NDk3NTc3OTc7Ojs3OTo6Pjo3NTg8OTc6PDk4NTc8Ozw7Oj08OTo9Ozo3Ozw9PT09PDg3ODc+
Pjs7Ojo8PD4+QDo8PkE7NTo7PD07PT06OTs7PDo4PTo6Pj49Pjw9Pj06Ozw9Pjo5Ozs+Ozs8PDs4
ODw+Ozw+PDs9OTc6OT09Oz4+PDs4Oj1AQDg3Pjk8PDo9Pjs5PT4+PTw5PDs8Pj49Ozc5OTs7PTs3
Oz45OTg4Pj4+ODo9Pjo8Ozo7Ozk6Pjo8PDk9PTo8PT06Nzs4Ozw9OTo+Ozg5ODs9PTs3Oj46Nzo7
PDs6Ojo5Ojw+Pj07Ojo+Pjs8Oz47Oz03ODo8PDk5Oz47PTs6Ojo8ODkxNDIvMTU0NDMyMTQxMjM0
NDIzMSwvMTEwMzMyMDUyNDQvLzIzMTAyMzAzNTIyMTAwMTIyMDI0MDEyMzMyMTQ1MjQ0NzM1MjI1
NTMzMTQ1MzUzMi4yMDUyMjIxMDM0NTM1NDIxMzMsLjAzMDIyNzQyNTAzMDM1MjEwLzE0NTEwNTQ0
NDIzMzEzNDE0NC40OTUwMDAxLzU1Mi8vMzI0MzMxNDMxMjI0NDU0MzU1Mzc1MjAwMzEyNDQwNDEw
MDEwNTUxMjQ1NTQxMzIxMjUyLzMxMjIwMjI0MjEyLzE0MDI0MzIuMS8yMzQzNC4sNDUzMzM1NzMz
NTUzMzIyMS8zMjUyMzI1NDM0MjM1MzU1NTUyMjM1Nzc1MzM0NTU0NTQuMjA0NTQzMjIxMCwwMjc0
MTM1MzQ1NzMyNDUzNTUzOTQyMzUyMzMyNDM1NzU0Mjc7MTI1MTM0MzM1NDMzLzQzMTMzNTU3NzI0
NTE3NDQzNTQ3NDIxMDQ1NTU6NzQ1LzEzODg1NTU1NDE0NDMxMzExMTM1NTIyMjMxMTAzNTUzMjcz
MTI1MjQzNTQ1NDQwMDQ0MzMzNDQ1MzIxMzMxNDIwNTU6OjU0Mzg3NTQ0NDU1NTU1NDM3NTg4NTU1
NzUzMzo4NTM0MjU4NTcyNTU1Nzc3ODU1NTU3NTQyNTUzMjEyMjE1NDUzNDQ0MTMzMTAxMzIzNDc1
NzUxMzU0NTIxMjU1NS8uMzIvMjQ0NTcyMDE1NTU0MzQ0NTQ0NDQ1NTg1NTUzMzI1NTMzMzQzNTc1
MzM0MjI4NTUzNDQ1NDQ1Nzc1MTI0NzQ3MzMzNDU0LzQ0MjU1NTQxMzM1ODgyMjM1NTU3NTU1MTU0
MjAzNTQ1MzIzMjAxMzQ5ODU1MzU5Nzg1NTU1MzQ1NDQ1NTM1Mi80NDMzMzc0NDg1MjIzNDQzMzUz
NDU0MzU1NTUxMjQwMjI0MzMxNDQxMTM0NTE1NDEzMjIyNTExNDMxMzc4NDIyNTMzNTQ1NDM1NTMw
MzIxMzEyODgyMzc5NTI0MTUzNDU0NDUyNDU3NTQ0NTM1NTU0NTk1MDAzNTU1MTU1NDMzNDU1MjQz
NDQzODc1NTQyNTU1NzU0MjU0MzMyNDg1NzU1MzIzMzE0NDMwNTg0NTs5ODQ1NTgyMzM1OTczOjc1
NTc0NTUxODc1NDU3MzI1NTUwMzUzMTUzNDQ1ODc5ODU0MjU1NDU4Nzc3NTQ1Nzc5NTMyMDc4NDU1
NTU1NTUyNDU1NTU1NTQ3NTU1NDU5ODc1ODM1ODg4NzU1NTg4ODU3OTc4NzQ1ODc1Ojw3Nzo9ODQ4
PDk3Nzo5ODc6Ozc3OTc1NTk1ODk5Ojk6OTo6Ojo7Ozo3NDo3NTg6Nzg1NTU6PDo3ODs5NDU6ODc4
ODU3NTk3Ojs4OTs8OTo5PDo1MzU1NTo5OTk1NDg4NTU3Nzc3NTc4ODUzNDQyNDM0OTgyODs4Ozo5
Ojg4ODU0NTc5OTc4NTU1OTk4Ozo3Ojs4NTo3OT1APjU4ODo5NTk5Nzc4Ojk5Nzg6ODk1OTc4NDU1
NTg6ODQ3NzU3ODk5Ojg0NTQ0NTc3ODg4Nzc1NTU5Ojk5OTg6ODc1OTc0NTM1Nzg4OTU1NTU1Nzg4
PDk0ODg3Mzg6Nzc6Ozk6Nzc6Ozc4NTczMzk1NTQ1NTQ4ODc1NzQ1ODg6Ozk1NTc3NzU4OTk1NTc4
NTc1NTg0NzU1NzU3NzozMzU1NDUyNTQ4NTU3NTUyNTU1Nzg3MzI1MDM1ODU0NTQ3ODg1NDU4ODg1
NDUzNTk4Nzk4OTg6OTUyNDg5NzU3MzU3NTg3MzU0NTQ1NTUzNTU1NzU0NTc3Nzk0Mjc6Ozo3MDU3
OjUzMjQ3NzU3Ozk3NDc1NTg1NTQ3NTg3OTg0ODs1NTU0NTQ1NTU3Nzg3MjU5ODU3MzU0NTU0Nzc0
MzQ0MjM1NTc1NDQzNTU1NTQ1NTQzNTo4MzQzNTg1NTc1NDc6NTU1ODc1NzU6OjU1NTM0ODc1ODU1
NDQ1NzU1NDU4Mjc1NzM0Mzg6ODg6OTUzOjk4Ojo8OTg1NDc1ODM0NzU3OjU0NTo5Ojs3Ojk5NDc1
ODk3ODg1NTc4NTU6ODU1OTc1NTc3PDg3Nzo6Nzc1Nzg5NDs8Ojg3NTc6Ojk3ODk1Ojk1Ojk5OjU0
NTo4NTU5ODU1NTU3Ojg3NTU6PDw8ODk6OjgzNDc3ODU1NTM1NTU4Nzo6Nzc1Nzs6Nzg3NTU1NDM0
NTUyNTMzNTU1Ojk3NDU1Nzg1NTc5OTM0NTQ1OTc1MjQ0Nzo1ODg1MTM3OTc1NDM0NzU4NTQ1MjU1
NTU6Ojk4NDU1NTk7NzU4NzU1Mzg6OTc1NzU6NTU1Nzg4NTw6NTU5Nzo8PTo5OTo7Ozc5PDk4ODk8
PDc6Ozk6ODo7PDk6PD47PDk3PT41OTo8Pjw5Ojs7Nzs6Ozs9QD06Nzo7Oj4+OzU1PUA+PTs3Nzo5
PTs6Ozs4Oj48Ozg7PT01Ozw7PD44OTs4Nz46NTg7PD49Pj06Ojo4Nzo+PDs7Pj4+Pjk4PD48PD08
ODk6OT5APj4+Ozo6Oz04OTo8Ozs8OTw9NTk6Oz05NTk6ODk+OTo5PT46OTw8Ojc8PDs9Pjs4Pj45
ODw7Pjs8Pj05PT08PD09PD09PDo8PDo+Ozc7ODU8Ozs7Ozw6ODk7PTo8PkA8Ojc6Ojk8Ojs9PDs+
Ozo9Ozs7Pj47Ojo+PTs8PjxAPj07Ozw9Pjk6Pj49PTw8PT46ODEzLy4vMDAyMzAuMzQzMTQyMDQ0
MTM0MTQyMTQ0My4wLzMxLi4yMzEwMzIwMTMxMTcyMDI1MjQxNTIyMjQwMjU0MzMzMjQzMzUzLzMx
MTM0NTU1LzEwMzUwMjMzMDEzMzUzMC8vMDIyNTMxMjQzMTQzMjQ0MjIwMjExMjIxMzQyNTQ0NzIz
MTQ0NzMxMTE0MjEyMjM0MjIyMTI1MTQ1NDEwNTA1ODI1NTQ1NTUyMzQyMjU0NTExMi8zMzI1ODcz
Mi8vMTM0MDU1MjI0MDMyMDAyNTQ1MzQ0NTg1MzM0NDMyMjIxMTM1MjM1MTU1NDQzNTExMzI0Mzc1
NTEyMjUwMTQ1ODQxMzI1NDQ1NTUxMjIyLjIzMjU4NDU0NzM1ODQyMjQ1NDQ0MTEzMjEzNDUyNTU3
NDMzNTc1NTM1NTU5ODUyMjQ3NTQ1NzU1NTUyMzc4NTM0NzU0MjM1NTE3NzIxNTUyNDgyMjU1NDk3
MzQ1MzIyNDQ0NTU1MzI0MzQ1NDQ0MzQzMzQzNTIzMzUyMTM0MzM1NzU4NzMyNDQ3NTk1NzczNTc4
NTU3NTQ1ODUzNTk1NTQ1ODMwMjU1NTczNDU3MzQyNTU4NTQ3NTUvLzM1NTU0Nzo3NTU3NDIzMjE0
NDQ1NTQ0MjU1NDQ1ODUzNzUwMTU5NDc4NzU3NzUzNTUzNTQ1NTM1NTc1NDMzMzM0MzQ1NTQyMzU1
NTc1MzU3ODQzMDQ0MjIyNTU1MjI0MzM0NDo3MzMzNTg3MzAyMTQ0MjA1NTg0MzI1NDEzNTM1ODUy
MzU1NDIzMS8yNDEzMzMyMjUyNDM3ODA3OjU0MzQzNTU4NDI0MjE1MjM3NDU0Nzc1NTc3ODU1OTo3
NDg0NzU1MjU5NTU0MzU3MjQ1NDQyNDMwMzMzMjE1NTU3NDg4NTU3NTM0ODg4NDI0MTI1NzM1Nzoz
MzU1NTc5NTI0MjI3NTQzMTE1MzQ0NDM5ODUyMzQ0NDQ0NzQxMTM0NTgzNTUyNTQwMTUxMjIxMTA5
NDM0NzQ1NTU1NTE1NTczMDc3NTM0NTc7OzI0MzE0NTU1NTQ1OTk0NTI1NDUzNDk3NzU0NDI1MzQz
LzQzMzQ0NTQ1NTQ4NDU1NDM0NTUzNDc3NDMzNDUzMjIyMS8zMzI1NTU6NTM1NTc4MzQ4NTU0NDUz
MzQ1NDc1NDU0NTQ1NTUzMzU0NTM1NDM1NTg1NTQ4Nzk0NTQ1NTMxNTU5NzczMDI7ODIxNTg1NTM1
OTU1Ozg1NTU1NzE6ODU4NTU1NzUzNzU4ODc1Nzk1NDs5NTs0Mzc4ODc0NDQ5OTg1ODs7Ojk4NTQ4
ODU3OTo7ODU3ODo5Ojs5Ozc3Nzc1OTo3Ojw6OTk1Ojs6OTk5Nzg6Ojk3ODg3ODk1OTg1Ozw+PDk1
Mzc5ODo8NTU6PTw5ODs6PDo4Nzk4OTc1NTc1NTg7PTk6Nzc5ODk5OTo5Nzg5NDg4NDM3NTc6ODU6
Ozo4NzQ0Nzk7PDk8NTo1NTs4ODg4NDk9Ozo0NTU7NzM1NDc5Ojc5OjUzNTU3OTw5NTU0NTo4NTc6
Pjw6NTQ1NTU1NTc3Nzc4Ojc1ODg3NTU1OTk7Ojc1NTc5Ojc1NTk4OTk3NzM1NTc5Ojc1NTU3Ozs4
Nzg1OTc6OTg4NzQ0Mzg0NTU0NTk5Ojc0NTU4PTk4Nzg3Nzc4Nzo5ODU6NTU1Mjg5NTc5Nzc6Ozc3
NzU4Ojk3NDc0NTk1ODg4ODc1NTU7OjU1NzU1NTc1NzU1NTU1ODUyNTU1Nzg3NTUyNTU1MzI1NTU3
NzU1NDcyNTQ1NTU3OTU3Ojc4NTU1NTE1ODU1NDU1ODczNTgzMzM1ODc1NTU1Nzk1NTU3NTU1NTU1
NzgzMTQ1NDM3NzU6NTc4NTM5ODUyNzk1ODU1NDU1NzU3Nzc1ODM0NTg5NzQzNTc1NDM3NTQ1Nzc3
MzM3ODU0NTU4ODc3NDEzNzgzNTM1NDE0Nzc3NTQ1NTQzNDQxNDQ0NDQ0Mzg5NTUzNTU1NTU1NzU4
NTU1NTQzNzU5OTc1NDo0Nzs7Ozc4ODg0Ojg4Mzc5OTo4NzU3ODQ3ODg1Ojc1NTk1NTU7ODU3NTo5
NTc3Nzk4NTI1ODU0OTk8OTU4ODI3ODU3Nzg3NDU4NTo+OTc3Mzk4Nzc5NTQ3NTc4ODU4OTo5OTk6
NTM5Nzg3NTc1NDU1NTcyNTQ1Nzc1NDI1Ozc4ODU5NTg4ODU1NDU4OTc1NzU4OTU0NzUyOjg1NTU1
Ojc1NTU4NTk1Nzg6OTk1PDg5NTg1NTg5Ozg8NzMzNTc6NTU3NTMyNzg1NTc1NDc5PDg1NTU0MjU4
Nzg3NzU1NTU1OTg1NTc5Ozg4NDc3NDU8OTc4NDU1OTk8ODU4Ozo8PDg0NTo7PDk5ODo8PDU4ODU6
PDg3NTk6NTU4PDo5OTs7ODk6Ojs7Pj04Ozs7Oj1APj0+PTs6Ozc1PD49PDs+OTw9Ozc6Ojk9Pjw6
PDs7OT09Ojw7Pjw9Pjw9QkA7NTo8PDs+Pj4+Ojs6Ozo3PDo3Ozo3Ojw7Nzs7Ojw+Ozs5Ojs+Pjo+
QD48PDw8Pj4+Oj09PTw8Ozo+Pj0+Pj07PTw8PUBCQUA7Oj5AQj0+PTs7PTw7PDo7ODc5Oz07NTo7
Pjo8Ozs9PDo7Nzk8PT47Pjo7PTk5Ojw6Ojo9PTw6PD0+PT49Ojg5Pjs7PTg5OTxAQUA8Ojw+Pjs3
PD47Oj0+Ozw6Oz07Oj08ODs3Ozo9PDw9PTs6PDs6PDo5NTUxMjMyMjIyMzMwMTExMDQzMS8zNTU0
MzUzMDEzMTAyMjIyNDIzMDEvLjIzMTIzNTIxNDEzNDgyMzIyLDE1NDAyMjEzLDE0NC8wLzIwMTUz
NDI0MTEuLjIyNzQyMTU0MzQzMTMyMTU1NTA1NzIzMTU1NTMvMjIuMjM0MjIzMjU1MTgzMTMyMjIw
MjEyNDMzMjAwMjAyMzEuNDMyMzMwMDM1NTQyLzAyMzcwMTUyLzI1NTQyMzIxMTU1MzMwMjMyMzEz
MDU1MjA1MTMzMzMxNDIzMzIyMDU1NDIyMzM1MDIzMTU1MTI0MzI1MC8uMDA0NTUzMTIzNDU3NDM1
MzM0MzM1MzUzMy4wNTc1MjMzMTUyMzIzMzQ1NTU1MzM1NDUyMzE0MzMyNDc1Mi8zNTIwMzUyMzMx
NTQ0NTIzOTU1NzQ1Nzg0MzExMzgzMDI3NTU3NDQ1MzQzLzIwNDIwMjI1MzM0ODc0NDQwMDAyMjU3
NTM1MzEwMzU1NTU3NDM3ODMzNTIyNzUyMjUvMjQ1NDM1NDU4MzI0MTIyMzM0MzIyMzU1OTU1MDI0
Nzc3MTI1Nzo6NzU1NTExNDM1NDU1MjI3NzI1NTU1NTUzNTQzMjc4NTU4NTg1MzQzNDQ1ODc3ODM1
NTE0NTo4NDUzNDU1NTc3NDU0NzM1NTMzNDcxMDM1NzUzMjQ1NzM1MzU3NTU1MzU1Nzo1NTU0MzU1
NTU1MzMzMzQ0ODMyNTI1NzUyMzU3NTU3NTU1NDU3MzExMzU0NTc3NTMyNDMxMzQwMTMzMjQ1NTM1
NTQxMzU1NzIzNDIxLjU1MzM1MjM1NDI1NTU1NTU1MjE1MzU1NDQwNzQ1NzM0NTU1MzU1MjI1NzEx
NTI1MTI0MzQ1NDIxNDU1NTUzNTQ3ODQ0NTU1MzIzNTk1NTU0Mjc1NTg1NTMzMTUzNDU1NDIzNDM1
NTQ1NTI1NTcxMTMyMDQ1Nzc0NDk3NDE1NDM1MzUzNzQxMTM4NzM1NTU0NTU1NDQ1NzUyODk1NDM1
NTU1NDU1MzI0Mjg3NTQ1NTExNTU1NTIyMjQ1NzQ1NzU0MjMxNDMzMzIzMjM1Nzg1MzIyMzo1MjEw
LzMzNDU4NTU3MTUwNDI1NTQzMzE1NTUxNDg6NTU1OTg1NTM0NTU1MzU0MTEyNTQ1MjM0NTM1NTQ0
NDQ1MzQ1MjU1NDMzNTU1NDQ1NDQ4NTU0NTU1NDI0NTU0NTU1ODk0NTQ1OTU4Ojg0Nzc1NTg4NTUz
Mzc0NTU3Ojc1NDU0NTU5NzU5NTUxMjg4NzU1ODg4NTMzOjc5OTw6OTU6NTc4NTg6ODo8Nzc5NzU3
NTw5NDk7Ojc3OTU4Nzs6Ojg3OjU4ODw7PDw5PTk6Ojo5Nzc5Ojw6ODo1OTg5PTo4Ojo5Ozw6NzU1
Ozk4ODc5PDg1NTU5OTg3NTU1NTg8OjkzNTU5PDg1NTUzMzg4Ojc4ODc3NTk6Ozg4OTk3Ozo6NTU1
ODU4OjU1ODU5OTo8NTM3OTs6NTg1ODU4NzU6OjQzNTg1ODo1Nzg8Ojw6Ozc0ODc0NTQ3ODo6ODU3
Ozs1Ojs1Nzg1NTc1NTg6ODU1ODk5ODc1ODo5OjU6Ojk7PDg3OTs4ODU4OTc1NDU1Nzk7OTs5OTg4
NTU5Ojg1ODg4OTU1ODk3ODs4NTUzMjU4NzQ1Ojs4Nzc6Ojo6ODc4NzU5Nzw5Ozs3NTU1NTg1MzU1
NTM4NTU1NDQ1NTEzNzU0MzU5OTg4ODU3NTMzNDE0NTI0NzQ1NTU3MzQ1NTI1NTQ0NTQzMzUxMzI0
NDQ1NTU4MjU0Mjg3OTU1NDc0MzQ1NDU3NTQyNTExNTgzNTUyNTc3NTMzNDM1NTM3NTQzMzEzNTUz
MTE1ODczMjI0NTU3NzU0NTEzNzc3ODk3NDI1NDE4NzQ1NTUzNTU0NzU0Nzg3NDU4Ojo1NTQ4NTU4
NTk1NTk3MzU3OTU1NDc0NTU3NTUzNDU1MjU1NTQ4NTg3NDMzNTc1NTc7NTM1NDM0MzU3NzczMzU1
NTQ1ODc1MzQzNTc4NTIyNTU1NDU1NTc3ODM0ODg6Ojs1NTM0OTc4NTc1NTk4ODU4OTQzOTU6Ojg1
ODU3OTg7ODc6ODU1Nzk4NDo5NDQ3Nzc4NTU0NTU5Ozg5Ojk4NTc3NDk8PDk0NTc5Pjo3OjU1Ojo1
ODk4ODg1NTk6ODU3NTc4NTU1ODc6NDU0NzU4Nzg0NTg1ODg1NTU4NTk5NTU1NTQ0ODc5NDU3MzU3
ODU6NDM1ODU5OTU5NTU4NzU0Mzc3NDU1ODo4OTg0NzM0NDc3NTg3NDU3NTk8ODo3Ojc1ODU1ODU4
PDU3ODg4OTg5ODc4Ozo4ODc3ODk5Nzg1NDc5NTc5ODQ6Ozc4OTczOD49ODk9Pjw6ODg7Ozo7OTo9
Oz49Nzk6PD09Ojk6OTo5Oj49Ojg5Ozw7PTg6PTw9OTo+QTw6PDw6Oj4+PTc3OTs8PDk8PTo8PUFB
Ojs+QT4+Ojw+Ozw6Pjk6Oz09PUA+Pj49Ozk5Oz07PTw6Pj48PDw7PDs4OTw8Ozw5OTg6Ozk1NDU5
Ojs9Pj49Pjw7ODo4OTs1Nzs+Ozk4ODw8Ozw5Ozo+PDk6Ozk7Ojw8PDo3Ojw9Oz04Nzs7PDg4PTw4
Oj08Ozs6Nzk6OT47PDw3PTs7Ozs6ODg5OTw8Ozk4Ozo6Ojk8Pj49OTo9PT07Oz46Oj09PTw4Oz0+
Ozo+Ozk3OTw7OTs6PT05ODk5PDs3Ozk9PD08PTswMzAvMy8zNTEyMS8yMjIxNS8uMC4uMjQwMC8v
MzIxNDMzMzcxNzEvMDU1MC8wLi80MjEvLzMxLzI1NDIxMDU5NTMzMjAyMjEvMzQ0MTAwMDEwMDEy
MDIzMzEzNTQyMjAzMTQ0LzI0LzIyMjAyMzc1MDMyMjEzMzAzMjEvMTgyLjEyNDEyMzM0NDQyMjMz
MzQyNDAyMjQ0MzMzMS8vLC8zNTUzNTEzNDExNTQ1NTMyNTMxNTQxMjM1MDAzMDQxMDUzMTEwLDAx
MzEwMzIzMzM1MzAyMjEuMTMyLzAyMDI0NTQ0MS8sMzg1NDUzNTUwMzcxMTM0NDIvMjI1NzUwMTM1
NDUzLzEzNDMwLy81NzU1NDExMTEzMTEyMS8xMzUyMzMzNTU3NTM1NDU1NTQwMzU3NDM0MTE0NTIw
MjIyNTU3ODMwLzM0MjU0NzgzNTU4NDg3NTA1MzE1NDMzNTczMzMyNTUyNTU4NDU1MjQ1NTMxMjAw
MjIyMDQyNDU3NTM1MzQ0NDg1MzU1NTQyNDUyMDU6ODQ1NTUwMzIwMTcxLjE1ODk3NDM1MjMzMzQ4
NDU1MTMzNTM0NTQzLDUyMjI0MzUyNDc1NTIzMjQyNDg5NDExNTIzNDE0NTU0NDU1NTUzMDE1NzUz
NzU0ODQyNDEvMzM1ODgzMzQyNTU1NTk1NTEyMzAyNDQ0MzQ0MzQzMzQ1NDMxMDM1NDQ1ODQ1Nzc4
OTg1OTUyMzQ1Mzg4Ojg3ODM1MjIxNDIwNTMzNDIxMDEyMTEyMjI1MzIyMzI0NTM1NzU1NTMzNzUz
MTIzMDM0MTM0MDU4ODc0NDg4MjU0MTM0MzIyMzM3NDIzMTU3NDM0NTE0MzM1NDIwMzQ0NTQ1MzIz
MzQ1OTU0NzU5NTM0NTg1NzQ3NTM1ODIzMjEzNDQ1NDI4NzM1NzM1NTU4ODU1MjU3NTQ0MzU1MjQx
MjU0MTIuMDU1MjQ0MzMzMzQzMTU0NTg1NDQzNDQzNDQ1NTUzMzIyNzMzNDU0MDE0MjI0MzIxMzc0
Nzg1OjUxNTI0MTEyMzU0MjU1MjU3MjU1ODU1NDMzODk3NTM1NTc4NTU4NTQ1OTQ0MDE0NTU3MTU3
MTQ1NC8zNDQ0MTMzNDMzMDM0NTU0NTg4NzQ0NDk3NTk1MDU1NTI0NDQyNDQ1NzU3NTU1Nzc0NDU1
NTg5Ojc1NTc1NDg4MzMzNDM3Nzk7Ozg1ODk1ODU1MzU4NzQ1OTU1NTU1NTo1NDM1NTM0Nzs8Nzk5
NTc3ODc5MzQ4OTc4Pjw1NTc3Ojc0NzU1OTs6ODw5NTk6Ojo5Ojc3OTk4Nzc1NTU4PDs1NzU4OTo1
ODg5Nzw5NTs+PDw4ODo1NTo7Pj44PTs6Ojc3Ozs6PDs6NTU1OTs8Nzg1NzU1ODs4OTc1ODg3NzQ3
PDw8OTc4NTQ1ODg4OzU1OTs4NTk5OTk0NTc3NTc6OjM4ODc3ODczNTc6OjUyMjg5Ojk4ODg4Nzg0
NDU1NTU3OTU0NTQ1ODc3NTQ5Ozs1ODU4ODU3NzU1NzU1ODg4Ojg3ODg3Nzg1ODg1Nzg5NTU0NTU5
NzkzNTc3Ozk4NTg6ODU3OTk3NTc1MzU1ODU4NDc5ODk6OTo8NDU1ODU0NTc1OTo4Nz08ODg1NDk5
NTU0NzU1Mzo5NTU5ODU6PTg6ODk1Nzg5ODg6NTU1ODk4OTk5NTU3ODo7PDg1Nzo1NDc1NTg4NTk1
NTk4NTc1OTk7ODc1NzU1Ojk5OTEzNTg4OTUxNDU3NTU5OjQ0OTo0NTUzNTQzNTc3NzM0NDUzODc1
MzEyMjM1NTU1NDI0MjE0NTc3NTUzNTQ1NzM1NDU4ODUzMzU4ODc1NTQ0NTUzMzQ1OzU3ODM1NzU5
OTczODc4NTc1MTU1NTU1NzU4Nzc1NTIyMzg5OTg1NDU3NTU4Ojg1OTI0NTU3MzU3NTQ1NTU1Nzo4
Mzc4Ojg1NTU4ODk6NDQ0NTU1NTU4NDg3NTU1NTc4NDQ1NTg1NzUzNTU1NTk3NTU0NzU1ODU3OTg3
NTs3NDU0NTg0NTk5NzQ3NzU1NDk4Ozo4ODU4NTk3NTo6Nzc4NTQ4NDo4Ozo4NzUzODc3OzgzNTQ0
NDE0NTg5NTU0NTg7Nzg3ODg4Ozw5PDk0ODg3NzU3Nzc3OTg0ODU5Ojg3ODk5OTU1OTU4PDg1NTU3
Nzc4Ojg5NTg5NTM0NTQ1NTM1NTU1NTc1MTM4NTc1MzQ1NDc3NDU4NTU6NTU4OTg3ODo3NTg6OjU1
NTg7NTU3NTU4NDQ1NzQ0NTU0NTU1NDg7NzQ0NDc1NTQ1Nzk1NTQ1Nzg1Nzs6NDc5OTU6OjI1OTU1
NTg6Ozg1Nzs1OjUzNzg3NzU5PTw5ODg5NTg0ODc1NTo6Ojg3Nzk6PTo4Nzc7OTc3ODc8ODo7Ozs5
Ozw6Ojs3Oj01OTo4ODs7PD4+Ozo5Ojs4NT09PDo8Oz04Ozo7OTo8Ozs9PTs4Ojk8Ozo7OTw+Pjs8
Ozw9QUE9Ozs7NTc5Ozw8PDo7PTo6Pj4+QT46NTc6Pj46Pjw7OTg8PD47PT09PT0+Pj4+Ojs7OTs8
Ojk5OTc5PkE8OTo9Ozk+PTs7PTw6OTc4Ozk+Ozw8Nz49Ojg3NTU6Ozc1OT09Ojs8Ojg7OTw9Ozk1
ODU3Ozw9ODc9PDs+Ojc6Oz0+Ojg4PT4+PDs+PDo8PTs8PT45OTk7QTo6Ojk7Ojs9Pj46Oz07Ozw8
Pj09PkA9PTw4Oz46ODc1ODo6Nzo7Pj5AOTAyMTAyMTIwLy8wLzIzLi81MCwvMzUwLzAyMDAyMjEy
My8xMjU0NTM1LywwMDEyMDMzNDAwNDExLjIzMjU0NTIwMTAyMjQyLzUyMjMzMjM1MzMzMS8zNTU1
MzIuNDg1MTE0NTMyNDIzMzUyMi8xMDAyMC4yNDAyMDQyNTM0NDQ0MC8vMDQ0NDQxMDEyNTMzNDQx
MjEyMjIxMjEwMjQ1NTcxLzE0MzIzLzM4NzM0NTMyLi8xMjIzMTEwMzI1NDExMzMzNDU1NDIyMTEz
MzMxLzE0NTAxMTIyMDIxMS4vLjIwMDUzMzUxMjMzMjEwNTQzMTEwMjczNzUzMjUyMTQzNTMyMTM1
NDUxMzIwNTMxMzQ0MzEyMDEzMTQ1MjM0NDAxMzM1My8wMzMyNTEzMDEzNDM0NDIzMTEyODk1NTU1
MjM0NTU1MjM1NDM4NTU5NTM1NTc1MjU1NTUyNDQ1MzM1MjUzMjM1NDU3ODUyNDUyMTQ1NTQwMTIy
MDAzMzE0NTc1MzM0NTMzMzQzNDIwLy8xNTU4NTIxMTA0MzUxMDI0MTUzNzU1NTU0NDUyMjAxMzU1
NTMxMzc4Nzk3NzUzODk1NDM1NTg1NTU1NTo3NDg0NDQzNzU0NTU0NTU0NDM1NzU3NTU1NTQ1NDc1
MzQ1NzU1ODM3NTQ3ODU5NTQxMzc5NTMzMjU0MzE0NTQzNTUxNDIyNTU3NDU4NTU1NzMzNDM1NDI1
MzAzNTUyMTExNDg3NTQxMzc1MzU1MTI0NDQ3NTU1MzQzNTQ1NTc1NTU0MzIwMC4yNzQzMDI0MTAy
MjAvMTEzMzMzNTUzMzUzNDQ1NDIxMTQzNTM1MzM0Ojc3OTU1NDc4NTc1NTQ0NzU1MzU1NTc1NTQx
NzIzMzk1NDU3NzQ0NTU0NDc1MzM0NzQzMzMzMDc3NTU1NDU1MDU1NDU1Mjc3NTU1NTc0NTU1NTI3
NTc1OjU0NTg3OjU0NDQ3OTU3NDIzOjo1MjI0MzU4NTQzNzU1NTI1NDUxNzU1NTc3NzU0NTU0NTk1
MzUzMzU1NTA0ODIyNDc1ODg0NDM1NzU1MzU0MTQzMjU3MzE1NTU4OTg1NzU1MjI1NTU1MzUyMzc3
NDMzMDA1MzU3Nzo6Ojk5NTQ1NTg1Nzc4NzQ1ODk3NDM5MzE0NzIxMzc1NzcyNTg4ODg5NTU1NzU1
OTc3NDU3ODk1MzU1NDc1NTU0NzQ1Nzk4OjU0NTQ1NTU0MzQ0NTc3OTUzMzQ3NTU1NTU1NzU0NTU1
NTU5ODUzNTI0Mjk0MzMzOTU4NTo4Ozc3ODk6Nzk6Ozo5PDk3Nzc1OTU3NTo3ODo6ODw7Ojc7ODg1
Nzo5Ojc6PTs5Ojw8Nzc3ODk5OTU4OTo6Ojo8ODg6OTk3OTs6ODg5ODc3Nzw1NTg5NTk1NzU5Ojo0
OT06Ojg3NTU4ODg3ODg4Ojg3Nzc3NzU5NzU1Ozk1OTk4Ozo8Ozk6OTk4NTU5NzQ0NDc5NTc6NzQ4
ODo6NzU1NTc5NTg4NTc1NTw7NzM1OTk1NzgzNTk4NzU3OzkzNTc6Nzg3NTc4ODc1ODU1OTM1Nzk3
NTc4NDU1NDQ5ODU1ODg5NTMzNzU3NTU1Ojg4NTg7Ozc1ODg5OjMxNTg5NTU1NTQ3ODk1NTU1NzU3
Nzo1MzU1NzQ1NTU4ODQ1ODc4OTk5Nzg5NzU5NTo7Ozg5OjU3NTk0NDg6OjU4NzU3NTg4NTM1Ozc1
NzQ1Nzg1NzQ1ODU4OTU1MzE0OjU1ODk7NTg5OTc3ODg3NDU3NTM0NDg1NDI0NTg1NTQzODg3NTM0
NDU0NTU1Nzw5NTU1Nzg3ODUyMzU0Nzg1NTU4Nzk0Nzc3NTUzNDU3NTE1NTM3NTAxOzU1Nzg1Nzc3
OTU3OTQyNTM1NTo5OTk3NTU5Nzg4OTc1NDc1Mzk7NDQ1NTU1NDUzNTQ1NzU1MzU3Nzk1NTM0MjI3
NTM0MzQ1NTc1NDU0OTUzNDMyMzI0NTU1NTczNTIzMzU0NzU3MzIwNTQ1NTg5ODk3NzU3NTU4ODk6
ODU3NDU1NTUzNDU3NTUyNDc4NTU0NTc4OTg0MjMyODc1ODU3Ojk7OTk4ODg3OTs3MzU3OTs5Nzg1
NTg5Ozc3NTg5Ojk1NTo7Ojo6NzU3PDc1ODc6ODg7OzU4OzU4OTg4Nzg1NDM3ODk5NzQ1NzQ4NzM1
ODo3ODk3Nzg1NzU3NTg3NTQ3Nzc1NTQ3NzU1NTk1NTQ0OjQ0NTQyMzQ1OTU1NTc0NTU0NTQzNTc1
ODU1NTU4NzE1OTw4NTk7Ozg3ODg1Nzc5ODc3OTc4Nzg3Ojk5Nzk4OTU1ODU4NTU4NTc3PDk1Mzc7
OjU3ODo1NDU1MzM1OTw5NTg7ODo5NTU6Ozg5PDo4OTs7Ojo6OTw3NTo6Ozs7PDk4PDo7Ozs6PUA+
PDc8Ozs9PTs5PEA3OTs7Oz4+PTs9PT09PTw4PDo5Oj47ODg9PTs9PD44Oj08Pjk7PD49OT4+Pjw+
PDk+Ojw8NT09PD45Oz46Oz4+Ojw9Ozk5OD46OTk+PkA9Oz49Oz49QT07Ozo4Ojs4ODo6Ojs8Pj47
PDw8PDs6OTs7Ozg6Ozk6ODg8OTc7Ojk6Pj47Ojw7Ojg8PTo7PDw7Pj47PTw+PDs8Pjw7Pj47Pjw8
Ozg8PkNAPDs7Ozs1NzpBPDc3Pjs1NDc4PT4+PkBAPTw8Ozw+Ozs9PDw+PT08PTk7Pj06Ojs8PDs0
NTs7PD4+Pj49Ozo7PD08PT0+PTs6MzIxMTIzNTMyMDA1MjAyMTIzMjQzMTAyMjExLzEzMi8yMjUz
MTIsMTQxMjAwLjExLjExMTAzNDAyMTQwMzI0NTUxMzQxMTIyNTMsLzM0NDQzMzI1MDAvNDQzMDIx
MzUvLjEwLjE3NTIxMTQ0NDUyMTQ1MzIwNDUzMDMwMTAxNDQzNDEzMy8zMjEyNC4zNTIwLzAxNTQz
LzQwMDQyLzAxMzU1MjU4NDE0NTQ1NTQ0MjMzMi8zMjIxMTAyMzIyMzU1MzE5NzUxNDI0MjU0Nzgy
NDA0MjIyMjE0NDAvMTA6OTg1NC4yNDIuMDQzMDIyMi8zMzU0NzU1NDA0NTc1NDQ3NzQ4NTM0NTMw
MzAvMjQwMjQ1MjQ3MjAyMTA1NTMwNDUzMiwvNDQ0MzMxMTIwMS81OTg1NTI0NTQzNTc1ODo4NDU0
Mi8xMDIyMTM0NDEwMTAwMjIxLzMzNzc4NDQ0NDU0MTMzMTUyMTI0NDMzMzc1MjU1MjI3ODU1MzU0
MjIyMDQ1NTU3NDIyNDU1NTMzNTc3NzMxMzU0MzIzMjQyNTUyNzc0NTI0MzU1ODczMzg3NDc0MzQ0
OTcyNzMzMjIzNDc1NTQ1NTU0MTU4ODcyMjU1ODU1NTU3NTQ0NDU3NDMzNzU1MTExMDU1NTQ1NDUx
MzQ1MzUzNC86ODM1MjM1NTE1MzEzODg6NTMzNTUzMjM1MzI0MTIzMTQzMDA0NzQ0Nzc3MjQwMDU1
MjE1MzM0MzAzNDQyNDQzMS4xMzQyNDQyMzU1NDE1NzMyNTIxMjUzMjUyNTU1NTE0NDMzNTc1MzQ1
NTQ1NDMyMzU0NDU0NDI0NTIzNTQ0NTg1NTU4NTMyMzU1NDU0MzMxMjEzNTEzNTc1NTU3NTU3MjA1
NTU0NDc1NTU0NDU0NTk0NDQyMjMzNzU0NDI1NzUwMzM1MzMxMTQ1MDU0MzU1NDc3NTExLjAzNTg4
NTQyMjU5MjEyNzU1NTU1OzgzMzU1NDQ5NDQ1NC81NTU1NTc1NTU0NTQ0MzMzNS8wNzQyNTczNTU0
NzU3ODc1NDU3ODU1OjczNDIyNDQ1NzU3NTQ0NzQzNDM1NzUzMzk4MzA0NDU3NDU0MzQyMjQzMzE1
MzIyNTU3ODU1NTc1NTU0NTU3NTQ1ODc0NDU1NTU0MjQ1MTE3NTAyNzc1NTU1NzUxMjU1NzU0NTU0
NTU1MjEyMzUyNTQ1NTU1OTkxNTM1NzQzMzUyMjM1MjQyMjU3NTIyMzU4NTQ5OjU1NDg1ODg3NzI3
ODg3NzU1NTg3NTc4NzU1Nzg5ODk5Ojo5Mzg1NDg7PDg0NzU3OTg1NTc6NzU1NDk1OTU0ODc3Ozc4
OTk7Ojc3NTc1OTk3Nzg9Ozk8OTo9Ozg5Ojg+OTg5Ojk5Ojk5OjU4OTc1ODk1NTc5ODk3OTk4ODU1
NTM0NzU1Nzc4NTQ1Nzo1Nzc5NTM4ODk3ODU4MzU3NDQ3NDc5ODg5NTU1NTc3ODU1NTU3OTg7Nzo3
Nzg3NTU0Ojg5Ojk6Ojc0NTU1NTg4Nzo1NDQzNzU0Nzg1NzUzNzc3ODk1Ojo5NzU1OTU1Nzg5ODc4
ODg3NTU4NTU3NTU5OTg4ODUzMjo3ODo5NTU4NTU3ODk1ODo3NDU1NTo4NTU5NTc4OTc6NTU3NTg1
OTk4ODg1ODk4ODg1NDk4NDM1NTU1OzU1NDg4NzU1NTU1NTk7Ojo7ODg3OTU3OTc3NTU1MjU7Nzg4
MzQ1NTQ1MzIzNzU1MjQ1NTU0NTc0Mjc6OjUzNzk3NTg1NTc1NTU0OjUzNTc5NzUxNTI4NTQzNDU0
MzE1NTQ1Ojk5NTU1NDM1NTUyMjg3NTg1NTM3NTU1NDMwMDMzNzg3NzQ0ODc0NDc3NTU1NTUzMTMy
NDQzNDIzMjU0NTk1MTU1NzU3NzU1NDg3NTQyOjg1OTU0NDU0ODk1NDU3NDU1NTU1NTU1NTk3NTU3
NTQzNTQ1NDU1NTc1NDE1NzU1NTA1Nzg4ODU1NTg0MzM1NTMzNTs5Nzg1NDU7OTUzNDU3NTk1Mjc3
NTQ1NzU1MjQ0NDc6NzU1MjI5OjI0NTM3OTU1Nzg4Nzo4NDQyNDU1NTUxMjQ1MTM0NTU1NzczNTc1
NzM3ODc6MjM1NDU0NDc7ODc1NTU1NDU1ODIyNzc4NTg4NzU1NTM1OjQ0NTM4OTk4Nzc3NTc5ODk5
NDM0Nzg1MzUzMjU5MzMyNzk1MzIyNDQ1ODs1NTU1NDU3NzU6NTU3NTg6ODc5NTg7NzU3NTQzMzQ0
NzU5OTg5NTU4NzQyNTU3ODM3ODU4OTs3ODU0Nzc1OTs5NTU3Nzc1Nzg5Ozk4ODU1NTc3NTk4ODU3
NTk4NTc5NzU4Ojg5Ojk1NTU9Ojw8Ozg6NTU4Nzk+OTg7Ojo4Nzo9Ozk7Ozg9PDk6NTs8Nzg8Pjo+
PTo5ODg5OTg6PDk3Ozg6ODs6Ozk5OTo9Pj4+Pjo6PT09Ozs7Ojo4Ojk7PDw6PT4+Ojw7Ozo8PDg6
PDw4Oz5BOj48Pjs6Pj07PDo8Pj49Ozo7OTk5Nzs+Nzk6Oj09Ozk7PD4+Pjw6OTo+Pjs3Ojw8Ozk6
PDs+Ozw7OjtAPjs+PDs5OTg8Ojs6PT48PTw+Pj46Nz46Ozs7PD08Ojk4Ozs9PTk9PUFAPT08OTo7
Ojk8Ojw5ODxBPj47PTw+Ojg5Ojk7QDs9Pj1APjo9Ojo8Oj48PDtAOjg8OT49PUA+PTk+OTw8PDk7
PD45NTk8Pj4+PDs9PDo7PTszLzIxLzQvMjQzNTQwMDEvMDIyNDMwMTIyMjIxNTQ0MzIzNTMwMTQ4
NzIyNC80NTIzMSwwMDAyNDMyMjExLzIxLDExMDM0NDUyMzIyMC8uMDQ0MTE1MzQxMDEuMjEvMDMx
LjU1NTIxMTI0NTQxMzU0Mi4vMCwvMjIxMTUyMDMyMjMzMTU0MjUxMzE1MzMzNTMyNzMzNDE0MzQz
MjEyMjEwMzIzNTQvMTEsLzAyMzMzNzg1NzU3NTU1MjEzMzQyMzMzNTUzMjMzLy8vMzQxMzIyMzIz
MzMxMDAyMzM0MzU1MTQ1LzIvMTQzLzAwMzMzMzUyMC43NTU1NzU0MzM4NTg0MzAzNDM3MDEyNTUz
MzI1MjM0LzIzMzU4NDQ1NDU0MDIzMTQ1NTMvMDEzNzMzNDIzOTIxMTE1NzQ1NTM1NDM1ODc4ODg0
NTo3MzU1MzU0MzQ0MzQxNTI0NTg1NzQzMzIwMzM0MjQ3NTQ1NzUyNDU1NTc1NzUzNTMzMzMzNDc1
Mzg1NDEzNTU0NTU0MzM1NTU1NTUzMjEzNDQ1NDQ1Mzg1MzQ1NTUyMjM1MTMzNTQ1NDIyMTM1MjM1
MTAyNDMyMjQ3MzMzMTQ1NTU1MzEwMzQzMjQzNzUzNDM1ODc1NDIxMzU1NDU4NTQ1MzU1MTQ1NTQ0
MjAzNDIzNTI0NDIzMjU1MDQyMTI1NTIyMzM1NDU1MjI0NDIyMTEzMDIwMC8wMzUxLzMzNTU1NTMz
NTQ1NDU3NDMyMTUzMjE1MzM1NDUyMjI3NTc1NzU1NTQ0MjIxNTE0MTQxMzIyMjMzMzIwMjU1MTUw
MjM5NTQ3NTE3NzU1NDUzNDA1NTI3ODIzNDQ6Ozg1ODU0NDU0MjI1NDU0NDU1NzMzMjQ1NTQ0MzE0
MTI1NDU0MzExMjI1ODUyNDUzMzU1NTEwMjM3MjIzMzMyNDQzMjEzNTMzNTQzNDIyMTE0NTEvNTUy
NTU0NTQ0MjU3MzQ0MjU1Nzc1ODc1NDI1NTU0MzM0NDQxMjo7NTU1NDI1Mzc5NTMyMTQ1NTQ1MTU1
MzUyMTMxNTg3MzQ3ODcvMTQ0NTMzMi40NTc3MTEzMjM1NzMzNTQzNDE1NTU0NDUwMjU1MTE1OTUz
NDQ0NTI1NzU1NTc1NTM0NTQ0NDQ3NTc4MzQyMzU0NDUzNDU1Nzg3NTo1NC81ODc1NTQyNDUyMjM0
NTU3NDUyMjU3NDU3OTU1MzI1NTU1NDM1NTU0NDk6NzMxMDc5NTQ1NTI1NzU1Ojs4OTg1NTg3Ojkz
NTc1NTg1NTU4ODUyNzg1Nzc6NTc6OTU1Ozg4OTw6OTo3ODU3Ojk5Ozg4ODg5Nzg8Ojs5Ojk4Pj44
Nzk1NTU0NDg8Ojc8OTo7NTU0NTU3ODU5OTs4NzU3Nzk4OTs6Nzo7NTg7Ojw5PDw6OjU4Ojg8OTc6
NTU1OTc3NzU1NTU3NTI3OTU0NDU5Nzo7NTU3MzM1NTk1ODg1NDU1NTI1Nzo6Ojk3NTc7ODU1Nzc5
Ojg4NDg4OTg1NTUzNTM1NTg4OTg4NTs6NTU3ODg1MzU1NTI0NzU5Ozs1OTs3NTk7Ozg5ODo7Ojk7
PDg1ODg4OTc3OTU1NTk7NzM1NTg3NDU3MzU3NTc6NzU6Ojs5PD04OTk5Ojk1NzU1NTM1OTU4NTo3
MzU6ODU0NDUwNTU1NTU4NzU5NzIyMDQyNDU3NTo5OTU1MjUyMjg5NzU5NTc1ODM0NTU1MzU4NTU1
NTg1NTc3NTU4OjQ6NzU1MjI6NTQ3Ojg3NzM1Mzc1MjU1NTk3NTU3NTU1NTc5NDQ3NzU1MzQzMjU1
NTU4NDQ4ODc1NTk1NTQ1NTc1NDUzNTg0NDU6OTQ1NTg4NDI5OzUwMjc1NDU1ODczNTc9PDU0Mzg6
NzU5NDI9Ozc0NTg6Ojk4NTU3ODk3NDU5NzU1ODU3OTU0NTg3NTU4OTExODk5NTU3NDQ0NzU1MjQ3
NTQzNDU3ODU5OTcxNDUzNzUyNTU1NTc1NTU0NTQ5NzUzNTw1NTEzMzU0NzU1MzI3NDU1NDU0NTc1
ODM1Ojg1NTc1OTU5NTc1OjcyODs6NzQyMTE4NTg+Ozk1NTU1ODU0NzU4Nzk5OTc0NTU1Nzk6NTM1
NDc4NTg4NTw9NTg4NTg4NTk5Ozs5NzU6OTQ1Nzo3MzU6NzMzNDc6NzU1MzM3Nzk3OTU5ODs5Nzs4
Ojc3NTU1NTQ1NTU1NDMyNzg6Nzc1NTc3NTU0NTU1ODg1NTQ1NDc4OTIyNTc5Nzg3NTM1NTUzNTk6
ODU4NzU4NTU3Nzc1NTk1Ojs4NTc3NzQ1NDQ1NTU3NTQ0NTU1NDU1ODc4OTo5Nzg1NTg4OTo6Nzc6
OTc4ODc1ODU3OTo3Nzk3Ojo1Ozs8PDU4ODo4ODg6Ozc3NzU4ODw5ODw8PDc1ODk8Pjo3Ojk6Oj03
ODs5O0JBOzU5PTk5Pjs3Ojg4ODs9Oz4+Ojw7PTo4OjtAPj0+PD4+PT4+Oz49Ozg5Ozw+Pjw8Ozw6
Ojs5OTw9PD49ODk6ODk7PD0+Ozg6OjxAPDg7Ojg9PDk7PTw4PT06Nzo+Ozs7OTk3PTo8PD48Ozs7
PTw7Ozs7PTw4OT07OTc4PTo+PD05Ojs8ODg6Ozs9PTw7QD06OD09Ozw+Pjs6QD43ODo8PT05PDo+
PT4+Ojc9PD0+PDs8Nzo+Pj49Ozo6Ojs7QUA+PDo9Ozo5ODo9Pjw8PDw8Pj4+Pj45Oj09Pjs8Ozw8
Ozc5OTc6OT4+Ozs1OjAwNTMvMjUzMS8xMS8uMjQyMTM0Ly4wMTIxLjAzMTEzMjQyMzExLi4zMjEy
NDIzNDMvLjEyMC8xNTU0MDIwMzIxMjIwMjIxNDMxMTExMjMzNTIvNTk1MzQ1MzMyMC4vLzIzODEz
NTMxMTAvNDUzNTIuLzIvLjI0MzQ1NzM0MjEvMTExMzIxMjIwMC8vMDM1NDczNDQzMjE1NzMyLzM1
MjIzMzM0NDIzMzI0NDMxNTMzMjM0NTIxMzAxMTIwMzUzMzE0MS4vNTI1NDU1MjQ1MzEvMTMzNTM0
OTUxNDUxMDIwMTIuMTAxNDMyMzQyNTQ1NTU0NTAxNDQzMzIwLDEzMTIyMSwyNTczMjExMTM1NzQy
NTUyNDU1NTIzNTI0NDQzMjExNDQ3MzMzMjQ1NDEyNTU1NC4xNTQ1NDQ0NzIzMzg1MzM0MjI0MzIz
MjEzMzEyNC8wMzI3NDU4MzQyLzIzMjU1MzU0MzQ1NTc0MjEwNTc1NTEyNTIzMjI1NzI0NDQ0MzI0
NTE0NTAyMjM3ODo3NTIyNzg1MzM0Nzc0LDE0NzU1MjM0NTU1NTQ1NTQ0NDIvLzU0NDQ0NDQyNDQz
MzAzNzU0OTUzNTM1NzU0NTQ0NDQ1NTUzODczMzIzMzM0NTU0MTM0NDk6NTg3NTUzMjQyOjo0MzU0
NTQyMTI0Nzg1MzQyMzQ3NzQzNTQ1My8wMzUzMjIxMTQ0NDM0MzQ3MjQ1MjM0NTUyMDIzMjIvMTQy
MzU0MjMxMzAxMjEwNTMvNDIyNDg0MDUzMzMzMjIvMjQzNDEyNDAvMTQ1NzgzMjI4NzM1NTM0MS8w
NTUzNTQ0MjIzODc0MzU1MzUzMTU1MzM0NTkzMzUxMzc5NzM1OTg1NzU7OTU3OTU0Mzc1NzM1NzU0
MjQyNDc0NDIyMzM1NTU3NTU1NDQ1NTg0NTUzNTQ1NTAxNTM0NTUzMzU0MDM1NTU0MjIzNzUwNDUy
NDQ0NTE4ODQ0ODUyNDU3NTEzNTMyMzQ1NzQ1NzkyNzIyMjM3MzM1NTQ0NTo3OjQzMTg1Mi40NDk8
NTU1NTc1NTU0MS8zNTg1NTU0NTQzNTIyNTU6Nzc5NTI1NDQ3MjM1NzIzNTQ3NTU1NTQ4NTU3Nzg4
OTU3NTo1NDU4NzMzNTU0NDU1OTg1ODU0MzM1NzU1NDUyMDQ4MzEyMzU0MC8wNTUzNzU1Nzc1NTUy
NDg1NTQ1MzU4NTc1MzM1NDU3NTQ3NDU1OTs3NDc3NTU4NTc1NTk6NDU5NDQ3NzM3NTo5OTc0ODg1
NTc5NTc1ODU3Nzc0Mjg3NTU6NTc4NTo7Nzk5NTk5ODU3ODg1NTg5Ozo4OjU4Ozk1MjQ1NTg5NzU6
PT06OTg5Ozk6Ojo5Nzg5PDs6NT45ODk4Ozk4NTg3Nzc6NDM1NTc0NTk5OTk3NTk6ODU3NzU1OTs6
OTU3Nzk4NDU3ODg4NTo3NDg4OTo3Mzg4Ozs1NzU1NTo5ODM4NTU1NTc1ODQ4NTQ1ODU1OTU1Mjc1
Mzg6Ozc3NDU1NDc5ODQ8OzU1NDQ0NDUzNTQ3ODo1MzU4Nzc1OTc6OTk3Ozo5NTU4NTc4OTc4NTk1
OD41NDQ4OTo5NTQ3OTg3ODU0Mzg5ODg5OTU3Nzc5NTM6NTg5ODg4NTU1ODs3NzU1ODo0NTU5OTc4
MzM1OTU4OTc1Nzk1NDc3ODU0Ojg5NTU3NDc1NzM3ODg3ODg1NzU3NDU3Nzg1ODg1NTU3NTc4NzU1
NTU1NTIyNzc1NTg4NDU0MzM1NDk0NDQ0NzU3Nzg1MDMzODc0ODk1MzM1NTIzNDU1NTU1NTQ0NTU1
NTc1NDU4NTA1ODk4NDU4ODU3OTg5NzQ1NTM1ODo3NTc1NTg1Nzc7Nzc1OTU3NTU1ODU4ODU0NDQ1
NzIzNDc5Nzg7ODk3NTQ3MzU4NzQ6NzM1NDUzNDUzNDc4Nzg3NTU3NTc1NDQ1NTQ3NTIzMzUzNTU1
MzQ1NTk3Nzg3NDU5NzU3NDU0NDU1MzU5OTcyNDU3NTU1NTU4Ny4yNTQzMjc5OTQ1NTI3ODc1NTM1
NTc4NTg4Nzc3NTU1MjU1NTg4OTg4OTk1NTc4NTk1NDQ3NzM3Nzg4Ojk1ODo6ODU3NDc4Ozc5OTg3
NTQ3OTU0NTU4NTU4NzQ0NTk6OTw4MzU1NzQ1NDQ1Nzc6OTg3NDg3NTo3Nzc1OjU1Nzg3NTg1Ozs6
Ozc3PDkzMzU1NTUzNTs4Ojg4NzU1NTo9NTU3Nzk1Nzo5ODc7ODU1NDU3MjIzNTM1MzU4NTs4Ojg1
NTU0NTczNTU4NDQ5NTU1NTU4NDc0NTU4NTM1ODo1NTU1NTU4ODg5Nzc5Ojc1NzU1OTc4ODg1Ojc3
OTw3NTU1NTU1Nzk6NDU3NzU4ODc0Nzk5Ojg3OzU4OT04PDo6Oz07Nzo7PDo9Ojo4Ojs7Ojg8PD0+
PDg7ODk6OTk6Ojo+PDo7Ozs9Pjw6OzxAOzw5Oj07PTw7Ozo5Ozw3OTo8Pj4+PDw+PT47Ozo+PTs7
OztAPT0+Qj4+PDs7OTg7PT49Qj08PTs9PUE9Oj0+Ojo5Ojw6QEA+OTtAQTs8Oj46Ojw9Oz4+Ozk9
PTs9Oz06Ojs7Ozw8Ojg4ODs+Pj06PTk8PDg7Pjo5Ojw7Ojw5OTk+Pj47Ojw9QT46Pjw9Pjs8Pjw7
PDw6Ozo8PT08PD0+Ojg6OTw6QDg6PTw9Pjw6Oj48PDw9PTs6PDs7Pjk6QD4+Ozg9Ozs+QDw9Pj08
PkA+QDg1OT4+MC8zNDIyMTQ0MS8uMjIzMjIzMS4xMDUvLi4xNDM1NzU1NTM1NzQxMTIzNCwvMi8w
NDM3NTM0NTQxMzAxMzIvLzAvLy83MTI0NDQzMzM1NTExMjIzMDEzNDMxMjQvMjIzMzMzMzM1NTMy
MDQxMjMxMjc1NTExMTE0MzAzMzM0MjAvMzErLzExMS81NTAxNTAzMDI1MzUyMjExMy4wMTUzNTIw
MjIxMjE1NDA0MzMxMzc0NTU0MjEyNTQyLjM0MzIwMDIzNDEwMjQyNzQ0Mi4uMjIwNDQzLDM0MTAw
MDEyNDU3MDM1NDExMjMvMDMyNTAwNDMyMjI0MDU1MjE3ODU4MzQzNDQxMjQyMzIzNDA0MjM0NzQ1
NTM0MjU0MjUyMzUyMjMzMTM1NDMzMzc3NDIzNDQyMjMyLy8wNzQ1MjQ1NTU1NTI0NDM0MzI1ODg3
ODUzNTU1NzU3OTg0ODU0NzU5NzUzNDU1NTUzNDUxMjg1MTAzMzAxMjI0NDg1NTE0NTU0NDc1NTU1
MzI0ODU4NTU1NDQzMzQ1MzQyMzEzNDo1MTA1ODQyNTM1NDM3ODQ1NDc1NTM1MjI3NTE1OjQ3NTU0
NTQyMzQ0NDc1Nzc3NDU1NDU4OTczNTU3NTM1MzU1NDU3NTU3MzQ1NzQ1NDMxMjM0NTU1NDUzNTM0
NTUxLzM0NTIyNDI1NTU4MjIyNDM3NTQ0MzQ1NDMyMTUyMTU3NTU0NTg1MzI1NTQ0NTc0NzU3NzQ0
NDQ1MTM5NTMyMzUzNDE0NTU7MzU1MjQ3NzQ1NTU0MzMzMzQzNDMxMjI0NTQ1MzMyMjExMjQwMTAz
NTQ1ODU0MzQ3NDI0NTI3NTc4NTg6MjM0NDU1NTUyNDc1ODc1NDU0NTMwNDQ1MTQzLzU1NDk3Mzcz
NDc3NzIzNzc0NTU1MTU1MzQ0Nzc1OTkyNDQ0MzU3NDU1NTQxLzU1NTU1NTQxMTQyNTU1NTczNDUz
MzUxMjQ0NTczNDU0NzMzMzM4OTg5NTU1NDQ0NTU1NDUxMzIxMzg1NzQzMjM1NTg1NTc3NTQ1NDIy
NTM1NTU0NTIxMzQ1ODgzNzc0NDEzNDU1NDU1NDQ1NTUyMjE4ODUzNTUwMTU1NTQ1ODUyMjM0NTA1
NDUwMjM6ODM0LzM1NzUyNzU1MTA1NzU1NzU1OTU1MTI1ODU1Ojc1NDQxNTc0MTMxMjQ1MjU0MzI0
NzU0NzU0MjU3NTU1NTU0NzU1NTU1ODU4OjczNDo3Nzw4ODg6OTU1NTU1Nzk3NTc6OTk1NTg4Ojg1
NzU4NTc6OTk3OTs1ODc6NzU3Ozw+OTw7Ojw9Ozo1Nzk7Ozk5OTU0Ozo4Nzo5Ojs5Nzg1NTc1Mjg7
Oj48Pjg1NDQ3OjkzOjg5OT06OzU1NTg9Ozo1OTg3OTc5OjU3Nzc4Ozk1NTU1OTk3NDQ3Ozo7NTM3
NzU4OTU3Ozo6NTU1NTs6NDUyMjU4ODU5ODg1NDU5OTU1NzU1ODc4NTk4OTg1NTc6Ozo3MzU3OTo3
NTU4ODU3ODg1OTU1Ojo9PjU3Nzg7NTQ6OTc1Ojg4OjU3NTc1NTg8NzU1Nzg1ODc1OTg6OTU1OTU4
OTUzOTg5Nzg1ODc5Ojk8Ozk4OTo3NzM4Ojo4Ojs6NTU3OTc3Nzk0MjM4NDQ3NzE1Ojc4Ozc4OjUz
NDk1PDk1NTg1NTU1NTI0NTU1OTU1OTs4ODc0NDc5ODczNTU0NDU3NTU3ODU1NTc4NTg6NzU1NDU3
ODo5NTU0NTU1NDc3NTU3NTg4NTUxNTU1NDUzNDI1NDE1ODU0Mzc3MzU3NTE0Mzk5OTU0NzM4ODcy
NTMzNTQ1NTIzNTUzNTg1NTU1NTc1NTMzNDU3NTQ0NTgzNTM1MzM4OTQ0NzM3NTU1NzM1NzU0NTg3
NTQ1NTk5Nzc0Nzc0NTg3OjU1Nzc1NDU1NTU1MzM3OTg4NzQzODc3NzUzNzU1NzMwMTc0NDQzNTU4
Nzg1NTI1ODg4MjMzNTUwMzM1NTQ1NDc3Mzc0NTU0NDc7OTc1NTU4NDMzNDMxNDM1Nzc1NTc5NTU1
NTQ3NDQ1NTU0NDU1Nzg4ODc4Ojk5ODU1OTc4ODw8NTk1Mzg6NTs4ODo6OTg3NTg3ODc0NTk5Ojg4
NTc3OTU1ODo4ODo6NDU5NTQ3NDUzNDc0MzU0NTEzNTU1NTU3NTU5NTU1NTg5NTQ1NTg3Nzg3NzU3
NTU1MzAxNTU1NTMyNzg3NTM3OTk3NTk1NTU1Mzk3NTg1NTg1NTg6NDQ1NzI1OTc5NTUyMjM1NTo1
Mzc0MjI1NTU1NDU3NTQ1NTQ1NTM1NzQzNDc1Nzg3MDI1Ojg0NDc8OTg1OT03NzU3OjU6Pj07NTk3
NTc1Ojc8Nzc1NTc1ODs9ODs8Ozc4OTk3Nzc6ODw5NTc7Ojw7Ozs6Ozg3Nzg6PDo7PTs7Ojs6Ozk1
OTs+PD4+ODk6PDw7Ozo9PDs7PDg5Pjw6Ojs8Ojo6Oz46Oj08Ojs+PDs5PEA8OTs+Ozs7PD06PDw6
PTw+Oz49Ozw6PDw5OTo9OTs6ODo6QD49PD49Ojk8Pjs4ODk7Ozw8NTo+Ozw7Pjw6Ojs9OTxAPjs8
PDw6Pj48PD06PD4+QDw9PDw5Ojk+Pjw6Pjs6Ojk7Pjw6Oj48Ozc7PTw7ODs6Ozk8Oj49ODs8OTk4
ODs+Pjw6Oz08Ozw9Pj46PDs7Ozw7Ojg8Pjo6Ojs4Ojw1Nz08Pjo7Pjo5ODo5Oj47Ojw7Pj47NT07
Ojo8OzoyMzIxMTIzMi8yMjIyMTEzLzExMjAwMS4wLjEzNTQ0ODM0MSwxMzI1NS8vMTIzMzEwMTQz
MSwyMzI0MjEzMjMzNzUzMjAyMjE0NTIxNTM0MTQzMjQxMDU0MDAsMDIzNDMzMTIwMTIzMzQyMzI0
NTQzNDQyMjEvMjUzMjMzMTMzNTU0MzMzNDQzNDEwMDIzMy8xNzQwMzU6NDE3NTM0LzEzMzExMTM1
NTIwLjEyMjEwMTMzMzEzNDUyMjUzNTMyMzExMDAyMTMzNzIyMjA1MzM0MjMyMjAxMi40NDExNTUz
MS80NTQ1ODU0NTIyMzg1NDMyNDQ3MzE0NDU0MzM0MDIvNDMxMTEzMjU1NDI1NTM0MjM0NDAzMjAx
Ly8zMDAyNDc0NDgyMDAzNTM0NTMzMzAzLi8wNDA0NDQ0MzAxMTEsMTMyODU1MjQ1MTExMzIzNDUw
MDE0MzQzMzEzNDc1MzQzNzUyMDM3MjU0NDM1Mzc1NTUzMy8xMjQ1MTQ0NTMzMjU1NTUzNDUyNTc1
Nzc3MjEzNTU1NTM3NDQ1NDIzNDQyMTo3OjQzMjQ0NDcyNTU0NTQ1NTE0NTg4Nzc1MjUzNTIzNTUy
MjQ1NDQzNDU0MjM0NzU4NDMyNDU1NDM4NDM4NDM1NTQzNTM1MTUzNDQyMDMxMzEzNzE0MzIyMzI0
Ly8zMTE0MjIxMjQ1MTM0MTAyMzMxLjU3NTQ1NDI0NTIvMTIyNDMyNDEuNTM3NTc1MzU1NDUzNDIz
MjQyNDQ0MTI1MjMwNDgzMDU0NDAwNTI1NDQ1MjQ0MDQ1MzUxMDA0NTU0NDU0MzU1NDEyLjE0ODU0
MTc1MTIzNTEyNDQzNTk0NTczNTQ3NTIzMjQ0MzI1MzU4OTQ1MjM1OTo1NDQzNTg4NTIzNTU1Nzc1
NTU4NTI0NTU1NDQzNTU1NTU3MjMyNDAwMTEzNDE0NTMwMjIyMjMyNTU1MzU0MzU1NTIvMzIvMjU0
MzUzMjI0NDc1MjQzNTIzMjE1NTM1NTc0MzIxNTU1MTE1MjM3NDg4NDc4NzQ1NDUyMzUzMzMzNTU0
Nzc3NDc0Mzc5NTc1MjMzMzMxMDI0NTQzNDU1NDI6Ojk3NDU1Ozg3MTMzMjU1MTU3ODU5NTU1NTc4
NTM1NzU1NTU3Nzk0MzQvNDo5NTQxNDg3OTczNTUzODc1NDU1OTU0NDg1MzU3OTo4Nzc4Ojc4NTM0
Nzg6OTUxNDE1Nzc0NTU0NTU1NTc1NTU5NzU3ODU0MzU3NTgzNDIzNTU5NTQ1NTk3MzU1NDI3OjU5
OTo4MzM4Ojk0NTk3NzU5ODg3NTg5Ojs3OzU1NTg4OjU3NTc9PTs8Pj45Nzc1Nzc3Mzg7Ojw8NzU4
Ojk1OTk5OjU1OTg7ODc4OTU3OjU4OjU1ODk3Oz07OTg3NTQ1NTk7ODc1ODc3PTo5NzM1PDw6PDo3
NTg5PDk5MzU1NTQ8Ojg1ODk0NzgyNDk1OTo5NTc5OTg4ODc4NzU0ODo7Ojk3Nzk4OTk1NTU4NzUz
NDI1Nzg4NTg1ODg6NzU5OTk5Ozw5Ozg7OjU3NTQ3NTU3Ozk1Mzg6NzU5ODg6ODc6OTk9PDw7MzQ4
PDo1NDU0Ojg3ODk3NzU0NTg6NTc4ODU3Nzo6Ojo3Nzk3ODU6OTg4OTU4ODU5NTU3NzU5OTc5Ozo8
Pjo3ODg4NTg3MzQ3Nzc3NDUzNTUxMzg7OTg4OTc5NTczMTU4Nzk1ODUzNTg3NDg0NTU1NzUyMjU3
Nzc1NDU4MzU4MjQ3MzQ0NzU5NTQ1MzEzMzE1NzI1NTU1NTU0NTQ1ODg1NTQ1Nzo6NTIxMzU1NTMz
MzkzLzI1MzMyNzg1Nzc3NDE1MzEzNTQ1NTU1ODU3NTUyMzM1NTU4NzM1Ozw6NTc4NTU1MzMzNTU1
NTc1ODkzMzU1NTMzODc3MzM0NDU3NTQzMzQwNDgzNTM0MTQ1NDU3NTMzNzg6ODUyMjU0Mzc5NTU0
NDk1NDEyMzQ3ODc3OTc1MTM1NTk0OTU1NTUyOTk1NTk3NTU4NTc4ODk6MjQ1NDU6Ojg1ODs1NzM1
NTg1NzU1NTk3MjU4ODo6Ojc1NDo3Nzo3NTc5NzU3Ojk1OTc1NTM1Mzc1OTU1NDM1MzU1NDU1MTI5
NDU1MzQ1Nzc3NTc3NzQ1OTc1ODo1NDQ1NDk4ODc4Nzk1NTg0NTc1NTQ1OTU4NDM1OjU1NDQzNTg6
OTc1ODk4OTg3Nzk4OTU1NT01MzU3OTg5ODQyMzU3Nzc4NTU1NTc4NTU0MTU0NTc3Nzg4OTc1NTM0
NTU0MTE3NTo3NDM3ODQzNTUzNDE1NDQxNTc6PDU4Ojc1OT04NDU1NTg1Nzc6PDc3OTc0Nzg1Nzg6
ODU4Ojk3NTg7ODc3ODo6OTQ0ODw3OTg1Nzg7Pjo5Ojk6PTpAPDs6OT09Ozs8Pjs5PD09Ozk8NTs+
PTw9Pj06OTg9Pjw5ODc9PDo+Ozc6Ozs4NTk+Ojw+PD09Pj48PTs8Pj49PEA9OT06PDs7Ozw9PT4+
Ozs5Ozk6OzxBQD07Ozw6PD0+Pjw9OT0+QTs6Ozg6Oz0+PDs3Ozs7Pj4+Pj0+Ojk9OTw9Ojk8Ozk6
PD09Pjw+Ojs6PDw8PDw7OjxBQTw+PTw7PDo6Pj4+Pj09PDo4ODw7Oj0+Pjw8Ojk5Ozw+Pj49QT49
ODw9QDs9PTk7Ozk4ODk7Oz48OTs8Ojw9PDg4PD07PTs8PT09PD0+PTw7OjtAPj08PDs8Ozs7Pjg7
Pi4yMy8yNTUwMjQyLzM0MzEwLjEwMDI0Mi4xMjAvMjAyMjIyNDExMzM0NTMvMTIuMTIzMjE1ODUy
LDAyMjM1NDMxNTQxMDIzMjAxMDExNTQzMzM0NTUzMzc0MjQyMTAzNDI1NTUzMjQzMjIxMDAyMzE1
Nzc0LzU1NDQ0MzIyNDQyMy8vMzU1MC41NTE0ODUyMjgxMTExMTMwMTExMTczMjMzMTUwMTQ1NDAw
MDA1Mi4xNDU3MjM0MTEyNTg1NTMxMzUwLDQzNDEyMzMwMDQzMzUyNDIzMDAwLzIxMTExMzQyMzU0
MTQyMzQ0MjA0MjEuNDMzMDQyMzUxNTczMDQ0MTEzMDIyMzEsMTQ1MzUvLzAzNzMyMzQ1MzM0MzI1
NDIzMzc4MzEyMzQzNTI0NDMvMTMxMjMwMTMzNDQyNDQ0NCsuMzQzNTU0NTUyMjIxMDM0MzMxNDQ0
MzMzMTMzNTUyNTQzNTg0NDMyNTU0Nzg1NTE0NTU0MTU1NTg1NTU4NDMzMzU1NTMzNDc1MzI1NDI1
NDE3ODk3ODczMjQ1ODU0NTQyMTA1MzIxNTUyNDU5Ojc4Nzg1NDI1NTs0NDMzNTQzNTg0NTU0NTMy
MjI0Nzg1MTAzMzI0NzU4ODUzNDUyMjU1ODk1MzUyNTc3NTUzMzQzMjQzMS8xMzI1MzQxNTc1MzIy
MzU3NzUzNS8vLi8zLzEvNTIyMzQyNzc1NzU1NDU1NTk1MjU0NTMzMTczNTU0MTUzMzgxMjE0NTU1
NTU1ODMzMzM0NTU1MzQ1MzEzMjUzMzg0MzM0MjUzNTQ1NzE1NTQ0MzIzNTU0NTMxMzQvLzM0NDU1
ODUxNTU0MzQ4OjU0NTU0NzozNTg1OTIyMTE4NTMxNDU1OjQ0NDU0NTU3NzU1NTU1NDcyMzU1NzU1
MzM0NTU3NDM4NTUzNTI1NTUzNDAzMzQ1NDQ0NDU1OjcyOTUxMzc1NDU1NzU0NTU5NzQ4NTMzMzQ3
MzA3NDU1MzE1NDQ4OTgzNDIzNDU1MjU4NzU1NTQzNTU0NTc1NTU3NTI3NDUxMzM1NTU3NTU3OTIy
MjEwNDg1MjU4NTQ0MzM3MzU4NTQ0NTUzNTc0OTMxMjM1Mzc1MzEzMzUzNTE0NTU0MS8zNzc1ODMx
NTUyMzczMDU0ODIwNTg1NTMyNDIyMzM1NTQxNTU1MzUyMjM3ODU1NTU0MTQzNTcyLzI1NDc3ODU3
NTIzMzc1NDc5OTUzNTU1OTU1OTg1NTU0NTI1NTc4NTIxNTg1Nzk3Nzg7NzUzNTk3Nzc1Nzg4OTc3
OTk1OTk7PDg1NTk3ODo4Nzg1OjMxNTg3OTc6ODk4OTo4Ozc1ODg5Ozc5PDw3ODo9PD0+Ozc7Ozk9
OjU5Ojo3OTU6Ozk7ODU1ODk3ODs6NTg1Nzc6Ojg4Ojk5Ojo3ODg1ODU7MjI1NTk3OTo8ODQ3NDU1
NTU3PDU1NTk4OTUzMzc0NTc1Nzc3Oj06NTU7Ojc3ODo7Ozc4NDU3NDQ7Ozc4ODU3Nzg1NTc6Nzs4
OTc1ODg1OTU0MjU1Nzs9OjU4OjcyMzU4OTQ0NTc3NTc3Ozg5ODg5OTg3NTk7Ozg1ODk6NTk1NDUz
NDg1Nzk5ODk1NDc4OTo4Nzg6OjgzMzU5ODc0NTc7NzU5Ojo1ODQ1NTc6OTo6NzU1NTU3ODk5OTc7
ODc6OTg3NzU3ODc1NTc5NTU4NTU1NzQ3OTg4Nzk3ODw5NTMzOjk8NzEyNTUyNTU0NTU0NDc1MzQ1
Nzc1NTU1ODc6ODc3Ojg1MzU4Nzk1OjUzODc4NTg3NzMzMTI1OD01MzQ4NTQ1NTU1MzU7ODU7OTo6
Ojk4Nzc1NTU3Nzg1NzMvNTgzNTQ1NTc0NzM0NTQ1NzM3NTg6NTc4ODg1MDQ1NDc4NTU4OTg3MzQ0
NTc6OTU1NDQzNDU1NTU1NzI0MjU1NTU5ODc1NDIwMjM1NTU0MTU1NDU1ODU3NDI1Mi4vMzU0NTQz
NzczNDU1Mzc3MjQ3NzQzNDc3NDU1OTU1NDg3ODc3NDIzMzI1NTo5NTU6Ozo1NDk3NDU3NTQ1NDU1
NTc3NTM1NzU3NTs4NTk4NzU4OTg3NTU0MzQ0NTc3MzI0MzU3OTg5NTgwODk1NTg5NDg3Mzk7OTcz
NDQ0NTU5Nzc6Nzc0OTU1NzU1ODc1OTk3OTc1Nzc4ODc5NDU1Ojo3ODk4ODU0NzM0NTU1NTg3NTU0
MzM5NTM1NDU1NTQ3Mzc6Ozg0NTU1Nzo3NTQ5Ozc1NDg5NTc1MzU5Ojg6NTc1MjU4NTU1Mzg1NzQ4
ODc1NzU3NTMzNzk3ODU3Nzk0ODU3OTc1Mi85NDc4NTc3ODk4Nzk4NzU4OTk3NTU1NTU4Ojc1NTc3
Ojo8OTg1NTk1NTk6ODg5ODU7OTk5OzQ1Ojc5Ozo8Ozw7Ozc6OT5AQTw5Ojg4PDo5Pjo8QkI6PDk8
Ojs7PD05NzU8Ozo8PD4+PD08PDs+PDs8Ojw9Pj48Ojo5Oj08PDs7PD08PT4+QD05OTk4Pjk0PDw9
Ozs7Pjs4PD47Ojk3Oz08Ojo8PDo8PDs7Ojw+PD06PDs7Ojg8Ozs8Ojk9PD0+PDk6Oz05PDw9Pj48
PDo5PUA8PTtAQj47Oz05Pjw9ODs8Oj4+QUA+PT47Ojs6Ozk+Pjo8PT07ODs9Ozo+PT0+Ojw+Ojo8
Pjw+Pj1APjc4OTw1OTs7PT49Ozs5PDg7Ozo8Ozg6PTo9PT05ODs8Ojo4O0A+Ozk4PTo7Ojg7Mi4s
NTMvLzIyMjIwLzAvLzMxMTExMDQsMDEwMTQxLi8xLzM0NDEzNTQxLCwxMzEzMDAyMzI0MzQ0MjUx
Mi8vMTIyMC4sMi8xNTQwMjUyMzEwMjUzLjI1NDEvMjQzMTExMzIwMTAvMDQzMjc1MzU3NzM1NTky
MTQyMS8yMS4wMCw0NDEyNTM0NTUzNTQvMTE0NTUyMjQ1MjE0MzI0NTM0NDU0NTQ0MzUyMjczLzI0
MzQzNDUyMjQvLzQ1MzIvMzMyNTEyMzMyMjQ0NDAzMzIxNDAzMTQ1MjM1NDEuMzAzNDQ0NTUxNTU3
MzAyMzIyNTIzNTQ0MzU0NDM0MzU1NDMyMzU1MzI0NTQ1NzU1MTM1NTEyMDI3MzI1NTQyMzEzNDU1
Nzc0NTM1NDM0MjQ1NTQ3NTMxMzQyNDE1NTM1ODcyNDM1NDI1NDIyNTA1NTM1ODo0NDQ1NDQ1MzMz
NTM0MzM0NDU3MzU0MzU1NDU1NDQ3MzM1NTQ1MzU3NzUzMjQyMzE0NDUyMTE0MzQ0MzMyNTMzNTQw
MTQ1MzM1NTMzMjQ1NTU1NTQ0MjcyNDg1ODU0NDo3MzQ0NTo4NDMxMDMyMzU0NTU0MzQ0Nzg1ODc0
NTc0MzM1NzM1NTQ1NTg1MjMzMTUzNDQ0MTU1NTc1NTMyMjUxNDM0NTU1NDMzMzIyMTM1MjI5NzMz
MzAyNTg1NDMzMTEyMzQyNTk1MjUzLjQ1MzAsMTUxMDIwMzIzNTIvMTQxNDU1NDQ1MzQxNTE1ODIu
NTU1NDQ0NDQ1NDEyNTQzMDU1MzE0MjQyMzQ0MzQxNTM0MjEzMzM1MzAzNTU4NTU1NTMzNTcyLzIz
MS8xMzU4NTQwNDEyNTo7NTI3MTE3OTUzNTU3NTc3NzU3NTc1MzU0MjM1NDc1NTg0NTQ1NTg1NDc5
ODo3NDQ0NzU0MzIyNTEzNDM0Mjc1MjQ1NDM0MjE1NTQ1MTE1NDQ1MzIxNTg1NDU0NTc3NTE0OTc1
NTc1NDU3NTI1NTMzNzU1NDMyNTg0NTg1NzU1NDU0NDI1NTM1NDc0NDI1NTI0NzU4NzQ5NTg1NDcz
MzU1MzI3NDg4NTM1Nzg0NTU1NTQ1OTUzNTU1NzQ0NTU1MzM0MjI1MzQ5NTU3ODc1MjIwNzUyMzg5
OTExNDM0NTU1ODg0MzU0NDQ1Mjk5ODEyNTQzMzU0NTU1Nzk4NDQxMjQ0NTc3NTU0NTU0NTMxODk3
ODg1ODg1MzQ1NDU1NTg6NTU1NDU3NTs3NzU1NTcyNTg3OTs3OTs5NTU4Ojg4Ojg4ODk4OTc3NTc3
MzU5NzU1OTs3Ozk3Ojo4NTw7NTc3NDM1OTg4NTk3Nzs1ODg6ODc1ODU4ODk4NDc6ODg4ODc7OTc1
ODU+PDg5ODk5OTk7Ozw9Pjk4Nzc5OTk6ODs6PDs4NDc3NzU6OjQ1NTU4Ojs4ODo8OTk7OTc6OTo1
Mzc3Nzg3NTk5NzU8PTo6NTU1OTo4NzU4ODU0NTw3PDg1NDM1NTQ5ODo4OTk1NTo1NDU1ODk4OTs8
ODk4OTs5NTc1NDU5PDk1NTc4ODg9OTk1NDg6OTg5OTU1OTg1ODg7OTg4ODk4Ojo3NTg3NTU4Nzc3
ODQ1NTk4NDc4NTU4NTo5OTc1ODM3NzU3Ojs7PDU4NTk3NDc4ODk1OTo1NTQ1NTc1Nzg4NzE1NDU1
OTUyODk3NTAwNDU0MjU0NDQ5NTU1Ojo5ODM3NTAyNTg5NTU0NDA1NTA0NTc1ODQxNTg4NDU0NTQ1
NDM1NTExNDg4ODI0NTU0MzQ1NzQyOTQyMzM1NzMxNzU1NzU3NTQ1NDE1NTI1NzUxNDQzNDMzNDQ1
MjI1MzMzNzU1NTU1NTU0MjQzNTc1MzQ4NTc1NTU3NTU0MTU4NDM1NTQ1MTM1NTI1ODU1ODU1NTg4
NzU5OTU1NTU0NTIzNTU1NTM1NTU0NDU1MjQ0NTUzNTU0MjQ1Nzc1NTQ4NzMzNzc0MzAwNzU1NTU4
NTI1NDM1OTQzNTcxNDgzNDE1ODg4OTo6Nzo4Nzo5NTc1NTUzMjQ3Nzc6OjU3OTg5NDU1NTg6OzI3
OTw6NDU1MzQ1ODQyNTg3NTU3Nz47NTU3NTg3NzQ0ODQ3NTc3NTc8Ojg5Nzk4NDQ4Ojg6OTg6OjU3
OTc0NTU5NTQ1Mzc5OTg4OTU1NDM0OzgzNTk4NTc3Nzo3NTIxNDI3NDc1NTU0NTU1NDU5OTg4NzU1
NTU1NDc1NTU6OTU1ODU1OTc4NzgzNzg1NTg3NTQ4ODU0MzU4NTU3Nzw6NzU0Nzc3NzQ0NzU4Ozs6
ODU1MjA0MDA0NDU1NTUxMjg4NTMyNzU3NTU4NDU1NTU1Nzk6NTU3Ojg6Ozo4ODg6ODg3NDU4NTU3
Nzg5Nzg5PD05NTU5NTk4Ojg1ODo5Nzo6OTo8Pjs4Ojw7OTg5PT45OTo9Ojw8Ojg5Ojs6OTg9PT09
QD48ODk6PUA+Pjg6Oj07Pjs9PD46PDk6Pjs5PTs7PDw6Ojo7Pjk8PD4+Oz49Pj48Ojo4OTo6OT06
Ojo3PT47PDs+PDs5ODw7PDk5Ojk3Ojs6PDo7PDU6PkM9OTk4Ojk8Ojs8PDg6ODs7PTw9PD0+PTs+
PTs7PDs7Ojo5OTk4OT4+ODw6OTo5PT49ODg3Ozw9PThAPjo5Ojw+Pjs+Pj09PDs9Pjo6Ozk5OTk5
OTg4Ozo6NDg9PDs+Ojk9Pjo7Ozs7PDk6OTs+Ozw7OTs4ODs+Ozk4Oz0+PDo6Ojo6NzoxMjIxMTAx
NDMxNDIxNTUzNDIyMDAwMjAuLjExMTA1NC4vLCwwMTIwMTExMjIxMjIzLy8yMTM1MDQyMDI0MDIy
NDQyMjAwMzEvMC8uMDIyNDEzNDM4MjIyMTMyMjIzNDMzMTE0NDU0MTAyMzU1MjE1NDQxMDEyMjI0
NDM1NzQ0NTQwMTQ1NTIyMjA0NTQzMzAuMjUzMDQzMzIwLDMxLzMxMDQ0NDMxMTAyMi40NDI0NTM1
MTI1NTUzMjIvLzI1MTIwLzI1NC8xMi8uMjAwODc0MDEyMzQ0MjQvMTI0ODMyMTAyNDMzNTIvMzE0
MzI4NTU1NDQ1NDM0NTMxNDUyMzE0MzU1MDAyMzU1NDUyNDQvLjIzNDQ0MTAxMTUyMjQ5ODU3NTI4
MTAzNDI3NTIyMDIxMjUwMzQ1Nzc3NTI0NTMzMjU1ODc3MzIvMzU1NTQ1NTQ0MjU1ODMxMzMvMDc4
NTU0NDU1Nzc1My8wMzIzNDQzMjU1NTMzMjc4NTIyNzU1MzU1NTMyNzc1NTIxMDIyNDU1NTQyMjI0
NTQ1NTU3NTc1NTk3NTU3Nzg4ODU0ODU0Nzk5NDU3Nzc1MzIxMjQ3MzE3NTQzNDc4NzMzNTc0NDUz
MjQyNzU1NzcwMDI1NTc1MTE0NTg1NTQ0NzQ0NzU0NTk1MzU4NzU3NTQ1NzQzMjI4OTU0NDU5ODM1
MjMzMzQ4NTMxMzMyMTMwNDM1NDMxMzMyNTU1ODIxNTU3MzAxLzIyMjU1OTk1MzU4MzAxMzI3NTU1
Nzc0MTQ0NTMxNDU1NTQxMjU3NTIyMzMxMDU0NTUyMjM3NC8xMjU0MTM3NDUzMzAyMjM1NTQ0Mzc3
NTQ3OTUzNTQxMTEwNTQzNzk3OTQ1NTU1NDM1MTEzMjI0ODUxNTM1NTUyMjU0MTQzMjQ0NTg9OjMy
NTU4NDQ1MjM1NTU3NTIzNDM0Li81MzIyNTU1NTU1NDgyNTU0MzU5OTQ3NTU1NDM4NTc0NTU1NDMw
MzQ0MzA0MzM1NTc3Nzg0MTMzNTU4NDMyNTc1NzU1MzE1ODk4NTQ1NDU1NDE0NTczNTU3NTQ3NTIz
MjM3Mjc3NDgzNTQzNTQ5ODM0MjQzNDM1NTU0NTM1NTU5NTE4NDI0MjU1MzI1NTU3NTE1NDk4NTM0
NTU1ODk3NTc1MzU3NTc1NzU3NDU1NTU1NTU1MzQ1NTo0NDU1ODM0NTU1ODg1MzU3MzUyNDU1NTU0
NTg0NTQzMzc4NTQ1NDU1NTQ4Ozc1NTc4ODs4Mzg5ODw3NTU4NTQ0Nzs0ODc3NTc4NDc1NDg3NDU1
OT05NTc+PDk3OTo7OjU0Mzc6ODc5Ojk1NTw7Ozo5ODk4OTk7NDk4OTc6OTo8Oz06OTo8Nzk4Ozc5
Ozk6ODg1OD46NTg4Ojk3ODU4OTk7OTc6Ozk5NDg4NTQzNzg7ODU6ODk3ODk3Nzo3ODk5ODw6PT04
NTg1NzU4Ojc1ODk7ODU1Nzk0OTk7NTo1NTQ1Ozc4Nzg3NTo6NTU3ODc5PDg1Nzg4NTQ3ODk5NzU4
OTU1NTk1NzQ1Mzc9OzU3Nzk1NTU1NTs1OTg5Ojg3OTg8NTg6Ozg5NTU5ODU1NTs4NTU4ODk1NTg5
ODo5NzU1NTU0NzU1Nzw4Ojo4Ozk1NTk5OTk6Ojc4Nzo6Ojk5OTg6OTU1NTQ3NTs6NDQ1NTc6ODUy
MTU4NTUzNTc4ODg1NTo3Ojo3OTo6OTQzNTc1ODk6NzM0NDU1Nzk6OTU3NTU1NDU6NTQyMzg4NzU3
NDU1NTM1Ojk3MzM1Nzc0NTcyNDo1NTs5NzU3NTc1NzI1NzU1NzU0NTU0NzQ0NTc1MzM3NDU4NTMz
OTQ1OjU4OTgzMzc4PDUzNTc5Ojc3NTU5ODQ1OTkyNzU3NTc0NDU3Nzc1NTU4NDc6OTc5Nzc4NTM0
NTU4NDQzMzU3NTg6NTc4ODQ0NTU1NTU6ODg4NTU4NzU3NTU1NTc1NDU0ODc1NTQzNTU6NTU1NDc1
NTc0MzM0NzU1OTk6OTczMjQxNDk0MjU3NTc1MzU1NDQzNTU1ODc4NTg6ODMzNzg5OTg5OjU4NTc1
Ojg3OTU1NTc5MzQ1ODU4ODc3OTk4NTQ3NTk1MzUzMzc4NzU3NDU3ODc1NTc1OTQzNTU0NzU3OzU5
NzU3OTU5ODU5PTc0MTU3OTc6Nzg1Mzg1ODo6NTg4ODc1OTg5Nzc1NTU3OzczOjs1NTc5NDU7Ozc5
Ojg0NDc4NzUzMjU4NDQ1ODc1NDQ1NDc1OTc0ODg4OTs0MzIyODU0NTQ4ODo3NzU4Nzc4ODU1NTU5
MzQ1MzU1OTczNzk3PDk4Ojo5OTs4ODQ0NTg3Nzk1OTc1OTo4OTU3Ojs6OT08OjQ1ODo6PDc1OTc3
NzQ3Nzs8Ozk6Ozo7ODg3ODk4ODs7Nzk6OTk4Ojo5ODk5OTo6PTk5Pjs8OTo8NzU3Ojg5Ojo3OD48
Pj06PDs7Ozo6NTo4ODw8Pj07PTs7PT48Ozs6Ojs8PTs6OTs8Ozc7QD0+QD49PDk4Pj05OTg3OD0+
Ozo7NTo9Ojs+Pjc5Ozg1PDw5Ozo8OTs8Ojo8Pjo4OT46OTo9PTw8Pj46Ozk7PD06Oz07ODw8PTw+
PDw8Nzg9OT4+PTs5OTg6ODc6PTw+PTs+Pjw4Oj4+Ozo7Pjw5PTo8PkA9Ozs7OTo8Ozs7QD0+Ozo5
OTg8Pj4+QD48PDU5Ojw+PTs8PD08OT07QD49QT4+Pj08Ozk8QT4+Pj07PT09PjEzMjAvLi4zMjIz
LzIyLC8zMzQ1NDU0MzEyMzAyMjEyMjQ0Mzc0NTUxMDAyNDcwNDEvMDQ3NDIyMzQxMTAxMy8yODc3
MzIyMzU3NTc1MzQxNDU0MjAwMTUyMTIzMTMzMjM1NzU1NDAyNDUzMTM1LzE1NTM0LzIzMzQ1MjM0
NTEyNTQxLzQ1MTEzMzM3NTQyMzU1NTIvMzQ0My80NDE0NDM0MDU1NDQ3OTQyMjMxMzcyMDEuLjMy
MDQzNTIwMzQ1NDQyMjM0MjIzMzEwMzEwMTMzNDU0NTMzMTU0NDUzMzMwMjIzNTQ0MzQyMzUzMDAw
Mi8yNTAwNTU0MTIvMzQwMjU0MjEyNTIzMjUzMjIyMzIuMDMyMTEyMTM0MzIyNDAzMzQzNDc1MDEz
Mzc1MzMzNDE3NDIzMjQ3NDEwNTczMjQzMjQ1NDU3ODU0MjU1NTUyMDIyMzQ0NzQxNTc3NTEsMTU3
NTUyMzQ1MzU0NTg3OTMyMzQzNTc3NTQ4NTQzNTU0NTQ5MjIzMjU0NzI0NDQzMjQyNDUyODEzNDIx
NTUzMzA0MzM3My8xNTMzNTU0NzM0NzUzMzMzMzQ0NTUzMjIyNzo3MzI0NTIzODI1NTc4NDQ3NDEw
NTUzNTQ1NDg1NDcyNTk0NDQ1ODU0NDM1MTE0My8yNTUzMzM3NTg3NTIyNDU1MzMyNDU0MzIzMzQy
MzMzNTU0ODczNTUxMTM0MjQ1NDU1MTM1NDIzMjM1MTIvNDUxNDUzNDUzMTIyODk1Mzc0NTIyNDQx
NDIyNTg0MzU0MzAyNDU0MjU3MjE0MjI0MjExMTIzMTIzMjAxMDI1NTc4ODE0NTU1NTIzNzQ1NDg3
NTUyMzUxMzU1NTU1NTU0Nzc0MjEyNDQ1MjExMjM0MjM0NDQyMzEzNTMyNTgzNTMzNTUyNDQyMTU6
NTUyMzc1NDU5NTc1ODU3NTQ1NTU1NDIwMzAxMjQyNTMzNTM0MzQ1NDUzNTQ0NzQwMzUzMTQyNTM0
ODUyMjUzNTU1Nzc0ODUyNDUzMzIzMzU1NTUxMTAwMzI0NzQ0NTUyMzE0NTU0NzU1NDUzNTQyNTU1
NDU1NDQ1Nzo5MTIyNDM1NTU1OTczMjIzNTc0NTU3MzUyMzIyNDUzMzg5NzU1NDU1NTU1NzQ1NzQ0
NDU0NzU3NTM1MzQ3Ojg0NTc1NTU1MzM3NTUzNzQ3NDc4NTc3Nzg5OTQxNzk1ODU1NDg4MzM4NTQ4
NTQ1Nzg1OTg5NzM4OjU4NTEzOTU3Nzk6OTUzNzk6Ozo4NTc3Ojw6OTo4NTc1Nzo1Nzk7OTo3OjU3
ODU3Ozk4NTU4NDU1NTI1MjU1NTs9OTo4NTg1NTU4OTc5Ozs9Ojo5OTc4ODo7Ozk3NTQ1NTk7Ojk6
OTo4NTU5OTo1NTc6Pjg4Nzc4ODg1NDU3Nzc5Ozg5ODU1Nzo5OTc4Ojc1ODw3ODs4NTM1Ojs0ODo3
NTU3ODQ3NTQ4NTg5PDg1Mzg6Nzo5Ojc4OTo3ODU3NTQ4NTU4NTg1Nzc1NTg9OTk1NTQ3NTU4ODUz
Nzc0NTc4Ozk3Nzo3Nzk4NTc6Nzc4ODo5ODo7Ozc0NTU1NTU4NDU0NTU3Ozs+PTU1NDU1OzUzNTk3
NTU7OzU4OjU5Ojk1MjU3Nzk5ODs6NTc1NTk6ODc0NTU4NTg0MTU3NzU1NzQ3OzU1NTg1MjI3OjM3
ODU3Mzc1NzU1ODk1MzM3NzU3MjQzMzU5OTQzNzU1NTQ3Ojc5NzU0NzU3ODczMzQ3NDc3NzU1OTk3
MzU1ODo4NTk1NDExMzU3NTQ0NTc3Ojc4NTQ1MzU1NTU1MjQ1NTI1NTc4NzU0NDc1MzU1NTk1NTQ6
OTU3NTU0NTc1ODU0NDU1NDc3MzU1NTU1NTg1MzU1NDQ1NDc5MzIyNTU0NzgyNTgxNzs0NDI1ODs5
Nzg4NzU1ODc4NTU1ODUzNTg4ODk4MDM0MzU1MzI0NzUxMjU4NzU0NTg0NDg4NTUzODc1MjQ0MTMy
NDI0NTU3NTk4NTc1NTg7NTczODg0NTc1ODU6NTQ4OjcyNDc1ODg5NTg6Nzk6NzU3NTc4ODU1NTc8
NTQ1MzM3OTk3PDs4NTQ3NTk6OTc0NTU1NTU3Nzc4ODk3ODg5OjQ4ODc1MzMxNDU1NzUzNTU1NDo3
NTc7ODU1NTU4OTQ3NzU3ODk3NTc0NTozNzc1ODU1NTM1OTU1MjQ0MjM5ODg0NTU1NTUzMzk3MzU4
Ozc1NTg3NDQ1Ojc4Nzc5Ojk0NTw7NTU0Nzc4NTU1NTc5NDM0NTg4NTg5NDIzNTU1OTU3NTcxMzQ1
ODQ0ODU4ODk1NTU5Ojc9OzUyNDo5Nzc1MzU1NTU4NzUzNTc5NTg4Ojc8PDk8OTo6Pjg5ODg1NTs7
ODc1Mzg5NTU5Nzc7Ozs6OT06PDs8PTo7ODg8Pjo9QDs5Oz5CPkBAPDU5Oz0+Oz06Ozw9Ozw7PDc4
PTw8Pj09Pj09Ojc3NT07PTo9PDw7PEA+PDs6PT1AQD0+Ozg3OTc1Oj44OT0+PT07PDs8PDc5PTw5
ODw6PTo7Oj07PD08PT48Pjw8PT49Pjs3OTs4PDo7OTo7Ojk6OTk8QD07Ozw6Nzk7PDo5OTw5PDg7
Pjs8Ojo5ODg9Oz08Ojs4Ojc5Pjs3ODs6Oz48OTk9Ozk+Pj05Ozo5Ojg6Pj4+Ojk5PD4+Pjo3OTw6
Oj08PD47PDk6PT08PDo6Nzg4OT46PTs1Nzk8PT47Oz48Ozg7PkA7PkA9MS8uMDIzLzIxMTAwLzAz
NDEyLywuMTMyNDU0MDIzMTEwMTI1NTMuLi4uMTMxNDQzNDU1MjI0MzEyMTIvLzE0MjMxLC8xLi80
MjQxMjMzMS4yNTUzMjIxMjAxLzI1MjEzNTMzMjIzMzAvMzMzMzI4NDIyMTQ0MjQ1MzMxLjU1NTMz
MjMxMTEyNTExNDc0NTMzNTQ1MjU1MTQ1NTUvLzI0MzMzLzEyMjMxMzIwMjUzMjAyMC8wMzUwMzAz
NDU0MzEzMy4yMzEzMDA3NTUwLy4yMjM1LzIyNDAxMjEvMjM0NTQ0NzU0NTU1ODU0NDAyNTgzMTU1
MzQ1NTEwMjQwLzExMjI0NTIzMzU0MzUwMTU1MjIyMDIwMDA0MjQzNDE1My41NTQyNDExMy4xMjMz
NDU1MjIzODU1NTUzMjUzMzU0MzU1NTU1MzIxMzUzMTI0NDUxLzMzMjI1NzIzNTMxNDUyNDMyMzQy
NDE0MTExMjA0NDI1NTI1MzEyMzQ0MzI1OTMyNDU1MjUzNTU1NDQ1NTUyMDIzNDM1MjM0Nzc1NDQ1
NTUzNTQ1NTc3NTQ0MTQ1NTUzNzw3MTIxMi8xMi40NDc1NzU4OjU1MzQ4NTM1NzU1NDE1NDQ0ODU0
MzMyMzIxMDIyNTU1MzU0ODUzNDU1NDEzNTU0NTQ1Nzg1Nzc1NTc1NTU3NzU1MzIvMzQzNDI1MzMz
NTMyMjIyMDQwLzIxMjIyMjIuMjQ1NDMzMzIwMTMzMjEzMzAyNTQwMzIxMzQzMi8xMTQ4NTAxMDIv
MTQxMDAyMjIvMjMyMTQ1NTg1NDAyMTEzMDI0Nzg1NDM0MS8vMzU1MTIxNTIwMjU1MzU0MzIzNDMx
MDQ3NTQ1MzA0MTEyNTU1NTc3NTQ1ODIwNDU1NTIzNDM0NTgzNTU1NTQ4NTQ5NzI1OTc1NTU0NTgz
NDU0NTczNTQyMzM1MzE0NDQ1NTMxNDU1NTQ0Mzg0OTcwNDUzMTUzNTUxMTUyNTUxMTIzMjEzMjU3
NTEwNTc1ODMyNDM1NTM1NDQ1NDU3OTU1NTU3NTU1NTQ1NzQ1NTgzMTU6NDg1OTU3OTUwNDU1ODc0
NTU1NTU1MzU0NTUzMTUzNTQwMDU1NDQxNDQyNTM3NTQzNTQ0NTc1NTU1Nzc1MTUzOjU5MzQ1NDU1
NTM1NTU1NDIzNzgwLzQ1NzQ1NzU1NDg3Nzc1NTc1ODU3NTM4ODUzMzQ1OjU3NTc4NzczNzQ1MjU1
NTU1Mzk6OTU4Nzo1NDc1NTk1ODU5OTU1ODs4ODc5Pj45NTU6NTIyNDU1ODk5Ojk7PTk3OTc1NzU1
Ojg4NTk4NTc5ODs5Ojo7ODU1OTc3ODc5Ojc5NTU1NTc4NzU3ODw5Nzk4OTo5Nzc5OTU1Nzc3NTk6
Ojg5Nzk5Ozw5PjU3ODk6ODU6OTc7Ojk6Nzc1NTk1Nzg3Nzs8PDo6OTs7ODU1ODk4Ojc0NTg4OTk4
Ozk7PDo7Pjo4NTQ0NTk6ODUzNTU3OTU3NTU4Ojc0OTk6NzM1NTU4NDM1ODM5Nzg9NzE1NTg3Nzo7
OTc1NDU8PDc7NzU1OzU4OTk3Nzc6PDc4ODk5ODQ4ODUyOzc1NDU4ODU0Ojg1NTU3ODc3Nzg6Ojo4
NTU4OTo8NDc4Ojg5ODk3NTU3NTQ1Nzk3NTM3ODM6ODc4NTU1Nzg1NTc4NTc5ODk4NTc1Ojk7Ojg4
NTc1ODk3NDI1NDExMzk3MzM1NTg4ODUzNDc5ODg0NDQ3NDU0MjQ1ODU1Nzo5Ozg0NTM0NTg3NTUz
ODo5Nzc0MzU3MjU4NTc1NTU5NTc4Ojk1NDM0NDUzMzQ3ODg3NTc1OTcwNTU0NDI0Ojs1NTc1NTU1
NTM0NzU1NDg3NTU1NTU1NzU1NTM0NTUyNDQzNTI0NTUyNTU1NTQ4NTI0NDIwMzU1ODUzNTU3NzIy
NTMzMzQ1NTU1NTMxNDU0MzU4OjI0ODU1NTk4NTQ0NDUyNDU0Nzc0NTQ3NzU1OTU1MzU1MzU1NTQ1
Nzc0NDU0NDU3NTU1Ojg0NDc1NTk7NTc1NTQ0NDUzMjU3ODU1Ojg4ODQzNTk1NTk4ODU5NTQ1NTg3
MzU4NzU4NzU3OTs1NTg6NTg5Nzc4OTc3NDM1NzU1Mzc6NzU6PTo5MzU1ODU3Mzc4ODk7NzM1NzQ5
ODU5Ozs5NTc5NTc5NzQzODc4NDQ4NzU5ODU3NzU4Nzo6NTg1OTo6OTg5ODU3Mjc6ODk3OjU4Nzc5
NzM3NTM1OzU1NTU3NTc1ODk3ODc0NDc3NTc3NzUyMzU4ODU1NTQ5ODUyMTE0NzU4ODczNzg4MjUz
Mjc1NTQ1MzU1NTk5OTk1ODU1ODc4OjU8OTc4Ojs5Nzc1NTg5NTg3OjU4OTg6PTw1ODk5OTU3NTc6
ODc1Nzg4OTw6NDg1NzU5Nzk1Nzk7Ojo5Ojk8Ojs3OTo8Pj47OTo9OTc5OTw8PTw9PkE7PTs7Ojo7
PDw7PTw9Ojk+Ozw9PkA7OTU4ODw5OTs8Ojs6Ojs9OTw4OTw7ODs6Ojo9Ozs+ODs8Pj4+PDc7Ojg6
Ojo3Pjo5Ojk7PkE+Pjk6OTg9OTo+PkA9Nz05Ojo5PD06Pjo3Oj49PDs8PTw9PTw9ODk+PT09Pjw3
Ojw4Ozs8Ozo3Oz06PDw7Pj08ODo4OTs4OTw6PDw9Pjs6Oz08PTs9Ozs5OD0+PDs4Ozw5Ojw9QD4+
Nzo5Ojo5PDo6Oj4+Ozw9PTs5Pj47Pjw1Ojo7PTs9Ozw+Pj49PjszMjEwNTMyNDQ1NTQyMTAwMTEu
MDEwMzM0MC8xMjMxMzMzNDQyMzQ1NTUzMTMwMjIzNDIwLi40MDQyMjIvMTIwNDMuMzU0MTQyMDM1
MzUwNDUxMTEwMDIyMzMzNTUxMTI0My8yNTI1MzU3NzkwMjEyMTMuNDAyMTE1ODU0MzI0NTUzMjM1
MDAvNDMxMjU1NTQ1NTQ0MzQzNTMzMjEzMTExMDQyNTEwMDEzMTIxMjc5NTMyMzEwLzI0NTMyNDM3
MzI0NDMyLzEwMTMzNTM0MzQwMTI0NDIyMjU0MzMwMTQyLzExLy4wMzMxMzMxLzAyMzIwMTAyMzcy
MjQxLjIxMjAxNDE1MzMvNTQ0NDMyMDI1NTEvMTQ6NDUzNTUyMDIyNDUzMzMzNDc1NzUzNTQ1MzU0
ODg1NTQ0NTU5OjQ1NDQzNTU4NTUyMy8vMTI0MjMzNDQ1NDIyLzIyNTQ0MzUyMzU1MDU3NTM0NDU3
Nzk4NDA1OjU1MzQ1NTQzNDQ1NTMzMDMzMDMxNTIyLzA0MjU5NTM0MzUzNTU1MjIyMzMzMzM1NTU0
NDU0OTU1MzU1NTM1NTU1MzM1NDQyNzU3OjU1MzM1NDU1MzU4NTczNzg0NDc3NTQyMi8yMTAxNDU1
MzI0NDAzMzAyNTg1NTU1NTc3NzQxMzc0NDIyMjM0NTM1NTQ1NDMyNTczMjc1MTEyNDcyNDIyNTQz
NzQzMzQxNDQ0MTIyNTU3NDAuMzk4NTQ0NTM1NDU1NDM1NTI4MTIxNDUxMjU1NzMzMzU1ODgzOTQ3
NTQ0MzU1NDEyMTQ1NTQ1MTE1NDU1NTc1MzU4NTU1NDU1NDU1NTU1OTUyMTMyMjM0NTQ0MDM1ODQz
MjU4NTI1Nzc3NTU1NTk3NTU1ODk1MzU1NTI1Nzc1NTMzMjIzMTMyNDU3Mzc1NTU5ODQyNDc1NDU1
NzU1NzU1Mzc1NTU0MzM5NTg1NTIxMTI1NTQ1NDQ1Mzc3NTc0NTc3NDEvMjIzNDU0MzM0MjQxMzU1
MzU3MzMyNTU1ODU1NTc4OTo4NTM0NDU4NzU1MzUzMzI1NzQ1NDMzNzg1NTU1NTU1NTI0Mjc0Mjg1
MzU1NDUxMjI1NDU1NTMyNTQ1NTg1MTE1NTU1Ly8zMTIyNzU1NTQ0NTU0NTQ0MzQzMzg1Mzc1NDU1
NDU1NTQ0NzU0NTE1NDQ1NzQ3OzU1ODU1NTo3NTUzODc0MjMyMzU4NTI1NTQ1Ozg1OTk4NTc1ODc1
NTU1MDc0Nzc3NDQ1NzQ1NTU1NTQyNDg1NTU1NTU1ODU3Mzk7Ojg5ODc5NTU0OTU1NTU6PTk1Mzg9
Ojg7OTU6Nzs6PTw6NDk4NDo3NTg6OTg1Ojg6Pjo4OD03OTs3ODs5Ozo5OTs5Nzo7ODU1NTg5Nzg4
Nzg3NTg7Ojk5OTU4Nzc1Nzc5Ozc1Nzo6ODc1Nzo5NTg4NTc3NTM3Nzg3NDU0Nzk5ODo5PTs4OTU0
Nzc3NTQ1OTc1Ojo3Ojk5ODU3NTU3Oz03Nzc3OjU1NTU5OTc3NTc3Nzo3NTU3PTo3OTUxMzc5Ozg3
ODg3OTg1NDs5ODU1OTg7OTU3Nzg3ODg4NTk3NTc3Nzc3OTk1NzU3NTU4NTUzNzU4ODo1NTo7PDw5
NzU1NTg1OTk8NzU1OTg4ODk0NDg8NTU0NDU1NDc4ODc1Nzg4OTU6Nzc5Nzc1Nzg5NTU3NTU0NDo0
NTg4MjU5Ojg4NTc3NDM0MTU1NTc3NTc3NzQ1NTU5ODQ0NTU1MzEzNTc3NDg1NDU1MzQyMzM1NTUx
LjMzNDc1NDU3NTQzNTQ1Nzg1NTM0NTIyNTc0Ozk1Ojw7ODg1NDU3Nzc0NDc3NDQ1OjQ0MjU5Ozg0
NTg1Nzg3NTQ1OTk5ODQ0NzU3MTUyMTU3NzQzNTc0MjQ1OTgyMDg1NTM1NTM4ODU0NDI4NTk1NDU1
NTU4ODU1ODg1NTc1NTQ1NTQ0NDk3ODU1NTQ0NTc1Nzc4NTUzMjU5ODU1NTg3NTk1NTk5NTU5NTU0
MTQ4NDU4Ojk1MTM1Nzg1MzU4Ozk3Nzw3NzUzODk3Nzk6NzU0NTU1NDQ3Nzc3OTg6OTo3NTU5NDM4
ODc1ODc0NTo3OTg5ODc1ODU1NTo1NTc1NTQ1Ojs0NTk1Mjc4NDU3OjgzNDg1MzU1MjU1NTc3OTo4
NTU0NzU1NDg1NTM0NDU6ODs4OTg0Mzc5OTg5NTU0NDQ1OTQzMTIyMjM0NTM0NzU1Mzc0NTc4NTQ4
NTU4NzU1ODU1NzMyMzUyNTc1NDU4OD05NTc1NTU1NTU1NTU4ODQ4NTg5ODo5NTU1ODU1NTQ4Ozs1
Nzg4ODg4ODU4Ojc1NTk6Pj05NTU6Ojo6NzU1OTU4OTk3NzU1Ojo5Nzs4ODw6OTo6Ojc3OT07Ojo3
ODo3NTg8Ozc1Nzo9OTc3ODo7OTw5PTk4Ojo5Nzo7PT07Ojk7OzU3Ojo9Pjo7Nzk9OTo9OTpBPj46
OTs+Ojw8PT4+Pjo8Oz4+Pj08Nzo6PT1BOz07OTo9Ozo9ODs9Pj07PDw8PDw4Ozs8PT05Ozg4ODs7
Pjo4PTw5Ojs9Ojk6OTs9Ozo3PDo5PD0+PTs8PT4+Ozo6PT49ODc7Pj4+Pj4+PEA+Ojg8Ojg5Pjs7
PD45PTw7Pj4+Pjs5Oz48PD09Ozs8PDs6Ojs8Oz1BPTw6Pj5BPj45Ojo9PDs+PEBDPjc5Pj08OUJB
PTk6Ozo5PDo5Ozg9Pjk5Ojo9QDw8Pj05OTo8PTw5Ozk8QDE1MS4uLy4yNTAyMC8wLy4xMDQ1LDAw
MjEwLjEyMDMvMTI0LzAzMjEwLywwMi8xMzAuMDMxLy8wNTUvLy8yMjM0NTIyNDU1ODc4NTMxMjM1
NTQ3NTQ0MzEvLDAxMi8xMDAzMy8yNDEyNTExNTUzNDU1MjM1MzM1MzI1NTQ3NTQzNTQ3ODg0MjEz
MzQzNDE1NDIyNTQxMTUyMzIzMTM0MjE1NTQ0MjEyMzEzNDU4MzQ0MzQzNDU1Mzg3NDIyMjAuMjcz
MjAxNC8xLjMxMDI0MjI0MTIyMDEyNDU0NTQxMjU0MzMyMzUvMDU3NTMvMDI0MjEyNDU1MjMxMjM1
MzA1NTI1NTQ0NTUyNDMzLDE1MTU0MTAvLzI1NTU1NDQyMjM0NDMzNTQ3NzUzMTAzMTMzMjMzNTU0
NTI0NTUyNDc0ODIxMDU1NTIwMjU0NTo4NTU1MTQ0MzQzMzMwMzMzNTQ1MzIyNTU4ODs4NTI1ODU1
NTM0NTIyMTQ1NTkzNTUzNDU1OTk3NTM1NTMxLzIzMjExMy81MzM1OTUyNDk1NTEyMTE6NDU1MzIx
MTMuLzIyNTUxMTEzNTI0NDU0MzMzMzQ5NTU3NTU1ODk1NDU6Ojs1Nzk3NzU1NDU1NDUzNTM1OTU1
MjQ1Mzc5ODs1MTAxMzU1Mzc0MDEyNDIxMzU4NTU0NTU3NTQ1MzQwODc3NTU1NTc0MjI1NzIyMjQ1
MzUyMzAyMzQwLjEyMDMxMC4vMDA0NTU1NTEwMTIzMzQwLywwMzMxNDIwMjE1LzIyMTAuMTUzMzQz
NTUvMTQvMzI0NS8xMTQ1NTU1NDMzNTQyMy8xMzI1NzIwMzU0NTU0NTU0MjEyNTUzNTQyMjQ4NzUy
NTUvMzU0NDU4MzU1MzU3NTUzMzU3NTUzMzUyNTU0MjU1NTM1MDI1NTU1MzI0NTg1Mzc1ODQzNTU4
NDI0MzU0NzU1NzI1MjM1NTQ4NzM1NDU1NTU0MjQ1NTQ0MjQ0ODU1NTU0MjUzNTIyMzM0MTQ4NTg3
MjE1NTU0NDIyNTU1MjU0NTI0NTUxNTQvMjQ0ODQ1ODk3OTU1MzQ1MjU1NDQ1MTA0MjIxNzU0NTI1
NTM1NTc0NTU6ODMzNDMzNzU0MzU0Nzg5MjIzNTc5ODQ1NzEzNzQ3OTUxMDQzNDQ0NDU4NzUzNTUw
NTc3ODMxMzU1NTg1ODU1NTU3OTo0MjU4NDQ3NTU1NTU1NTc3NTU1OTU1NTU1NzU3NTk1MzM1NTUy
NTQ1NTU0Ojc3NDg1MzM0Nzc1NDk3NTg4NzU0OTo4Ojg5ODg1NTc3NTg5ODo3Oj04OTg5OjQ5PTs1
Nzs6Ozo3Nzg3Ojk5Nzg1NTc7OjU1NTo4NTg3Nz08Ozg5Ojo3Nzk4Ojk+OTU1ODg3NTU7ODg4Nzk1
ODc5OTk3ODU4Ojo4ODk4Nzg3NTU5Ojg4ODM3OzUzNTg7ODc6Nzg6NTU3NTU4Ojc3Nzg4PDs1NDg3
NDg4ODg4NTs7PDo3Nzg5Ozs4Oj06ODg4Nzo7NzU6NTU4NTU1NDQzNTU1NTc6Ozk6ODc3NTc6NTs3
NTk5NzU4NTU4OTs6ODc4OTU5OjU1Nzs3OTMzNDI1OzczNTQ3Nzc5Nzc1Nzc5Ozk5NTs3Nzk4NzU1
NTMzNTU3Ozk3OTg5Ojo3NTk6OTk+ODQzNzU4NTQ4ODc1NzUyNDg3NzU1OTk1Mzg3Ojk4NTUzNTg4
NTQ0NTc4OjU3OTc1ODs1NTU1NTU0NTozNzE1NTQzNTc1NTU1NTczMTQ3ODg5ODU1NzU3NTQ1NTU1
MTAzNzMyNzc3NDQ0NTo4NTU0NzU5NTU4NTU1Nzc1NzM1Nzc1NDc1NDU7OTE0ODc1NTQ4MzQ3OjU0
MC81OTk1NTUzMjI0MjQxNTcyNzk4OTU0NTg1NTQ1NTc4MjEzNDc3NzQ0NTU1NTQ0NDc3NTE1NTU1
NDUzMzU1NTU0MzM5MzU0ODU5OTw1NDU1NzUzNDM1MjQ1NTg3OTg1NTQ0NTU1NzMzNTk4NTM4ODg4
NDU3NzU3Nzg6OjUzMTM0ODU0NTc1MzIzNDQ1NTU6NTU4NDQ1Ozk4NzU5NTQzNTo3MzQ4ODUyMzU4
NTQvMDU4NDg4NTU4NDU5MzQ1NTg7NTQ0NDI1NDI0NDM1Nzs5NTU1ODo0NTUzMzU3NTg6Ojg4NTc4
ODc0ODU3NTg6Ojo7Ojc1OTo4ODc1NzU0NzU1NTk4NTk5NTU0NTU1OTg3Nzc4OTc0MjQ1NzUzNDQ5
NzM3NDU1ODc1OzU1OjQ1NTQyNzc3NDU3PDUwNzU3Nzc1MzU3NDg1NTQ0OTk1NTU4ODg7NDE1OTU0
NTU1NzU1NDM4NTQ0NTc5PDk1NTg3MTU6Nzg1Nzc1NzU1Nzc5ODQ3NTg4NTg5OTo7OjU1OTg4NTk3
OTU4Ozg1OTo8PDs3Pjw6PkA7NTs6Nzk7PDg4PDg3ODs8OTw5OTg+PT47Ojs+Pjo5Ojk+PTw1Nzk9
Pj08PDs7Pjw6PD4+PD49OTk6PD4+Oz4+PTk7PTs7PTk8PD48Ozs6PDo7PkI9Oj06Pjw7PDs8OTs6
Ojo6Pj47PD4+Ojk4Ojk5PT4+Ozo5Ozk3OTs8Ozs1OT47PD09QEFAOzs8PTxBPTk6OTk8PDo7OTc6
Ozs7PTg1Ozo7Ojk7PT06Pjw6PTw6PUFBPD46ODk6Ozo6Pjo5Pj48Pj5AQT09Pj0+OkE8Pjk6Pjw+
Pj49Pjs8Pj47Ozw8PTs+Pj4+QD06PT47PT48PTo7NTU1MTAzNDQzNDUzNDQxLzEwMzIxNzk1Nzc0
MjEyLzIvMDIzMzMxNDI1NTQyMzIzMjAvMjA0NDEyMSwsMjMwMjU0MjIyMDUyMC8xLi4vMTUyNTI3
NTMyNTQvMDQxMjA1MjIyMjA1NzIyMTE1ODQ0NDU1NTQxNDUzMTQwMTM1MDU0MzMzNTQyMC8xMTIx
MTM1MzMzNTA1MzMzNDI1NTMzMzMyMTI0NTExMjc1NTIwLzI1NTQyMjA1NDIzNDEzNDUzMTI0MzE3
MzM0NDQyMjQyNDEyMzM0MjU1MDIyLzMvMTUzMDM1NTU0MzUzMjI0MTM1NTIwMTAzMTQ0MzEwLjEy
MTIxMzMyMzM1MjEzMS4zMzAyNTc0MzEyMjMzNDczMzIyMzM4Nzo3NTU1MzM1MDMzMjAyMzAxMzMz
MzM0NDAzMzEyMTQ3NTUzNDMyNTU0NDc1NDU0NTUzMzIxMTExMTI1NTU1NDEzMjQ0MzE1MDMyMjM1
NDUyMjAzODc1NTU3OTUyLzEzMzU1NTMyMzU0NDQ1NTM0MjEvNTU1MzAzMzQ1MzQ0MzIvLzM1NDI1
NTU0MzA3Mzc4ODUzMzQ1NDMxMjQ3ODc4NDM1NTQ1NTU1ODU1MzU1NTIzMjQ1NTU5ODczMjI1NTU0
MTU5NzM4OjUzMjQzMzU0NDUyNDQ0NDU0Mzc3MjQzNTUzMjQ1Mzc1MTQzMDExNDUzMzQ1NzQxMDU0
MzM1NTMzMzQ0NDQyNTQvNDQzMDA0NTU0NTU0MzU3MjA1NDEyMzM0NDIxNTMzMzUzNTM1MjMvLzA0
MzI3MjI1Nzc3MTI1NTQzMDAxNTU1MTA1NTMyMzQ3MjU0MjM1MzM1NzUyMTM7OTg4NTc4NTQzNTI1
NTU1NzM1NTMwMzg4Nzo5ODc1NTQ0NDU0NTU4NTU0NTU0MzQ1ODg0OTc1Nzg1NTUxMzU0MjAwNDg0
MzQyNDQxMjMxNzU1NDIxNDQ1Ojc1NTE0MzE0NTQzNTUyNTU0MzMxNTQ1NTIyNDg1MzE1NDM0ODU0
MzMzMjI1NDMzMTEyMjM0NzgzNTc0MzIyODU3OjM0My8yMjQzMzQ0MjQ1NDQzMjE1OTc1NzQ0MzU1
Mi8zNTExMTU1NTc0NTQ1NTQ3NDc1NTQ1NTU3ODU1MjI1NDE1NTU3NzU3NzU1NTQ5NzU3NTc1NzU1
NDc1NTQ0NTU4NTQ4ODU1NDM1ODU4NTMzNTg3MjI3MTE1NDUzMjU4NTc3NTM1NTQ0NzQ1NTg1NzQz
NTc1Nzg3NTM1OTk1Nzs6NTU5PDs3Nzo5OTs3OTo3ODc7OTk6NTc5Nzo3NTk5NDk5NTg4Nzs6ODU5
NTk9OTU1NTc4NTU7MjU4Nzk7Ozg7ODk1NTo4OjU1Ozo4Oz06Nzg1ODg4ODs5ODs7Ozw8ODo6OTk6
Ojk5NzU3OTs5ODk1NTU1ODk5Nzg4Nzg5Nzo1NDU3NzMyOTg1NTU1Nzo3MzM1NTo6NzU1NTU1NTc3
ODg3Ozs4NzQ1Mjg4ODU1Nzs6NTc1NTg5ODk3NTo6OTg1NTU1ODc1ODU3NTU1NTk4OzU0NTU3MzQz
NTk5OzkzODUzNTQ1NDU3NDU1ODg5Ozs1Mjc4Ojg4NzQ0NTc4NDQ1NTk4NTM0ODgyNTU5Ozk1NDQz
NTg6NTo4OTg3MTI0NzU4ODg4Ojc3NTU4NTc3OzU1NTU3MzU3NTU1Mzg3ODg3ODg1NzU5Nzg5ODc1
NTU1NTk5MzU4ODg1OTU4NTU3NTg4Nzg4MzQ1NTU1NDM0NDIzNzk0NTg6ODc0Mzc6OTUyNTMzMjU5
NTExMzU1OTc4NDU0NTQ1NDM3NTQ1MjAzODEzNTIvMzU0MzQ1NTU0NTU5NzIxMzU5ODc4ODg1ODg0
Mjc4NTQ1NTc1NDQ4NzMzNTc4NTU3OTQ1NTU1MzI0OT03ODg4NzU0NTc1NDQ3NDQ6NTMxOTU1NDUz
NTU1NTc1MDQ1NTc7PTs1MzM1MjM1NTU3NTQ1NTUzMzQ1ODc0MzUzNDEwMjQ1NDg0MTE1NDU0NTU3
ODk1Nzo1NTM1MTQ0MzUzMzg1NTQ1ODc1NTM3NzU3NTgwNTw8PTg4OTc3NTE1OTc1MjA1Ojk1Nzg4
NDU1NTg1Nzk1MzQzNTU4NTU1ODk3NTc4NDU1NTk1MzU1NTM1NTU1Nzc5PDo5OTk5ODU1Ojk3ODU3
ODk5NTc4NTUzNDc1NDM4ODk3MzU0ODE0NTo5ODc4NDMxMzM0ODc5NTc1Nzg6ODU3NzU3ODk6NzU1
NTc4NDU5ODU1NTU1ODk5NzU1NDU3MzQ3NDg3NDU1NTQ1NTU3ODUyMjU4ODU1NTU0MjQ4PD03Nzg1
NTQ3Ojc5Nzg1NDc0ODc3NTQ3NTk3ODU3OTg1Nzc3NTc1ODk5ODc6Ojk7Nzk7Ojg7Ozk4Ozk7Pjs9
OTs8Ojs6Nzw8OT08Ozw4ODg4PDk4PTs8ODo8Ozc5Ojs5OT09PTg5OTo3NTk7Ojs9PTw4ODo5Ozs7
Ozs6Ozs+Pjs6PDk9PTtAPjw+OD07PT07OD47Ozo8Ozc4ODs8ODk7ODk6Ozg3OTs6Nzs7Oj09OTg8
Ojs+Pjw3OT4+PTk4PUE6Pj47Qj5APj47Ozw+Pj0+OTo7NTU4Ojs7Ojs9Ozo9PD48OTs8PDc8Ozs6
OT0+Ojo5NTg7Ozw7Ojk7Oz46PT04PTk9OTk8Ozo6PDo4Ozw6PD49Ozs6Ojs6PTw6Ojs9PTo+Ojg8
PTk6Ojk6Nzc9Pjs+PDo6PDs7PTs7PDk7PT01MzM1NTIwMDIyLjEyMTMxMjAvMzQ1MzIwMDczMjU0
MzAvMC4zMjMwMTEvMTIzMCwyMzQyLywuLi8uMDAwNC4wMjAyNTEyNTQxMTQzMjI0MDI0MjM1MjE1
NTczMDAxMTEwMy4uMTEsLy4wMzMxMjIzMDAyMTU0MS8wMjU1NDQvLDExMTQ0MTUzMTQ0MzQyMi80
MzAxNTEzNTMzMTE1NTUzMzMyMzMyMzU1MDEzMjM0MjAyMy8wMzAwMjExNDQzMzc0MzIyMzQwMzQy
MDIzNTUvMDIxNTg1NDUzMjI0NDUxNTQ3NDIyNDgxMTIyNDcyMjIxMTM1NTAxMzU3NDM0Mzg4Mzk5
OjUzMjM1NDIxMTQzNDU0NTM1MzM1Nzg4NzUxNTUzNTg3MzMzMjQzMzMzNDU1MzUzNTMvNTU1NTUx
MTQ0NDQ3MzQ0OTQ0Mjc1NDUxMDU3NDExNDU1MTM3MzMyMDAzNTU0NDc3ODUwMzQ0MjU1NzQ0NDQz
Mjc4MzM1NTQ1NTQ1NTUzMTIzNDQ0MzAxMzM0Nzg0MTM3ODcxMjMzOTQwLy8zNDM0MzQ0NTQ1Mzcz
MzExNDU0OTc0NDM0ODUzNDQ1NTIyNTc3NTc0NDM3NTMzNzU1NDQ3NTU1NTc4ODg5OjU3MzU1MjU6
NTA0MjUyMjQyNDQ0MjU1NTU1MzU3NTQ1NTUxMDI0NDQzNTc0NTU1NzU4MTI0NTU1NDQyMSw0MzI0
NTU0MTU1NTU1NDQzNTMyNTUyNTIxMjQxMzQyLzExMjIzNDQ0NTMzNDUyMzg3MzE3NTc3MTExLzEz
MzQ0My8yLzEuLjQzNDQ1NTAvMTEzNTQyMTQ0MTQzNTU0MTI1NDU5NS8yNDIxMjQ3MzM1NDAyNTQ1
ODU1MjMyNzc1NTU1Nzo1NzUxMzM1NTUyMzk4NTc1NDMzMTQ1NTUzNDUxMjQ0ODQ1NTc0NzU1NDI3
NTUzMDQzNDQzNTU3NTU0MjQ1NTIuNTMwMjM0NTU1NDc1NTU1Mi8uNzg3MjA0NTUzMjg1MjM0MTIy
NDEyNDU3MzE1NTUyMjE1NTU1MTc1ODUzNDQ1NTU5ODM1NDAwNTUwMzQ1NDQ1NTQzMzQzNDU0NTU1
NDU1NDI1ODU0NTo0MzMwMzU6NTIzNDQ1NTUzNTI0NDk1NTU1NDU0NTMxMzQyNzg0NDU3NzQ1OTc4
MzI0MzM0NTc1MTM1NDQ0ODU1NTg5NzM3MzUzODUzNDI1NzQ0Mzc0MjM0Mjc0MzU0NDU3NTQ1NTU0
NDg1Nzs1MjQzNzc1NTU3Nzc1NTc1NTMyNzk4OjozNzw6OTUyNTg4ODs5OTc6ODU0NTg3NTQ1MzU3
Nzc4OTo4Ozs5Ozk5PDk7Ozk4Nzc6Nzo5OTs9OTg7PDo7NzU1Mzg4OTo6OjM5Pjo4NTc3NTg3NTg4
NTU1Ojg5Ojg4NzU4ODg5Ozg7ODo8ODk1NTc4ODo4ODU1OTg0NzU1Ojg1NTc3Ozk3PDs4Nzc3Ojk5
NzI1Nzg5Ozc1NDM3NTg6OTc1Nzk3NTg1ODk6Ozc4NzU1Nzg1ODc4NTc5ODU6NTU6NTU5Ojs6Ojc4
Ozs4ODg1NDc5OTU3Ojc4ODo7OTg3ODU1OTw1OTI0ODk4Nzg5NTs4NTg6Ojs9NTU5OTc1NTU5Ojg1
NTU1OTg1NTc3NTU1OTk3ODk5ODc0NTc4Ojc3Nzs0Mzk5NzgzODk1ODU4ODQ1ODo5NDU5ODI1ODU0
NzQ3MjMzNzQ6NTU1OTczNDQ1NTg4NTQzMzIyMTU1NDExLDEzNTU5OTU4ODMyNTM1NTQ0MjQzMjIz
NTU0NTQ1Nzk3NTg3ODcyMzU3OTU1OTU1NzU3Mzk4NTI1NTc1NDQ1ODg0NDc0Nzc5ODU3ODg1NTU5
ODMxNTU1NTc1ODM0MjI3NDEzNTc3MjI1NDg3OTk4NTU1NTg4NzQ0NzM0ODk4MjM0OTo1NTgyLjM0
NTc1NzMyNzc4ODg1NTIzMjQyNTU4NTU0NTc1NTQ1NzQyMjc3ODQ0NTg5ODc4Ojs6OTUzNDU0MzU1
NTU1OTg0Mzc3ODg0NTg1NTU5NTIyNDc1MzQ1MzU3ODs7Nzk5NzM3PTk1NTUyMzg4NTU3NDM1ODU0
OTc3NzU3NDMyNDc1NTU4NTo5OTUzNTUxNTU8OTg3NzU3NTg3NTM1NTc4NzU0Mjc1NzUyNzMyNTU3
Nzc1MTMzNTU1MjU3NzU1NTc6Ojg4NTE1MzExNTg1NDo3Nzc1NTc4MzI1ODU4OTU3NzszODg1NTQ1
NTU0NTc0NzQ0Ojc3NTo4NTg6NTU1ODQyNTI1NDMyMjM1ODg4NzM1Ojs3OTQ3Ojg5NTM4Nzg7Ojc0
NTo1ODc5NTU4OTg1ODg4ODQ1NTU5Nzg1NTo3OD0+NTc3NTU7PTo5OTg5ODQ+Ozw1Ojo4OTw8PDk6
OjU5OTg6ODc1PD08Oz07Pjs6Pjw3OTs7Pj06Oz05ODw5OTw6PDs6Nzk8PDc5Ozw3Nzk5ODo4OTk1
OD0+QkA+ODc9PDo8PDo5OTs4NTo7PTo9Ojs8OTg6Pjo3PTs8OTk8PDw8PD0+OTo6NTo7PTw8ODk8
Pj49Oj08PDw9PDo5PDw8Pj08OT09Qz46OTk4OT0+PT0+Ojk9Pjs6ODs7PTo5Ozg8Pjo6OTs+PDs8
PDs+Oz4+Pj06PDw+Pj4+PDo7Ozw7Oj49Pj46Ojk7Pjw7Nzk+OTs+Ojs+PTs8OztAPD07NTo9ODs9
Pjg3Ojw5Ojw+PTo5Oz07Oz07Ozw7OjEyMDI1NDAuLy8wMTMwMDEzMTMzLDIyLiwwMjAwMTEvLy8y
NTIyMDIxMzQxMTEvMzIvLDIxMjEwMjAwLy8yNDU1MzEuNDQyMjAxNTQ1MzIxLjIzMzU0MjEyMzAy
MzM0NzcyMTEuNTMuMjUvMjU4NTQ0MDM0MjU0MjEuMTQxLzIzNTQ0NTMzMzQ1MjA0NCwuMDU0MzQy
NTQvLjIzNTIyMS8zNTQxMjM1MDUxMzMyNDEuMTI1NTIzMTEzMCwwMzIzMzI4MjEwMTI0MzAvNDc1
Mi4vMjQzMS8yMzI1MzAxMjU0MjUzMTE1NTEwMzIyMTQ1MTMyMzcyNDIyMjQ3NTczMzgyMTQ0MzU3
NDIyMzUyNTQzMzQzMzMzNTQ1NDM1MS8wMjM1MjAzMDE0NTU1MDMxNDUxMTEzNTUzNDk1NzQxNzIz
NDU0MzQ0NDIyNzg1NzU1MjIvMTc4NTU1NTMyNTMxMjQyMjI1MzMyNDMxMzMyNzU0NDMvLzU3NTUz
MDc4MzU0NDM0NTU1NTMwMjU1NDQyMzMyMjQ0NDEyMjUzNDU0MzA0NDU1MjMxMjM3NTI0NTc1NTg1
NDg1NzMyMjMxNDQ1NTM0NDMyNTU1MzIzNTU0Mzc1NTIxNzU0MjU1MzQ4NzQyODgzMzU0MjQxNDU1
NTQyMjU1NzU0MzQyMDAyNzk1MDM0NTMzNTU1NTUzMjIwMjMxMzI3ODI1NDE1NTQxNTM3NDQxMzE1
MTExMTc5NzMzNDQ1MzM0NTQzNTQ0NTI0NTk4MzMyNTE1NTUzNTUzMS8yNDQ0MjMyNDQ0NDE1NzUy
MTMzMzUzNDIyNTI0NTQzMjU0NDUyNDM0MzE0MjU5MS4uMzQ0NzcwMTU1NDExNTU1NTIzNDMvMjc5
OTc1NDMyMzE1NDI0ODQ1NTU1NzQ0MzQ0LjUzMzU1MzU0MjQwMzUzNzMyNTU0NTExODc1OTc3NzU1
NTQ1NTQ0ODg1MjQ5NzU5NTU1ODgzMzIyMjI0NzQzNDk5NzIyNDQzMjU0NDUyMywwMzI4OTUzNzQw
MjU1NDI1NDM0MjM1NTMyNTgzNDQ0MzQ1OTcyMzU3NDQ0Mzc1NTIvNTUzMzUyNTU0NTQ0Mjc4NTU0
NTUzLzQ1NTQ4NDU0NTUxMjI1NTQzNTUzNDU0NTU1NzU3NTQ4MzM1NTU3NTU4NTQ1NTU3NTU3NTUz
MzM3NzU1OTkzMzU3OTk4NzUzODUzODk4NzU0NTc3Nzc3ODk1NTo6NTU4ODs4NTU5OTc0NDk3MzQ3
NTM0Nzg4OTU0NzU7PTQzODo4Nzg1MjU3NDM3Nzg5OTc7PTQzOTo3OTk1NTc7Ojc4OTk9NzU3OTo3
NTU8Ozo1NTU1OjU1NTk7ODk1NTU6Ojk1ODo9PTw4ODk5Ozo7PDo4ODQ1ODg6Nzg4OTo3Ozs3NTc1
Nzg1ODs4NTc5OTc5ODc0NTg3Nzc1Nzk1NTU1OTk6OTo5NTc3Nzc4Pjs4ODU3PDk1OTU3NTg1OTc1
Nzk4NzU6ODU4NTg1ODU6PTg5PTo5PT49Ojo1NTg1NTU6OTU1NTg1NDc1OTs4NTk3Ojc3Ojs5Nzs4
Nzg1MzQ6NzU3OjU1OTk4OTg6ODk4NTk5NzQ0ODo5ODU1NTU4ODg1NTw8PDc1NTU1Oj05Nzk5Nzg1
NDc4NTc3NTQ6ODc1NTg0NTI4PDc1NTg7NTU1OTk8OTU1NTo4NTg5NzU1NTM1NTU1NTMzMzQ1Nzc4
NzU1NDU3MzMzNDU3NTU0ODUzMzg4NzM0NDQ3NTIyODc0NTQ1ODc3NzQ6OTg3NTUyNTU6NzI0MzU1
ODU1ODg0NDU0Ojg5OTU0ODUzMzc0ODg6NDQ0NDI0NTc4Nzc3NTg1ODk3NTU1Nzg5NDU3NTQ1NzU0
ODo5NTU1ODc1MTQ4NzU1PDk1NDc0ODUzNTU4NTU1NDU1NDU1NzgzMTc1NDU4Ozk1Nzc0NTUxNTQz
NTk3NDg6NTU3NTc5MzQ3Nzk1Nzc1NTUzOTo1NTU1ODU0NTczNDU4NTgzMDQzNDU1NTQ0MDQ0OTo5
NDM1NTg3NTU1NTc5OTU1NTg0OTo4NTM1NTI1NTc1OTk5NTQ1Nzg1MzU4PTg3NzU4OTc1ODo3NTQ4
NTU5OTc6PDc1Nzc1NTc3OTk4NzU1ODo6OjU4OTk3NTc1NzU3Ojc3OTk7Ozk5ODU3ODU3Nzc0NTU1
NDU1MjQ3ODU1NzU1OzgzODs8ODU3NDU1NTs1NTU0NTg5MzM3NDU7OTg1NTMzMzM3NzQ1NTQ0NzU5
NzU1OTo3NTg3OjU3PDg1Nzo1NDM1NTQ3ODU1NDg1NTg1Nzc6NTU5OTcyNDg6Nzs4NTc1Mzc5Ojg0
MjQ1ODg4Nzc0NzgyMTc5Ozc1PDk5Ojk6PDo4Ozs7ODg6PTw6PDk5PD47NTc6Ojg4Nzw4Nzs6ODw5
Ozw7Ozo5Oj0+PDs6ODo3OTw5Oz0+PkA9Ojc6Ozs9Pjo4ODw5OT09OTw+PDo7PD46ODg4Ojo8Pjo7
OkA+OTw9Pj09Ojk+Pj48PTk5OTs6Pjw8Oz4+PD47PDs+Pjw9PT4+Ozs3Oj09Ojw+PT08PDs7Oz4+
PT4+PUBAOzpAQD49PEA+Ozo+Pjw8PDw6ODw9Pj49PUBAOz5APTs+PT5AOzk8QDw+QUA9ODo9Oj06
PD49PTo9QT1APkA9Oz4+PTs9Pj1APT1BPD07Oz47Pjo7PTo+PDw+Pj49PT49Pjs8Ojo8Ozw+OzxB
PTw+PDg5Oz0+OTs7Ozw4ODk8MjIxMjQ0NTMyMzAuMzU1LzEzNDU1NTEzNzo1NDAyMDU3MzAzMTI1
NTQxMS8zNTA0NTUwMTAzMTMzLzEvMTI1MjEuMi8vMC8xMjExNC8xMi8zNTMxMTMyMC81NDI1MzEy
MzEzMDIzMzk1LzExMzIzMTQ3NTQyMDAzNDIxMTMzMDAyMDA1NTMxMC8yMi8uNTM1LjAvMjUxMDQ0
MzAzNzIvMzUxMTMvLzI1NDU3ODU3NDMxMS80NDQyNTIwMzMyMTEzMzIyMy8yMjAwMDEzMTUyNTIz
MjMyMS8xLjMyMC80MjAxMjU0MzQzNDA3NDUyNDU1NDM1NTIuLzAxMzQ0MjAxMTU1MTUzNTc0MjU4
MzMyNzMvMTQxMTE1MjU3NS80MDMyMzUvMTE0MjU1NzQ1NDE0NTIxNTIzMS8xMjExLjU1MzQ1NTU1
NDU1NTgyMzU1NTQ1NTQ1ODIxNTM1NzczMDQ1NDQyMzM0MTQ1MTEzMzM5NTc0Mzg4NTQyMTc1NDMz
NDQ3NTA0ODM1NTIyNDMzNDQzNDI4ODIyNDU3NDI0NTU1NTM3ODc1NDU1NTc0MzQyMTM1NTQ0ODg1
MjM1NTMzMjU3NTo4NDUzNDk1MjU3MjU1MzMyMzU1OTc3OTMyNDc3NTE5NDI0MzQ1MDA1NTQ0NTU1
MzE0NTQ3Mzg4MzI1OTQ3NTc1MjU3ODk1NDIxMzE1NDIzNDgzNDU4MzM0Mjc3NzExMzU3NTM1MzQz
MjIyMjMzNTQzMTEyMzMxNTM0NDMyMjAzMzk3MzQ1NDExNTQ1MzEzMTU0NTc1Nzc0NTUzMTU1NTEy
MzM1NDM1MjAzMzM0NTU1MjI0NTg0MzIzMjQ1OTQ1MzMyNTM0ODU1NTU1MzMzNTU0NTczNDI3MzM1
ODc1NzAyNDUzMzU1NTMzNDMyMjc3ODU1NTMzMzIzMzU3NTU3NTMwMjQzNDIwLzEzNDc1MzM0NDQz
MjU1MzQyNDc3NTMyNTMzLjE0NDU0MzMzNzU0NDIuLjExLzEzNDQ1NTQuLzM1MzAzMjE1NTU1NzQz
MzUzLzM1NDQ0NDQyNTU1NTQyMzg0NTU4NTU0ODQ1NTM1NzM1NzU0OTc1MzU3NDUzODUyMzI1OTM1
NzUzMzQ0NDM3MjIyMDM0MzU0MjU1NTUwMTM1NTU1Mzc1NTc4NTQ1NTU1NDUyNDU3Mzc6Ozo0Mzk5
ODUzNzQ3NzkzNDU6Ozo8OzU4NTg1MzU3MjU6MzU3NTQ1NTQ1ODU1NTM1NTU0NTQzMzg1Nzg1NTU1
Mzo1NTg6NTU6OTk4NDUyNDM3NzU6OTk3ODg4ODg4OTw8Nzg8PTU1OTg6ODw6Nzg6Ozk6Ojc3NzU6
Nzs5ODs3NTU1ODc4ODk7PDs8Ozc4PTs5Ojg6ODU1ODc1NTc1OTk0Ojo7Ojg0ODg6OTU3NzE1PDk3
Nzs3ODU4NTg8NzU1NDU5OTc1Nzc7OTk4NzQ1NTc0NTc1NDU5Nzc3OTQ7OTc1NTg5Nzs7Ozo1Nzg4
Ojc1ODc0NDQ1NTc1NDg1ODg4OTU3NTUzMzU1ODc4Ozg1Ojk3NTI5ODU3NTc7OTQ1NDI1ODw3NTEy
NTg4Nzc7Ozc3ODo8ODk4NTUyNDg1NDU1NTQ1NTQ3NDc3NTg1NTg6NTQ7PDk7OTc4Nzc1Nzg4NTM1
OTc3OzU3ODU0Nzk3ODg1NTU3NDU1NzkzNTc1MjQ1MzU4NTU3Nzg1NDU3NzU3NTU1NzQ1Nzc0ODc1
NzUzOTg5Ojc0ODU0Nzg5ODU1Nzg1NDEwNTQ3NTU1ODUzNTU7ODg4OjU1NTU3MjQ0NDc1NTUyMTEz
NDIxNDQxNTE0NTg1NTQ0NDg0NDQ1ODUzNTMwMTA0NDQzNTk0NDQ1OTk1NzU1NTc1NDg4NzU3NzI0
ODQ0NTQ1NTQyMTU3NTc4PDk4NzEzOjU0NTU5Ojc0NTU0NDU1NDQzMzM4OTo1NTM1NDQzMjU1NDU0
NzU1MDA1NTM1MjIzMjQzMzI1MDI3NTQ0NTg0MTU1Nzg1OTk0MzU1MDU1NDUyNDUzNzU1NTU3ODU0
NTQ4ODc1Ojo5NzU0MzU3NzU3NTU1NDU3ODU1NTk1NDU1OT01NTg1ODg5NTU4NTU0NTU5OjU0ODk4
OTg1MzI0NTU1NTc1ODg4OzU1Nzo5Ojk0NDczNTU5NzUzNzg1OTU4Nzk1NzMyNDQ0NTc4NTo5NTk3
NzU1NTc1NDU3NTg0NTg1NzU5Nzg3NTU5NDc0NDU6ODU4OTc1MTQ6ODM0ODg4ODU1NzQzNTU3NTU6
OTk4NzU1NTU1NTg1NDk4ODU1NTk0Mzg8PDo1NDc3NTc1MTU3Ozk0OTU3ODc4Ojs5OTs6NTU5OTo5
Ozo1NTo8ODU0NTc1Nzw9ODU1Nzg6NzU5Nzk1NTk4PDo+Pjs8PDU6Pjk4PDs6PTs3OTw4NTo7Ozo4
NTg9Pjw6OTo4Nzw8Ozs+OTg7PDk7PD48ODc7PDo7OzxCPj49PDw+Pjw+Pj48Oj09Pjk8OjU7Oz49
PDs6Ojw8Oz04OTlBPjw6Ozs4PD46PTw6Oz08Pj0+QDo6Ojw6Pjs+PTs9OzpAPjg5PT0+Ojw8Ojg5
Ozc7PT48PT07PTs6PD05PUA+Ojo7Pj47PD48Ojk4PDw7Pjs9PTs3Ozk5ODU4Ojg8PDs8Ozk5PD09
PD48PTo8PTw7PDs8Pj48PD07Ojs+PD06Ozk6OkBAQz06Ozk7Ojo5Pjg5PT4+Pjw6Ozw+Ozg+Ojk7
Ozs7OTxBQTs7PDw6PDwzNzU0My8yMzMvMTM1NTEvLzEvLzQwLzAuLzAzMjMyNDIvLi4sLy8vMjMz
MjIzMDE0MjU1NTU3Mi8xMy8xMjIxMzQwMiwuLzAyMTU1MzAvMDMwNDIzNDIvMDQ1NTEvMjEyMDE0
MDEwLy8zNTIyMjUzMy8sNDM3NTMyMTA1MC4vMTEwMTEyMjIwMDAxNDAyMjI0MTQ0MDE1NzQwNDMw
LDM0NC8yMjMxLzMvNDM0MzMzNTU5NDE0NDQzNTEvLzA0MjIwNDMzMjE0MzIzMzA1NzQzMC8yMzMx
MjIwNDQxLzQ1MzE0NDMzMzM0NTU0NTM1MjQ0MjMzNDQyMzIxMTExMzAyMzIyMzM0MzExMzMxMzQ1
MjI1MjMzNTIzMzU0NDc1MjQ1NDc1NzM3NzQwNTIzMzExMDU0LjMzMzg0NTU1MjI1NTUzMzEzMzIy
MjQyNDQxMzU0NDU1Nzc1NDM0NDI1Nzk1MzU1MzI1NTQ0NDQ1NTExNDQ1NDEyMzM4NzQ0NTcyMTQ1
NTQzNTMyNTQ1NTE1MzEzNTc1NTU1NTQzNTU0MDU1NTg0NDU4MzQ3NDA1OTU0NTUyNTMzMjU1NTU1
MzMzMzU1NTM1NTI1NTU1NDU3NzgzMjQ0MTExMzEzMzcxLzU1NTU1NTI1MTU3OTUyMTU7ODQ1NTc3
MzM0Nzk1NTUzMDIzNDg3NTUzMDU1MjIzNTc5NTEyNDUzNTMxMzU3NTMxMjUyMTEyMzEyNTU1MTEy
MzEvMjEwMDM3OTMvMTQ1Ojc4NDQuMjM1MjUzMzM1NTU0MTMwMzMyMTU0MC8wLzQzMzQxMCw1MTM1
NTQzNTU1MjEzNDI1MzI1OjU1MTA0Nzo4NzQ0OTUxNTg1NzU0NTU1NTUyNTQ1NTU1NTk1NDMyNTg6
NTk3NTU1NDM0OTQ1NDIwMDM4Ozc3OTc4NzU3ODU0Mzc4Nzc6NTg3NTU1NTUyMzczNTc1MzExMjU0
NTA1NTU1MTQ1NDM6ODM1NTc4NDQzNTU3ODU1NTU3NTc5NTU1NTM1NTc3NDUwMTUyMzMyMzQ0MTU1
MzMzNTU1NDQzMzU1MjE0OzU0NzQ1NTU1MzU1MDA0Nzk1MTM0ODQ1NTo3NTUyNDU4NDU0MjI1NTc4
NTU0Nzc1MjM1NTM1Nzg4Mzg4MzM0MjU3NDIzNDQ0NDIzMjI4NzU0Nzc4MzU1NTU1NDUzMjE0NDU1
MzQ5Nzg0NTc6OTU0NDU3ODs8ODQ5NTU3Nzc4NzU1NTQyODk3NTc3ODs6Ojg1NTM1MzQyNDE0NDM1
NTU3NDMyNDg1NTczNTI0MTIzNTUzMzI1NTU1NTU1NzU1NTc0MzQ4OTg1NTg4OjQ4NTU1NTU1NTc4
Ozk0NTU1ODU5ODgyMzU4NTg4NTc3PDk3OTs5PDk6ODo8Ojg3Ojg6Ojg4NzU3Nzk4NDc5NTo7Ozk3
ODg3NTk8OTc4PTs6NzU1ODU5Ojc4Oz45ODo4NTk3Oj05OTo5OTk5NzU3ODk5ODc3ODg4OTg4OTo5
OTk4OTw5OTs5OTk5OD48ODc1NTU4ODw1Nzc1NTU3NTk7OTg0NTU4OTc5ODU5OTc3ODg4Ojc3NTU3
NTc9ODg5NTU3Ozk1NDc3OTQ1NTc5ODU4PD03NTU5OTo3NTg4Nzc5OTk4NTc7PTg1NTc1NzQyNzg6
ODc1NTU4ODU4NzMzNTU4OTU3NzU3ODU1NzUzNzUzNTUzNTQ1OTU3Nzg4NTc1NzI0MjU4NTc0NTU4
NDg0NDU1NTU0MzQ1NTU4NTg4ODU3NzkzMzM1Ozc1NzQ4NTE1NTEwNTUzNDU0NDc1NTk0NTQzMzQ0
NDUxMzU3NTc3NTQzNDU1MzQ1NTM4NzUzMzU1MzE1NzM1MzExNTg3NTU6ODk3ODM0NDU0Nzk+Ojc1
NTU1NDQ1NTU4NTM1MjAxMjQ6NTc4NzU4NTc1NDU1NTk0NTE1NTQ1NDg1MzQ1MzU1NDI1NzU1NTU3
MjU3NTczMzQ0NTU1NDU3NTgyMzU5NTM1ODQyMzUzNTQzODo5NTMzODIxNTQyNTM3NTQ1NTM1NTc4
PDUyNDAxNTQ1MzQzMzU3PTgzMjM3NTg4MjU6ODs4ODU4NDQ4NTU6OTI4OjcyNTg5ODczNTc3ODk1
NDI4ODg0Nzk6NzUyMzQ1NTQ1NTQ1Nzg3OTc1NTU5NzU0NDc1NTM1ODc3NTo3NTUzNTU1NDk4ODU1
NTc4NTc5PDs4NzU0NTc1MjI1NTU3ODU0ODo0Mzc0NTEyNDg1NTMzNTg1PDo1NTc5NTo5NzU1NTQ1
ODg5NTc3NTQ1OTk6NTc6OTc1MzM1NTk7NTc1ODg1NTQyNDU3Nzc5NTc8ODo7Ozk5ODU1NTcyMzk3
NzU7OTU3OTc1Ojk1OTg6OTo5ODo8PD07NTc3Ojs4Nzg3Ojk8PDk7PDk7OTg5ODU1Nzk9Ozk5Ojk9
Ojs9Pjc6Ojc4Ojo5OTs7OTg7QDw5PD5AOj47Ojw+PTs8PTk8PTk+Pj49OkE8OTo7QD46Ojs+Ojk1
NTc3OjU6Ozs5PT48PDk4OjxBPjw5PTs+OzlAPjo5Ojw9PTk8PDk4Oz07Ojc8OTU1ODc6ODtAPjw7
OTc7PDw5Nzo7Ojo4Oz5DQj45Oz07PDs+Ozo9Pjw7PD05PD48Ozw+Pj0+Pj07PTw9PEA6Pjw+PDw+
Ozw8PT48Pj49Ozo6OTg6OT4+Pjs4Ozw+PkI7PT4+QTw+PT49ODk6PDw8Pjw7OTw8Pjs8Pj09PTo8
Oz08Ojo8Ojg9OzIzMTAwLjAyMjEvNDIvNDQ0MjI0NDIyMjQuMjQ0MzEwMjIyMTQyLzIzMzIyMzIw
MDAxMTI0MC8yNTIxNDM1MDMyMzUyMzMyMTIzNTUxMjEvMTI1OTUzMTEyMTQyMjI1NTAzMjUzNDU0
NTQzMy8zMTI1NTU1NzIzNDIsMDEyMzMwMTI3MzMyNDQyMzMzNTkyMDQyMDI3MzUwMjQzMzAyNDEx
MTIzNTEuNTQ0MjExMDEyMDQzNDEvNDIxMzQ0My8zNTMzMTQ0MzI0MzIyMTU0MzQ1MjMyNDUzMjEy
MTAwNDIyNTk1NTIwNC8vNDk6NzExNDMxMTI0NTQ1NzE1NzQ1NTczMTQzMzQ3MjQ1MzM0Mzc0NTcx
MzU4MjIyNDUyMzU1NzU1NzQxNDo5ODc0MjU1NTM1NTU1NzQ1NzQ1NDQzNDU3OTo3MzI3Nzg0NTU1
NTM1NTQyNTc6NTAzNTUzNTM1MzI1NTc3OTc1NTU1NTQvMjExMzI1NTQ0MzM0NDM0NDUzMzc1NTQz
MTMyNDQwLzM0NTU1NTU0MzkyNDMzNTU0MzU3NTQyMDQzMzU3MzUzNDU3NTMxMDEzNzc3NDE1NDM0
MjU0NTQ1Mzc1MzM1NTQ5NzQzMzU0NDc1MzQ4NzU0NTIxNTcxMTAzMjMyNTQ0ODIyMzM0NzU1NTQ1
ODUyNDUzNDU1NTU0MjI1MzI0NDMzNTQvMDI1NTM1NTU4NTMxMTIxMzI1NzU5NTU1NTUzMjQxMjQ4
OTUyMzc1MjAzMjU1NTMyNTUyNDUyNDEwMzA0MDQ1NTEyMjUzMjE0NTMyNDQzOTg1MjMzNTQ0NTQw
MjIzNTg6NzI1NDc4MzU1MzI0MzM1MTQ4NTg3MzU3MzI1MzI1NzEyNDg1NTI0NzU0NDU1NTQ0NTU0
NTU1NzU3NTU1MDE1NzU1NTU3ODk1MzIzMjEyNTUxMjExNTc1NTQzNTM1NTI0MjMzMzUzMzUyNTU1
MzQ1NTU1NDM1Mzc1NTU1NTk4MjQ1MjU3ODM1NzU0NTg1OjQxMzc1NDM4ODc4NTQ1ODM1ODU1MzEv
MDI1NTQ1MjI0NTU1MzEvNTc0MzU3Nzs1NDE1NTU3MzQyMjU4NzQyNTIyNDU4NTM1NzQ1ODM1NTU3
NTUxMTc3NTM1NTU1MjE0MjM0NDQzMzI1NTUyMzU0NTU3ODc1NzQzNzcyMjU3Nzg1NTc1NTU0NDU0
NTU3NDU1NDM3ODU1NTcyNDI0NTU1MzU1NDEzMzQ1MjEzMTM1Nzg1NTQyNTUyMTU6NTg5NTU4NDc4
NDE0ODU1ODc1NDc1MzU3MzU3Nzc6NTg6OTg1OTw5NTc5NzQzMzU6OTU0NTs6NTU3NTs5Ojs3OTU0
NTs5ODo6NTU4OkA6ODo3OTU4ODk3ODg3Nzk3NTU6OTc4PDo5Nzk5OTU4Nzg4NTo6OTg5OTo1NTg7
OTw4Ozw5NzUzNTc3Nzs1NTU4Nzc5NTQ4OjU3Ojk4OTg3OTg6NTg1OTc1Ojc1OjU1NT04NTU1NTU3
OTw7Ojc1NTk5ODo5Nzg4Ojk1MTc6Nzw5NzU1Mjo6MjU5NTM0NTUxMjc6ODc4NTU1ODg6OTg6NTk4
ODU1Nzg5NTs4Ojc1Nzc3ODg6Ozc4OTg6NTU4Nzw7ODg5Nzo7PTg5OTo4Ojk5Ozc6Pjw3ODs3OTMz
Nzc1NTc5NTU3Nzc1ODk8PDc3NTU1ODk4NTU3OTU5Ozk3Mjk3MDQ3NDU1NTM1Mzk0NTg4MjgzMjg4
Nzg4NTM1NTo4MzM1MzIyNTU1NTM4NTUzMTAxNTI1MzQ1ODM1OTU1Mzc1MjQ1MzU0NDI0ODg1Nzg1
OTU0NTUzMDc9Ozg3OTQyMjc1NzQ1NzQ0NTg3NTk6ODg3Nzg4NzQ3MzUzMzM3NzQ0NTU3NTc1NDg4
NTQ1NTU1MzU3NTc3NTc1NTU1NDQ1MzQ1NTc0ODkzNzUzMjQ4NTA0NDQ1NzIyNTMyNTU3NTU1NTU0
NzMzNTk1NTQzNDU1NTU1MjQ4ODIyNTU1NDM1OTc1NDI3NTU0MzU0NDM1NTg1NTM1NDU4NTc4ODg1
NTk1NTU1OTc0NDE0MzUzMjEzNTU1NTU1NTU1NTU1MzQyNTU0NDk4NDIyNDQ1NzczMjU1NTs5Nzk3
NDU1NTg1Ojo4ODc1ODI1NTg1NzUzNzg1OjU1NTo7OTg5ODU0NTU4ODMzNDg3NTU3NTU1MzQ1ODU0
NTUyODQ5NTUzNTU4NTI0NC8yNzU6NzQ1Nzk4ODM1Nzk4ODk1NTU4NTc9OTc1Nzk6NTQ0NTc3Nzw5
NzU1OTg3ODk5ODU1Ojg1NTg1ODs3NDc+Ojk3MzM8OTU3NTs6ODU3OTo7OTs5OTc4PD48OTozNzU3
NDk6OTg4NTg3ODk0NTU5Oz45OTg6Ojk3ODo1ODg4Ozs5ODk0NTk1NTs1ODw8PEA8OD48Ojw7OTs7
OTs4ODw5Oj47Ojk5Ojo8PDc5PkI5OTk+PDs7Ojo7PDs9Ojo1NTw8Ozs5Pj06Ojw4Ozo6OTs9ODw+
OTo+PDk7NTtBPjs+Ozk8OTw7Ojo4Ozs6PD09PT04PEA7PD48Pj47PDs8Ozw5Oz07Pjw7Pj0+QD4+
ODk7Ozc+Oz49PDo7PTw5Ojk8PT47Ojs8Oz1AOjo3Ojo7Pj4+PkI+Pjg1OD49QD09PT1APjs6PDw8
Ojw7Ozk3Oz06PUBAOzw7Ozc9PTo7PTo7PTk6Ojk7Pjw7PDo4PD09Ozs7Pj48Ojs8PTw+RD47Ozw8
PT48PDxAMjI1NDAuMTEsMTE0NTIwNDEyMTIwMDEwMjI0MC80NDMxLi8wMTEvMy8uMDIyMTEyLDEx
NDc1Mi8xMjQ1NDMxLiwwMTI0MS8vMzczLjEyNzU1NDIvMzIxMzM0MzQzMzI0NC81NTUzMzAuMDAz
Mi8uMDQ3MTI1NTIsMDM0LzU1MSwzMjMzMjIyMjMzMy8wMzExMzU0NTE0NzMxMDEzMjEyMDIyMjAw
MTM1NTU1NTQzKy40MzcyLzAzNTU1NDMyMDM3NDI1NDIzMTA0NDIzOTUxMTQzMzg1NTMvNTMvMjEy
MTA0Mi4wLy8zMTAzNDU3MjExMjQyNDIzMzMwNDUzMTAwMjQxMzM1NTA0MDAzMjIyMTQ1NTMyMjAx
NDQzMjIzNDUzMTIzNzU3NDMyMzM1NTEvMjMyNTQyMzUzNDQ1Mzc1MTQzMjI1NzQzMTQ1MzQzNTQx
MjU1NDUyMzQzMzM1NDQ1NTIzNDU3MjU1MzMyMjUyMTQ1NTUzMjUzNDEwMC8zNTMyMTIyNTUxMjU1
MzQ1NDQ1NTU1NTMxMjQyMzcwLzU4NTU0NDU5MzI4NzQzMzMzNTM0NTAzNTQ1NTc1NTIvMzIyNDMy
MzUzNTU3Mzk3NTUzMTE0NDMyNTU3NDU1MzQxNTQ3ODc0MzczMjQzNTAxMzQ1MzIyMTQ1NzM1MTEz
MDM0NDM0NTk6NTU4NC8zMjIzNTMwMjUyLzM3MzQzNTQxMTM1ODU0NTQxMzQ1NDAzNDQxMDQ3NTIz
NTI3ODMyMzU0NTMzMzM4MzQxNDU4NTUxMzM1NDUyMjMxMzU1NDQzMzU0NTU0MzMwNTQyNTQyMzEz
NzM0NDU1NTM3NzU1NDM1MjQ3NTIyNTk1NzQ1NTg0NTU0Nzk5OTc1Nzg1NTU0MzU3NTM1ODQzNTUx
NTUzMTM3NTg6ODc3NTQ1NTg4NTQzMzU1MzU1NTM1NTI1MzIxMTc0MzI1NTU1NTI0OTg1MjU4ODg1
NTc4MTM3NTU1NTQ1MjU1NTU0NDU1NTEyMTU3NDU1My8zMjE0NTg7OTIyMzUzMjU4Nzc0MTE0NTQz
NDQ0MjEyOTk1NDMyNDg3NTU1NTQ1NTUzNDA0NTc4NDI0ODU0NTIzOjg0NTQ1NTc5NTU1MzE1NTU4
ODQ1NTQ0NTQyNTc1NzU1Nzc7NTU5NzQzNTU0ODg1NzU0MTM4OjU1Nzs1Nzo4NTc6Ojg3MjU4Ojc3
ODo3NDk3NTU3NTU4NzU0NDU1MTI0MS8uLzAwMzMzNDU1NDg0MzQ0MjM1MjA1NTU1NDg5NTs6ODQy
NTQ0MzU4NzU3ODU1NTUzNTM1Ojs1Nzk4OTc0NTU0ODg5NTc3OjUzNTU1NTk7NzQ4ODo1NDg8ODg3
Nzk3Nzk1OTs4PDo5PDk4NTU3Ojc1NzU4OTU3OTk1NDU3NTg5Nzs1Nzo5ODk5PDo6OTg4NTc3ODc4
NzQ0MTMzOzg3NDU1NTU1Nz01NTU4OTk4ODUzODk1NTo7OTw6OTg4NzU3NTw3OTc5ODk5Nzk7NTc1
OTs6OTQ1NTc6OjU3OTg6ODU1NTo3NTg5Ojc1NTc3NTg4Ojg3Nzc1OTg1OTk1NTU1NTU3Ozs9NzU5
ODk8Ojc5NTQ4NTQ0Ozo3NTU1Nzo4ODU7ODQ6Nzc5Ozc6OTg0NTU6Nzs3NTU1NTs4NTg5Nzc4Ozs4
NDU1ODk1NTU1NTo6Ojc0NTc3NDU0NTM1Mzg0NDM0NTc1OTc1NzczNDU3NDQzMzMyMjE0NTUyMTU0
NzU1MzI1NTU3NTk3NTU1NTM0NTk3OjM3NTQzMjU4OTo3MjEyNzc1NDc3NTU3NzQxNTg1MjQzNTU1
NTU1MjQ1NzU1NTQ1Nzc1NDc5OTc0NTg1NDk0NTQzODU1NDgzMjM1NTQyNTg1MzU1Nzk1ODU6Ozcw
MTU1OTk3NTk4NTQxMjU1ODg3ODU3NTU0MzU3NTI1NDM1NzQyMzUzMjU1OTg3NTM3NDU1NTk6NzUw
MjU1NTc1NDUzNTU1NTgyMTk0NDQ4NTM1NDU0MjQ4Nzc5NzM1NTQ3OTQ1MzQ1MjU1Nzc4NTQ5NTc1
Nzg3NTI1NzU1NTQyNTk0NDUzODg4NTc0NTU1NDg3ODk4OjU1NDIyNTg6Nzg1NTc3NTI0Nzg3NTc4
NTc1ODc5PTo4NDA1Nzc4Nzo1NDU0ODk1ODU1OTM5ODc1Nzc3ODUwNTU0NzM1NTU4Ojk1OzU4MzM1
NzQ3NTQ0MzU1NTM0NDk4NzU1ODc3MzU4ODk4OTc3OTU1NDMyODg1MzU1NTg3OjQ0Mzc3ODg1NTg4
NDU1NTo7Nzg4Ojs5ODo6Nzo5ODQzNTU1NTo5NTU4Ojg6OTc6NTU1NzU4NTc4ODc1ODc3NTg8Ojc1
Nzo4OTc3ODg5NTc5NTs7PD07Ozk3PDo5Ozo6ODg3ODw7OzU5PTs8PT4+PDs4NTo7Nzs+PTs8Ojw9
PD49Ojw5PDo5OTo8Pjc5Pj4+PDw8Ojo9QD08Ojo9PD45PDs7Pjo8PUA+Pjk7OTk8PTw8PDw7PEE8
QD46PDs3ODk7PDc4ODo8Pj5BPT47OTs7OTg6OTs6PTw+Ojw8Ozw5NTU6Oz49Ojw5QD06Oz48PD45
Oz06PD09OTlAOTs3OTs6PDs6PD48Pjs5PTw9Ozw3OTk8Pj0+PjxAOz08OTg6Oz0+PT48Ojs9PT06
Oz0+Pj08OTs+PTs4NTc9Pjw6OTc6PD06Oj07QD4+QDo5QDxAPjo7PT47OzxBOzs6Pj45Ozo8OT08
PTsuNTMwMjEwLzIzMTMyMzAzMTIzNTU0MTc0NDMzMDMvMDQ1MTQ3MC4vMDIwMzMxLzM0NDMuMS8w
LzExMi8zMzEyMDMyLzAzMjAzMDEyMTMzNTQzMS8xMjQzMjQzNTUzMzUzNzQwLi4xMS4xMjAwMjIx
MTIyMS8wMzIzLi8zMzUzMi8xNDQyMzU1NTQyMjQzMTMxMDEyMTIuMDMxMjM1MzAxNTUzMzI0NDMx
LjIyMTQyMzIzMjEzMzIyMjM1NDU1NTQvMzUyNTc0MTMxMjAzNTUyLzQzNTU0NTcxMjEuMjU6NTUw
MTMzNTQyNDMyMzQ0NzIvMjUzNDUyMjEvMTMwMTM1NTM0MzEyNTE1NTg3MjIyMDM0NTc1NDU1NDQz
MzI0My8vMzU0MjMyNTQ0MzMyMTM1OTQzNTM1NTMyODg0NTIzMjc4ODg1Nzc4NTM3OjM5OTgzMjQx
NTU1NTQ1MzUxMTMxMjU0NDQ3NTU0MjM1My8yNzc0MjU1OTU0NzU3NTUzNTg1NTMxNTE1NTIzODcz
MzEzMzM1Mi4wMzU1MjEyNDU0NTI1NC8yMjc0NzU1NDU0NzUzNzcwMTU5NzM1NzU1NDI1NTQ1NDU3
NzQ0ODc1NTU0MjM0NTg0Mzg6OTg1NzU1NTU1NTg5MzI0NTU1NTU3NTc1NTc0MzQ5NTMzNTU0LzQ1
NDQ0NDM1NzQ0MDI1NDM1NzUzMzUzMTMzMzQ5MjEyMTM1NTU1MjMxNTozNTAyMzAyNTgzMzUzMjI0
MjE0NTQxLzEyMjMzNTUzMjI0NTQ1MTU1NTIzMjIwMTQyMzM1NTc1MzIxNTUzLjA1NzMzNTQ0Nzc1
NTQ4MzQ1MzQ0NTI0NDU3NTc6ODQzNTQzODU0NzU3NTc4NTMyNTUzMzs5Nzc3NTUzNTU3NTIwNTU1
MzczNzUyMTc4NzQwNTk1MjEzNDU1NDAyNDE1Nzc3NDMzNDc1NTU6NTQ1NDUzMzM1NDc5NTg6Nzc1
MzM1NTQ0NDU5NTMzNDQ1NDQ0NDIwMjA1NTU0NTU1NTQ1NDU1MzMzNTQ1MzcxMjM0NTU3NzQ0NTU1
NDQ0MzQ1NTU1NTM1MjQxMzU1NTQzNDQzNTI4NzUzNTUxMTMxNTU4NzUyNDQ3MzM1Nzc1NTUzNTo3
NDM1MzE0ODc1MzU1NDI0NDo5NDU1NzQ1MzE1NDIwMzc1MjU0NTcyNDUzNzg1ODU1NDU1ODU1ODU1
OjQyNDU3NTI3NzQ1MjAzMjIvMjIyMzAxMzAvNDU1MzI0MzM1NTg1NTU1ODUwNTU1NTs6NTU1OTU1
OTg3NTU3ODk3NDI0NzU1NTc1ODU1NTc4NDc7NzU4NTg1Nzc1MzQ5ODs7Ozo4NzU4Ojk5NTU7Ozs5
NzU3OTo1Nzg4NzU3ODk9Ozo1ODw5ODk3NTk4ODc4OTk6ODU1Ozo1Nzk6NDg5OTU6ODo3NTQ7PDs1
NTc4OTs5OTk6ODc1NTU3ODs4Ozk4NTo3Nzg5OTc1NTc3OTo6PDU0Nzk1NTo6Nzg5Ojg3Ojc4OTo1
Nzc1OTc3Ojk1NTk1NzQ1ODg1OTo4ODc4Ozs5NTU1NTc1NTU5OTk3NTU5OTU1NTc1ODo1NTQ3NzU1
Ojc5ODs4Mjg7NzU3Ozk3OTg3Nzk5NTc1ODs5ODg4ODU4ODU7OTk5Nzw0NTU4ODo7NzU3OTU0NTU1
Nzc1OTUwNDQ3Mzc1NTU4Ojc5ODg4ODc4ODU3NTU3NTc1Nzg6NTU1NTk1NTU0NDQ1MTQ3NzUzNDMy
NTg3Ojc0NDc1NTQyNTQvLDEzMjQzNDg1MzU0MzQ1My8yNDM1NzUzMzMyMTU3NTU3Nzg1NTQzNDo9
NTE3NTo1NzQ1Nzo5ODk4NDM1NTg1NDI0ODo5OTU0Nzc5NzQ0NTQzOjk1MzU0NTE0NTU1NTU1NDc1
NTMzNTg6NTQ1NTU1NTc3NzU3NTU0NDE1NTU1MjM3MzQ0NDQ1NTQ0Ojg1NTc3ODU3NDQ4ODc3NTQ1
MzU1NzQ0NDUzNDU1MjQ0ODc1NTc4OTk4OTg3NTMxNDU1NDk1NDg3ODIyNTUyNDU6NTo0NDEzNTQz
NTUzNDU1Nzg5MzU1NTQ0Nzk5NDM1NzM4NTczNDg3ODg3MzMxNTo1NDU1Nzo4Nzk1NTUzNzc3NTUz
NTU7OTU0NTU3Ojc0NTk0NzcxODc1NDQ5NTo7NTU1NTc6NTc0Nzk5Ojg4ODU1NTk3Ojg0NTU5Nzg3
OTo8OjQ0OTc5Nzc5NTU3ODg3NTUzNTg4ODg3ODQ4OTU1NzkyMzU0NDg1OTc6Nzo6ODU1NTk6NTg6
ODc0ODg9NzUzODc1Ojo4MjU1NTc1MzU6NDQyNDQ0Nzg1ODo5OTkzOjk0NDU0NDk1NTo6Nzk3MTU3
ODU3Ojg5NTU9Pjs5NDc9OTs5Nzk4ODo3Nzc4Ozs6PD04ODg4ODk4NTg5OjU4Nzg4Nzw8Pj09PDk6
PDs8NTc5Ojk7Ozw7Ojw6PTo9Ozk6Ozg9Pj06PD07PTk7OTk6Oz09Ojs+PTo7PT45Oz5BPT47ODg8
Pjs8Ozs7OTw8Ojs+Pjw+Pjs+ODg8Oj0+PTs7Ozo6PTs8Nzk9QT06Oz07Ojw7OT4+PDw4PTw7Pj07
PD5APjk7Oz46NTk9Ozs8Pj49Oz49OTg6ODc8Pj48Ozs3ODo9Ozo6OT08PD47Pj06Oj47Ojk9Ozw3
PDs4OTo9Oz0+PD4+PDo7PT0+Ozg6PT08Oz05PTw8QD06Ojw7PD47PDw7Oj07NTU5Ozs6PD04OTE1
MzExMi8yNzEuMDIyNDMzNTIxMjUzMTE1NDMwLjIzMDA0MTEyMC8zMTIzNDMzMjEyNTA0LjA1NTEz
NzM0NDQ1NzAvLy4xNDUyMjIzMi8wLzU1NTMzMjQzNTQxLzAvMDU1NTMvMjEwMzU1MzQzNTQzMjIx
NTIxMTMzMjg1MjU0MzMzMjMyMDAwMzk5MjQ1NTIyMzM1NTE0MDE0NTUzMDIwMzEwMzE1NTEyMjAx
MjQxMTQzMzIxMzU1MzMyLzE0NTQ0My4xNTUzLzMwMDMyMTQyMTE1NDMzNTM0MjMzMzMxLzIyMjQ0
NDEyMzU0NTU0NTAwMDM1NTExNDQ0NTExMzQ0NDIzMzMzMjAxNDk3NTU0NTEzMzUzMzExMzEzNTUz
NTU0MzU1NTg0MTI1MjU4OTU1NzUyMjU1NTQ0NDE0NTM1NDQyMzQ0NTMzNDU1NzU1NTU0NTU1MDU3
Nzc1NDc3OTUzNTMxNzc1NzUzNDU1OTU0NDI0NzczNDQ3NDA1NTU4NTU1MjQ0MzMzNTU0NDkxMjU0
MzQ3NTU0MzM0NTU4NTQ1NzQ1NDIzMzMyMS4yMzExNDUzNzc1NTU0ODczMzU3NTc1NzcyNTczNTIz
MjQyMzg1NDIxMjEvMjMyMTg4NDU3MzU5NTM0NDUyMjU6Ojc1Mjk1MzI1NDUyMjc6NzczMTU0ODMz
NTUyMzQwMzExNTU1OTQ0NTIyMzUyODUzMzEzNDk1NDg1MzI1NDc4MTI0NzQyMjQ0MzQ0NzczNDU1
NTMyMDc3MDIxNDU5NTo3NDE1Ojg3NTM1NDg0NDU3MjQyMjIzNTAzMjM1NTEzMzM0MjIzNTM0MzMz
NTU1NTU1MjU5NTM0MzQ1NTc1NzEyNDg0MDI1NTA1MzE1Nzs4NzEyNDQ6MzQ0NTc3NzQ1ODg4NTUy
NTc4NTQ1Nzk1MzcyNTg0NDM1ODMzNzUzNTMwMTM0NTQyMzEwMjc1NDQ4MzU3NTM3NzE1NDI1NTU1
NTQ1NTUxNTk1MzU3NDU4MzQ1MzU0NDU3OTMzNTU3NTM1ODg4NzI3NzQyNT03NTQ0ODU1NTk0NTU1
NDQ0Mjc1NzUzMzc5NTU1NTU3OTU3NTU6Nzc1NzIyNTo3NDQyNTk1ODk1ODU1MzgzMTM3NTMzNDc4
OzUyNDU1ODc1NTc4NDU1NTM1NDIzMzQ3NTU1NTUxNDk1Nzw6NzUzMzk1MjQ1NDU3OjgxMjc5NTUy
ODI1MzUxNDUzMTIzLi4xMS8uMS4xMjIvMi4vNTUyMTEwNDU1MzMxNTU3MzM4PDk5OTo6NTU4NzM0
NTU1NTQ1NzQ0ODc1NTQ1NzU1NTg1Nzc6Ojg6Ojw1NTo7NTg5ODU1OzUzMzQ3NTg4Ojc7OTU5NTc4
NTg3ODk6OzU5NzU1NTU3Ozk5Pjs7OTc5OTU6Ojk3ODk8ODk6Nzg5PD47ODk3NTU6Ojo1NTw8Nzk5
ODQ6OTU3NTg3NTk6OTk3Oj06OTk5NTc3NTQ1OTg5OjU3OTg1ODc3NTk3Ozo7NTU6ODc6ODU4NTg6
ODk1NTs6ODc3OTc4ODk1Nzg6ODw5NTQ4ODU1Ojs5NTQ1OjU1ODg3NTc1Nzc7OjQ0NTU4Ozo1OTs4
NTUyOT05NzU0NTU7Ozo8Ojg4ODU6NTU4Ojw5OTU0NTU4NTU4Ojg1NTg5ODU4NTU0MjQ0NDUzNTU1
Ozc0NTE1ODo8Mzc1NTU4ODUzNTU1NTc1NTM0NDMzMzEzNTk5NTU4NTQ1NDU1NDI1NTIzOTg3MzI1
NTU1NDU1NzU3OTU0MzUyNDU1NTM0NTU1Nzg3NzU0NTQwMzU3OTU3Nzg4ODk1NTU4NTM1NDQ1Nzg6
NTc1MzU3Mzc1NTQ0NTM1Ojc3NzgzNTg1NDg1NzU3Nzk1NTg1Nzg1NDM1NTU3Mzk3ODc4Nzo5ODc4
Nzk6NzQxNzk6NTU1ODg1Ojc1MTE1NTc6NTc1NTc1NzczNTU0NTg3NDE0NDI0OTg4NTQ1NTU6ODc1
NTQzNTg3ODgxMTI0NTUyNzQ1NTQ4NTM1NDQ0Nzc4NzQ0ODg3NTU5NTUyMzc1NTU1Mzc3ODUzMzQ0
MzM1NTo7Nzg1NTUyMjU1NzIzMzI1Nzg3NTc0Mzg3ODo4Ojo1Nzk1NTUxNTU1ODg1NTc0NTo5ODo1
MzU5Nzk1NTo5NTM0Nz07NzU5NzU5NTc1Nzg3NTc7OTc4NTk4NDQ3OTk7Oj03NTs4NTczNTk5OTUx
MjQ0NTU5OTg1ODU1Nzc3NzUzNTk4PTU3ODk6OTU1Nzk1NTQ3Nzc1OTo5ODUxNzk1Nzc6ODg1Nzk5
ODUxMzQyNDM3OTc1Nzg3NTU1NTg3ODc1ODc4Nzc1NTk1NTQ1OTU5NTUxMzU1NTk1OTo7NTc4PDs7
NTU5OTg3OTs4ODo5ODo5NzM4Ozk5NTU4Ojo6Nzg5Ozg4Oj05NzU1OTc4Nzk6PDc9PTw8OTs7PTs7
OTk4Nz0+Pj09Pjw5Oz4+PT4+Pjs7Pjk+Pjs8Q0I6PDs7PT49PDs6PT08Oj0+QTs7Oz08Ozo8PTo6
PD47QDw7Ojw7PTs6OTc4PDw5PDw5OTw+PDw8PD08PT49Ojw6PT46Ozs6PT09PDg6Oj06Ozg7PDo4
OTo4OT09Pj09OTo5PD0+Pj09Pj06OzxAOTg8Pjs3Ojs8PjozNzw9PTs1OTw+PDo7PD06Pjg5ODk7
Oz48Pj09PTw7OD48NzU8Ozs+Oj06PT06OTc6Pjs7PEBAPDo6PDhAPTw7Pj4+QT06ODk8LzMyMDEx
MS4zMzIxNDQ0MzMyMjI0NTMwMC8xMTAwMC8vMC8yMzM1NTQyLzM1MDU0MDIvMDAwMzAuLi4yNDUz
MTQ0MjIyMDMyNDIyMi8sLy8wLzEyMzIxMTAvMTIyMTEyMzIzMTIyMjIzNTQ1NTQ0MTE0MzQyMjE0
MDEvMzMxMzEzMjQ0NTQ1MzU5ODQwMjQzNTMzMjQ3ODEvMzMzNTM1NDIwNTQyMzAwMjExMjQzMjIx
NDEyMTM0NTEyMDEwMC8zMzQxMjIwMzQvLzI1NTIzMzIwNDUzNDMyNTQzMzU1LzAxMTMyMjI1NTMz
LzQ4MzM0MzMwMDUwLi81MjQ0MzMzMTQ3NDAsMTA0NDQzNDg0MDAvMzQ0MzU1MjAxMjEyNzQzMzMy
Ly80NTU1NTQ1Nzc6NTU1NTM1NDMyNDUxNTUyNDU3NTEwMDU4NTU0Ojo3NTMzOTU1MjM5NTMyMzE1
NzQzNTc1MzU3NzIxNzQ1NzUwMjM0MDg1Mzc3MzEyMjc3NTU1NTUzNTU0NTU3NDg3NDQ0NTk0MDU1
MzQ3NTU0NDM1NTAvNTc1ODc3NzM0NTU1NTUxMjU4NTU4NTU0NTczNDU1NDQ0NzUzMzU0MTUyMzQ1
MzE4ODc1NTM1NTg4NTMzMjQ5ODU0MDU1NzU0Mzc3NTI1Mjg3NTQ0NTM3Ozc1NTc1NTEzNDQ0MTAs
MTQ1NTQxNTIxNTUzNTQ0NzE0NTU0NDk1NDIzMjg0MS8yNDU0NDIzNDQ0MDMzMTQzNTMyMDE0MDMy
NDIxMzQzMzIyNDU0NTUyMDIzNTc0NDIzMzIxNzc1NTU1NTM0NDE1MzU0MTMxMjU1NTc1MjU1NTU1
NzMxNTI1NTc3NTg1NDg4NTU1NTQ3NzU1NTE1ODQ1NDI3ODM1NzM1NDMxNDk5NTMzMzU1NTM1MzQ0
ODM5Ozk5ODo4NDU1NTUzNDQ4NTI1NTI1OTg1MzUzNDU4NzI6ODk5ODUzOTU0NTo5NzQ0NzU1OTI0
NDU0NDIuNDU4MTEyNDM0MjI0NDU6ODUzNzU4Nzg1NzU1NTc1MjIwNTM1MjI3NTM1NTU1NTQ1ODU0
NTc0MzQ0ODQ1NzUyNTQ0NDc3OTU0NTU1NDQ1NTU3NTQyMzQ4OTU1NzQzNTc1NDk1MzQ4ODU4NTU1
NzIzNTU1MzM1NDU1ODUzNTQ1NDc0MzQ1NDc1NTU1NTQ1ODk1NTQyMjEyNTk4NDU1NDU1NDU4NTMw
MzQzMC8xMTIsKSgrKywwLC8uKy8uLywuNDMxMjUyMjU1MTAyNTAyLjAzMzQ1MzQ1NTU3NDU0NDg1
NDM4Nzc1NTc3ODUzNTg1NTQ1NTQ1MTEyNTc1NTU1OTg3OTs3NTc6OTs6ODw9Ozo5OTo7Nzo4Ozo5
PTw5ODUzNTw4PD04NTU1NTo5Ozk1NzU3ODg4ODk8Nzo5Ojk4NTc6OTU1OTk7OTg6Ojg4NTU5NTg4
Ojk4OD08PD44NzU1ODs1Ojk1OTU5ODU3Nzg3NTc6ODc1NTk3NTU3ODc6OTc4Ojg4NTk8NzU0NzQ1
NTU8OjgzMTU7NTQ5PDc4OTc1Ojw4Nzk5ODc3NTQ1ODg6Ojc3Nzc5Ojk6OTw5ODg4NzU3ODg4ODc6
ODU4NTgzNTk3ODQ1NzU4Ozg1NDU5ODg5Ojo0NTU5Ozg6PDU4OjQ0OTk1Nzc3NTU0NDU4NTUyNTc3
NTc3OjgzNTg1OTo5NTQ1NTg6NTg5OTk1Ojo1NTQyMjQ1NzQ1NTg7NTI1MjQyNTQ1MzI1NTQ1OTc4
NDQ1MzU1NzMzNTU1NDU5OTk1NTc3NTk1MTc1NTM1ODg1MzU0ODczNTQyMzcxNDc3OTg4NDU0MzU1
ODU3Nzc5NTc0MjQzMTI1NTM3NTU0ODc3NzU3NDU6OTc3OjU1Mzg0Nzs6OTU1Nzc4Ozo4NTg4NTM1
NTk3NzM0NDMzNzg1NTk4Nzg4MzU1NzU1NTMyMzc1MzQ0NDA0NDc3NTU1NDMzNDczNDc4NTQ1ODk6
OzUzNTc4ODU0Nzc3NTQ0NTQ1NTMyMzg7ODMyNDQ4Nzc5NzIzNTI1NTM1NTI1NzU1NTUzNTc1NTM0
NTQ1Mzc0MzM3MzM3OTU1NzU3ODU5NzUyODg3Nzc3NzgzMjE1NzU0NDQ1NDU0NzU1NTM1NzczNTc0
OTg4NTc1NTQ6NTU4MjQ0NDU0NTU1NTg1NTg1NTU4OTc1NTM1NTU1NTU1NDM1NTU1NTM3NzM0NTc3
OjI1NDQ1NDU7PDo4NDI3OTs3Nzk4NDU0MzM3OTc1NTU1MzU1Nzk3NDU3ODg3NzU1NTU1NTU5OjU3
NzU3MzU0NTc1NTU3Ozs7OTU3OTU0NTs5NTQ1Nzk6NTQ3PDo7OTg5OjU1Nzo5ODU1NTg1OTo6Ojk4
NTk4NzU1Nzo4NzU0Ojs3NT47OTo8Ojo8Ojw9OTU7Ozo6OTU5OTk3Ojk5OT47ODc7QEFCQjw4OTo7
NTg8Pjo7Ozw7Ozo8Oz47Qj04Pjs4PD0+PD1BPj4+PD09PkA6Oj07ODs+Oj04PEE+OT4+PDo8Pj48
Ozw9Pjo5PDw+PTw8Ozw8PDw8PD06Ozo6Ojs+Qj46Ojw4Oz49Ozw9Ozs8Oz4+PDg7PT47Pjs9ODg7
Pj49Pj4+PD0+Ozs5PT4+QDo6PDw6PDs6PDw7Pjs7PkA+PDs7PT48PUE+Oj5APj0+Pj08Ojs7Pj49
PDs6Ozw8Ozs8PT08PD49Pj06Ozw+PTs9PDw+Pjw5PT46OTs8PUE+PDw3PDw+PTgxMjQ1NTUzMzM1
NDI0NDMzMjExMzIzNTMzMzQxMDMwLzA0NDMzMC8yNC8yMTE1MTAyNDQzLzIzMS8zNDUwLjM1NTQz
NDUyLzAxMzU1NDM0NDQzMDIyMjQyMDMxMC4sMzU3MzEyNDU1MzU3NTMzNDU1MzczNDM0MjU1NTU1
MjQ0NTQwNTMxMjc1MjM0NDI0NDQyMzU1MzU3ODMyMTMzMjQwMDIyMDQ0My8zNDQ1My4yNTU3MzIw
MTU0MjIzNTUzMzQ0MzM0MzM0NzMyMzI0NTUxMi8yMTAzMjMxNTQyMCwwMzUyMy8xNTgzMzMzNzM1
ODU1NzczMDQzMTE3NTU1NTMzMjMzMzMzNTUyNTU5ODUxMTE0MzIzMjI0NTM0NzMzMzIzMTQ4MzU0
NTU1NTQ0NTQ0MzM1NzU1NDUyODQzMjk1MzQ3NDE1ODU0NTU1NTU0NDI0NDQ0NTc1ODM1ODUzMjU3
NTAzNzU4MTE0NDUwNDU3LzM0MzU0NDI0OTQxMTU0MzQyNDIyMi8xNTg1NDUyNDU4ODI0NTQ4Ny8y
MzM1NTQ0NTQzNTIwMTQzMjQzLjI1NzU5NzgzMjU1OTMxNzg1LzQ1NTI1MjIzNDUxMTM1ODM0MjQy
NDU1MjMzNDc4NTUzNTU0MzQyMTQ3NzU0NDczNTU0NDk1MjU1MjM0MzMxMTI0NTU1MzQ0NDQ1MjQz
NDQ1MzU3NTUzMTQ0NzU1NzU1NTU3ODc1NDUzMzQwNTU0MzQzMzUzNDU1NDQ1MjI1NzUyMzU0NTU0
NDU1NTUxMzc3MjEwNDU0Mzc1NTUxMzUyNDMyMzQ0MDI1MTEzNDQ6ODMxODU0NDMzNzM1NTU1NTc0
MjM1NTc1NTI1Nzk3NDQ0NTk0MjU0MTc1MzM1Ozg3ODs4NTU4MjczMjU1NTU4ODU0Mjc5NzU1ODU3
NDI0NzM1NTQ1NTIwNTU3LzAyNTQxNDQ0NDU4NTQ3OTU1NDI0MzIxMTQzNDU1NDMyNDU3OTU5NTQ3
OTUxNzU1NDM0OjU1NTU1ODU0NTo1NTM0Ojk1NzQyNDQ4Nzc1NzQ1NTU0MzQ3NDM3NTU3NTU1NTc6
Ojg0NDEzNzU5NTk1NDU3NTUyNTk7ODo1ODs4NTEyMjM1MzQvMTI1NTU1NDUzMjUyNDM1NTcyNTQ1
NDUzMjIyMzMyNTU1ODg1NDQ4Nzc1ODg3MzIxNDg3NTQ4NTQzNTU1NTU1MjQ1NTE1NTk0NDIvMjI0
NTUzLywqLCwvLC8yMDAwLC4vLzIyMjAzNTUzMjExMjAxLy4vMzUyNzs0MzEyMzU0MzI1NTM1Nzc4
NTc6NDUzNTU0NTUzNTs6NzQxMDU1ODUzNDc6OzU3NTc4NTU3Ojk4OTczNTU3NzU4NTU3NTczNDg6
ODk4ODg0NTk5NTc3Nzo5OTg3Pjo3NDQ0ODQ1ODU8OzU4Ojo4ODc3NTQzNDg3NDk6NTM1OTc4ODg9
PDk1NTU0Nzs3NTg5ODk4NTQxNTU3Nzc4Ojg1ODc4NTU1NzQ1NTo5Ojg4Ozk4NDU9Nzc1NTc1NTcz
NTU1NTs7ODU1Nzg6OTw7NTk5ODU5NTU3Mzc3ODc1NTk4Nzs6OTU1NzM1NTU1OTk3Nzg1Ozg3NzU4
Nzc3Nzc4Nzc1Nzc3NzU0NTU0Nzg1NTU3ODU6NTQ1Nzg3Nzc4NTU3ODg3OD00NDQ1NDU3PDU3NTc3
NTQ1NzU3Nzc0ODg3NTU3NzQzNzg1MzU1NDU5Ojg6NDU4Nzc1NTU1NTc3ODg6PDg0ODg0NTg1NTM0
NTU0ODk0NTc3MzU1Ozc1MjE0NDU1MzU1NTU1NTQ3NDQ1OTc1ODo3NDU4NTMzNDk1NDUzNDk3MzM1
NzU3NDQ1NTU3MzU0NTU3NTcxMDU1NTg4NTI1NTUzOzU1ODk1NTU1NTk4OjU1MzMzNDU1ODU1NTQ1
MzU4NTIzNDM1NTk1NTUyNDc1NzU1NTM0ODM1NTQ3ODo3Nzg1Nzk1NDM1NTQ3ODM1NTc1NDUzMTQ3
NTU1NTMzODk5NDQ4NTM1NTc1NTc5NTQ3NDU3NzgzMzM1NTU1NzU1ODc0MzU1NzU3NTQ1OTc5NDM4
NTQ1ODU1NTM1ODU4NTQzMjU1NDQ1NDc1NzUyNzo0NDg5OTc1Nzc3Nzg1NTo5NzU3NzU1ODQ4OTQ1
NDc1MTM4ODQ1NDU3OTg0NTU5Mjc3NTQ1NTM1ODU3NT49ODMzNTM1NTczNzUyNDU6PDg1NDUzNzc6
Ojc3OjU4ODo1Nzs1NTg4NTU5NzM0NDc4NzU1ODo1Nzg1MDM1NTg1NTU3NTQ5NTU4NzU0Nzc5NTk4
MzQ3ODk4NTU3NTg4NzU4OTU1MjM3NDU3NTQ1ODU4NTk3Nzo8PDk1OTc3OjczNDs5PDg3ODo4OTo5
PTg1ODo9Ojc1ODk5Nzk8OTc3Ojk7Ojs7NTM5Pjw9OTU3PD4+Ozo6OTg4Ojg5OTo8PDg1PkE+Ozw6
PDs6OTs8PD47Oz5APj09QD49PDo6Ojk6PkA7Ojs+PUBAPT48PT48Ozs6PD4+PDo3NzU3Pjw5OTw4
Oj08Pj09PDg6Pj5BPjs+Oj48OT0+PTs6PDs7Ozw5PDs8PUA9Ozo8PDw6PDg7Ojo7Pj4+Oz08Pjw9
OTk8Ojg+PDg6Ozo+Pj4+PDxAOTg7PTo9PDk9PDs8Ojo8PDs6Ojk6Ozo9Pj4+OT08PDw7PDs5Ozs8
PTo+Pj08Nzs9Ojk5PUA9PT08NTs9PTo6PTs8QEE+Ozk+Oz05Ojo+Pj49PjQyMTQzLywuLzIyNDQu
MS8zLzEvMTMyMzQzMjExNTMxMjMzMjEyMzc1MjUyMjIsLy8zNTQ0NTEzNTU0NTAzNC8yMTA0MjMw
MDIxMTAzMzIyNzUxMTMyMS4wNDEzNDAxMTM0MzM0MzQ1My8xNTQ1NDU0NTMyMTEzMjEyMTExMTUy
LzExNDMxNTM0MjEwMjQxLDQvLy8yMDExMzIwMjA0Mi80Mi4sLDIyMjQ1NTMzNDMxNTU1MS8wMjMv
LjEvLzQzMzMzMjI0MzIyMDMyMTIxMzgyMjQ0MzExNDUvNTQyNDUxMDM0NTQyMjQyMTEwNDEzNTEw
NDQxMjM1NDU0MzMyNTU1MzMwNDk1MTQzMjMyNDQ0MjMyMTEwMTQ3NTAzNDEyNTQ1Ny8xMjMzNTQ1
NTUzNDM1NTU3NTc3NDM1NDU1NzUzNTQ3ODMxNTQ1ODQ0NTU3NDU1MzQwMzQyMzQyMjExMzU0NDQ1
NDQ1MzM3NTQ0MzQ3MzM1NTU1MzU1NTM0Mjc1NzQ0NDI1MzA1NzU0MTQ4NzU0NDI1NTU3NzQ1NTUy
NTU4NTU0NzU1NDMzNDI1NTU0NzM0ODU0NDU3NTIwMzU0MjU1NDc4NTUyMzU1NDU0NDA1NDM4NTM5
OTc1NzU1NTM1NTU1NTc0NTU5NzQ0NDM3NzQyMzU0NTg1MzMzMzU0NTczMzU1MzU1NDI1NTMyMTUz
NTUzNTc7NTc1NDUwMTQ1NTIzMzQ1OjU1NTMzNTUwMzUzODQ1NzM1NTQzMjI0NDg0MzU0NTMzMjE0
ODU1NTUyMTM0NTIyNzIxNDMzNTU1NTUzNzIyNTEwMzMxNTAxMjQzMzM3MzM3NDU1MzEyNTM3NDU4
MzM4MzQzMjU3NTU1NTI3OTIzNTU0NTQ0NTQ0NDQ1OTk1ODk7ODc1NTQ5ODU1NzU6ODU3NzUxNTMz
MjEyMjM4NTM0NTU4NTc1NTQyODQ0Mjc4NzQ3NTg3OTo5NTM0NDQ3NTQzNTU1NTQ1MTU4NDU5NTQz
NzU1NTU1NTU3NzU3NTU1NTg1MzU1NTU0MzM0NTc3NTM1NTM0NDMyMjQ0ODEvNTU3NDQ0ODU0NTQy
Ly80MTMyMTE1NzUzNTU3NDM1MzAxMzUxMTc3ODg4NTI1OTc3ODU0MjUzNTQ4NTg5Nzc1NTU5NTQ1
NTc1NTM1NTQ0NzUxNTUyNTMzODU0NTg1MDMyNTM1ODo0NzU1NzMyMzIwMDU0MjAwMjMwLCwyMDAx
NDEuLC8xLzEvLCsvLy4uLiwwMTAvMTEwMCwyMjIvMDExLi8vLi41NzE0NDc4Ozc0NzQyNTcxMjQ1
NTM1NzU4NTg4MzUzMzU3NzU4NTU4OTc4NTM1NDQyNDc0NTU6Ozk1NTQ3OTk5Ozc3ODk5NTc3Nzs3
NTk8Ozw1NzU4Ojg1NTU1ODU4NTc0ODg6Nzg4NTUyODc7Nzk5NTU1NTU3PDw4ODg3ODM1Nzo4Nzc3
OTQ7ODI4OTg5NTU7PDg5PDg3Ojs5Nzk4Nzg5PDU0Nzg3Nzc4OTg4OTo5ODUzNTU3ODo4NTk7OTU4
Nzg4OTc1Nzc1OTk1ODk3Nzc1Ozg3NDc1NTk3PDo1ODk3ODo5ODQ1NzU0NTU3NTc3MjQ3Nzs5NTM6
NTU6Ozw7NTs6NTM4NTU1NDQ4Ojs5NTg3Nzg1NzQ1NTU1NzU3NTs3OTg1NTQyNDU4NTo5NDg6Ozc0
NTUzNzU1Nzk3NTU1OTU1NDU1MjU1ODU1NDQ3OTg4NTU0MzU1ODk3Nzc3OTU3ODk5NzU0NTM0NTc1
MzU1OTI1NTQ1NDUzNDU1NzU4OjU1NDQzNDc4NDM0NTQ1NTU0MjU3ODU0NDUzNTU1NzM1NTQ4NTU3
NzUyNDU1NTQ1Mzg6Nzc4NTM1ODM1Ozg5NzU4Nzg4OTU0NDE1NTgzNDI1NDU4NzU1NDQ5NzU3NTU1
MzQ4NTU1MzAvNTQ0MzU1NDU0NDU3NTU0MTU0NDU5ODs4NTQ0OTc1NDM1Nzg3NzU1NTU1ODg1NTc3
ODg1MDI1NDo1Nzk1NDU1NzU0NDQzNDU0MjU1NTc7ODU1ODU1MTU1NTc5NzU1NTU0ODU4ODk0NTU0
NzgzMjU0MzU1NDU3ODo1ODg0ODU0Ojc1NTkzNTczNTg4Nzg1NTg1ODkzNTU6OTc1NzQ0NTU3OjUy
MjQ1Nzs1NTc4NTo3NTc1ODU0MzU1ODk3NTU6Nzg4Nzg1Nzk0MzU5OTU5Ozc4OTkzMzc3Nzg0NzU0
NDU1NDU4NzU3NTU1NDQzNTc4Ojo4Nzk4NTc4NTc0Nzg1OjU4Nzo0MzU5ODU1OjgzMzc1MzU1NzU3
NzU5NzU1MzM3Ojk1NTI0Nzg3NTg1NDM1ODU1Nzc5NTA1OTk7NzU3NDk4NTk1NTQ1Ozs1NTc4ODc3
Ozg5PDk6Nzk5Nzc3OTw5NTg+ODg4Oz06Oj09Nzg7Ozc7Pjs6ODo8PTk3Oz09QEA+Ozs+Pj1APDk5
PD47Ozw+Ojc6PDw7Oz08Nzw7PDw8Nzs6Ojg+Oz4+Ojk7Pjo5Ojs8PT09PDs7PTs7Ojs+Ozw8Oz07
PDxBPjs8PDw7Ozo8OD5APUBAPjw9Pjw8Oj4+Pjw4Oj48Pjw8PTs+PTpAPDs+QDw7NTs6Pj48Pjw5
Ojw+Pjw7Pj1AQD09PTg7Ozw6PUE5OT09PTs5Oz0+Ojw+Pj09Ozo6Ojs+PTw9OTU1OTw9Ozs7Oz46
Ozo7PD47PkA6Ozc9PDs6PT49Ozw+PTU6Ojs8PDw9PDw5Oj08PEA9MDAzLy8xMjUxLzA0MjEyMDI3
MzQ0NDIyMzAzNTUvMTMyMDAyLzA0MzM1MzE0NDAuMzUyMzIzLyouMDEyMzAwMi4yMiwzMjMyMTAx
MTAuLy4vMzU0MjMyMjEwMTU1MzUzMzM1NTQvLDAyMC8zMTEyMTM0NTU3My8xMTIvLjEyNTUyLzUy
NTUzNDExNTI1MzU1MjQzMjAvMjQwMTI0NTUyLjU1MzU1NTU1NDEyLy8xMjUxMjU1MjExNDUzMjMw
MzIvLjAyMzIwMTQ0MjM0NDUyMzQ1NTIzMzU0NDIyMTMxNDU4OjI1NDUzMzUyLzIuMjQ1MjAuLjEz
Ly8zNDQ1MTE1NDEzNDUwLjEyNDQyNTQ4ODUzNDU0NDg3NTUyMzEzNTQzNTQyNzUyLDM1NDg3NDMx
NDU1ODI1MzEzNTU3NDI0MzQzMzE1NzQzNTE1NTI0NDIzMzIzMTQxMzU1NTU0MjM0NDU1NTE0ODQz
NzM0OTc1NDM1NDQ1NTQyNDUzMjI0MDM1NTQyNDEzNDIzNDU4NDI3ODIzOTU3NTI0NTMyNDQ4ODU1
NTU4NDUzNDc3NDU0OTUzMzk4NTo1NTc1NTU1OTU5NTExMzQzNTQxNTc1MjU3NDU1MjQxNTQ0NzMy
NDc3ODc1NzU4ODk0NDQ5NzU3NDM1NTc3NDQyMTM1NzU1NTI4NTU3MjU3MjExNTMzMjAxMDQ1NzQy
MzMyMDM0MjU0NTQwLzI0MzI3MjM0MjU0MzU3NS81MzU1NTM0NTM0MTMzMDEvLzAwMDI3NDM0MjEv
MTMxNzUzNDU0Mzc1MzQzMDAzMzQ0MzI0MzQyLzI1OTU1NTU1NzUyMzA0NTExLzI1PDU3NTU4NzM1
MjA0NTU1NDc0NDIyOTczMS4yNzQ3ODk1NTQzMzQ3MzU3NTU0MjMyMjQ1NzU1NzU3NTE0NTM1NTU5
MzQ1NTc3NDU0Mjc3NzU0NzQyNTg6ODQ0MjU1NTQ0ODQwNTM0Nzc0MzQ1ODUyNTUxMzg1NTQ1NTUz
Mzc3NTU0MTAyMzczNTo5NTQ0Nzk0NTU0NTIzLjM6NTU3NzMyNDUwLzMzNTMyMzUyMTQ1NDQ3NTU1
NTQ3NTQ3NTM5ODU3NTQ1NTU0ODQzNTczNTU0MzU1Nzg1NTU4NDAwMDAyNTc6OTU4NzgwMzU0MjU1
NzMxLzQ4NzU1Nzc1MzE3NzQ1Nzo4NzU3NDU3ODg4NTk8NTMzMDIvMzAyMTU0NTIwLDAzMTAwLzEy
MDAzLzEwLi4sLCosMTEyNDUyLywwLywvMTEvLjMyLzAyNTk6NzQ5QEZHPDU0ODQ0NTc5Ozc1NTU7
NzU3ODg1NTU6OzUyMzc3NzM1NDQ6ODg4Mjg3OjU5ODc3NTg4NTg6NTg4NTc5PDs+ODc6Ozw5Nzo5
OzQ1NzU5Ozk0NTU3Oj48ODg4MzQ3NDU3Ojc0ODg4OTs3Nz45NDU1NTc3Oz07OTg3ODQ7Ojk1ODQy
ODU5OTo6PD05NzczNzk1NDw6NTU1NTg4OTk3Nzc3NzU0NTM3OTk7OTQyNDU5NTk7PDU0NzU3OTg+
PjU1NDk4OjU1Ojg0NzU1NDg4OTc4Ozk4MzU4Nzk5Nzg4Nzg6NTQ3ODUzODg3ODc3ODg3ODk4Ojg6
PDU4ODs7OTU8PTk5ODU6ODc1Nzk6ODU4NzU4ODU3Mzc6Ojc1NTg3NzQ0MzQ1Nzg5NDw3NzU0ODU1
NzU6Nzg0NDQ0NzUzMzc4NzM0NzU1NTUzMjU3MzI0MzQ1MTE0NDMzNTUzNDU1NTgxMTIyNzk1MTM1
NzM3NTM1NzU4OTU1MzU3MzU3NDMzNzg5NzU1NzU1NzQ1NTU1NTk0NTU3Nzk4NTM0ODUzNDU3NTU3
NTc5OjcyNTI1NzM7OTc4NTU1NTU3Ojk4NDM1NTU3Nzk1NTQ1Nzg1ODg6NTo6Nzs3OjQxMzo3OTk1
MzUzMzQzMzU3NTc1NTMzNTQ4Nzc5NTU1NTUvMjQ1MjE1MjQ1MzU1MjM0NDU3NTQ1MTM0ODUzNTc0
MjU4OTU3NDI3ODg5NTc1NDM4ODc1MjQ1NTUxNDc3MzIxMzk4NDUzMzM1MzQ0NDQ1NzU0NDU1Mjc1
MjIzNTMzNTUyNTQ0NTU4NTU1NTU0NTM1ODQyNDM0Mzc0MjEzNDU4NDo5NTg4NDQ4OzczNTU4NzU1
NDU1OTk7Ojk5NzU1Nzk3NDM0NzU5ODc1NTg1NTU1NTU0Nzc3ODk3Nzk4Ozk1NDU4Ozk3Ojc4Nzc6
Ojk7OjU3Ojo3NTg6OTg3NTQ3NzU1MjU3NTg6Ojc5OTU3NzkzMzQ1ODg1ODs1NTU5NzU3Nzg3OTk7
Nzg6NzU1NTU0NTg3Ozk5ODk6Nzc3Ozg4Ojw4NTc1Nzo3NTc0ODw6Ojc0NTc7ODk7Ojo7Nzo7Nzo7
Oj46ODo5ODk5Nzs8OTs3NzU7Oz08OTg3PD06PDo3NTo6ODc7OTg7Oz07Ojo6PDs8Pjk7OTc8OTg5
Oj09PTk7OjU4NTU+Pjw+Ojk8OT06Oz08Oj4+Pjw4Ozw+OjU4QDk+PjUzOzw+PT07Ojo6OTo8PTs6
PDo5Ojw7Ojo9PDc5Ojs8Pjs9Ozk5PTk5Nzo5Ozw8Pjw6PDo5PT06PUA8PD48PD4+PD1APTs7Ozg5
Ojs9PDo4Pj09PT06Oz08Ozw9PDk6OTc5PDo5Pj07Oj0+Pjw9Ojw+Pj48OTo7PkA9Ojs+QkA4Ojs7
QkJBOjs9PD07PkA+PD47OTs9Ozs8PDw4OTo5PD09Pjo1PTowMTIyMjIzMS8yNDMwMTMxMjE0NDI0
MzU0MzQyNDMyLDA0NTQwLC41NDI0MS4zLzEzNDM0MzIwNDIyMS8yLy4vNTAyMzQzNTAwMDQ3NDIz
MjAuMDUzLzIxMjAyMjEzMzM1MjUxMTIvMzM1NTQ0MTIxLDExMjI1MTEyNTUzNTQzNDU1MS8vMzIz
LzA0ODUvMTUzMTIzNDUzMjE3NTQwNTU1NDU1NTUxNDM1NzMyNDU3MzA1NTU1NTUyMzExMjU0MTIx
NDUyMzEwMjM1NDIxMjIvMzQ1MzEzMjMzNTU1MzQ1MTEzMjUzMjUxMjExNDMyMjIxMzE3NTU1OTg1
NDI0NzQ0MjM1MjMzMzIyNTU5NDQyMjI0NDMwNTc1NDIzNDE1MzU1NDU3OTUzNzU1NTU0Nzo1NTUz
MjM5NTIxNDQ0Nzk3MzM1NTM0NTU1MTU1NTU1NTIxMzQ0MzMwMzQzNTU0MzQyNTc0NTU1MjQ1NTc5
Nzc7NTQ1NDQ1NDU0MzIzMjMzNDc4NzU0ODQ3MzQ0NTU5NDEzMjEzODg1Nzg1MzU3NDQ1NDIzNDMz
MTEzOTUzNTU1NTc3Ojk3OTc1NDQ3ODsyMzU0NTI3NzU1NDg7OTUzNTQ0NDQ0NTU1NTQ0MzAyMzU0
NTU3NDM3MjUzNDQxMTU3MzMyMzQyNDUyMDI0MzMyNTc1NTIyNDIyNDMxMzExMzEyNTE1MzMzNTU0
MzIvMzMzNDM0MzU1NDMyMTIyMjEzNTI0NzczMTAxMjQ0MjQyNDMzMzI0MzE1NTQ1MjEzLjMxNDIv
MjEyNDU1NTUwLjIzNDIxNDU0MTUxNDU1NTU1NTc1Nzc1NTU1NTUyMzg3NDQ1NDM1NTU3NDU0MTE0
OTg1MjQzMjM1NzI1NzU0NTU4ODU3NDQ1NTQzODg4OTU1NTc3MzQ1NDU1OTU0NTQ1NTczNDU0NzU1
MzU3NTIzNTU1My8yNTQ3NDUyNTc1ODM3NTEyMzQ1MzQzMzU0OjQ0MzU1NTU5NTMyMjU5ODo4Ojc1
MTU1MzU4OTc1NTQ4NTE0ODUxMjM1MzU1NS80MzUyMzQ0MzUyNTU1NDMzNDU3NDQ1NTE0NTIyMjU4
ODc3NTU1Nzg1NTQ1NzU1NDg3Nzg3NDc5NzU0NTk3MjMyMzEyNTU0NTU1ODg4NDQ1OTUzMzIyMzI3
OTc1NDEyNTg7OjM1MzAzMzI1NzgyMzc4NTU5Ozs3NTU1NTM1NDUyNTU1Ly8uLi8sLi4wLzEuLiwr
LC4xMS8rLC4vLC4sLCovMC4wLy4sKiorLDExNTc6PkE+Oj1BUlBDODc3NTU1Nzw6NTk7Ojk4NTU5
OTU1Nzg6NTI0NTU1NTU4NzIzMjMzMzU1ODU1NzU1NTU5ODU1NTU1ODU1NDM1OTg4MzQ0NTo4NTg3
NTo3Ojk6ODw3Ojw+ODg4OTk5Nzk3NTU7NzU1ODU3Ojs7ODc1OTo7ODc1Nzk0Nzc7ODM1MzU1OTc4
Nzk1NTo4NzU1NDg6PDc1NTo4ODc3NTk4OTUzNTUzNzU7Ojg6NzU4ODg1NTc5Ozc1OTk4NTg7PDgz
NTU5NTQ0NDc3OTs4Ojk5NTUyNTU5OTk8OzgyNTU7ODo6OTc1Nzk6PDo6NTU6Ozk7ODU0ODg1MzU1
ODw7NTU6NTo6OTs8ODU3NTk3Ojg4Nzk3NDk4OTU1ODs3Nzc4NzU4NTk4ODU4Nzo4NzU3ODo3Nzs4
ODU4ODczMS8yNzk7NDU4NTUyNTU4NzQyMzg1NTc1OTg3NzQzMjQ1NTM0OTU1NzU5NTk1NTo3NzUy
MTQ5MjM3Nzc4OTs6ODU1NTM1ODU5OTg1NTUzMzUzNTc1NTU5NTc3NTU1MzU4NTczNTU4NTc1NDU1
NTU1NDE1NTU3NTc3NTU5NzM4ODU4Ojg1NTQ1NTU1NTU1NTQ3NzUyMjM1NTQzNDUzOTU6NTU0Nzc0
NTUzNTU1NDUzMjUzMjoyNTU0NDM1NzQzODU1NDQ0NTUzMDUzNDk3NTU1NTQwMzQ0NTU1NDI1NTEv
MjQ0NDUzMjM1NDM1NTU3NzQ0NTI0NTQwNTc3NDQ0NTQ1MzMyNDU5NTU1NDc6ODU0ODU1Mzg3ODU0
NTU1PDMxMTQ1MjU1NDQzODc1MzM1NDQzNDg1OjozNTc5NTE1NTo1OTU1NDQ1ODczNTU1OTc0NDU3
NTs4ODU1Nzk4ODs5ODUzNzU0NDQ1ODU1MzE3OTo0NTc0NTk1NDk1Mzk1Nzk5Nzk3NTg0NTg3NTUy
NDU1OTc6NzU3MzU8OjU0NTg3Nzc1NTU1NTUyMjg5NzQ5OTU1NTU0NTU5MzI1Nzg1NzU0NTU1MzU3
Ojo6ODU5Ojg3NTU3Nzc0OTc5NTc4Oz07Nzc6Nzc4ODs5Ojk5NDU0NTo3Ojc4NTQ3ODk8Nzk6NzU1
NzQ1OjU3PDc3NTc4Ozc4OTk5Ojw6Ozo7Oj48PD06Oz09Ozk5PT47Oz07PD09Pj44Ojs5ODo8OT45
OTs8Ozw8Nzc6PDs8OTw6Oz49QD47Ozo5OTk8Ozk7Ozo1Nz5CPTk5PDg1ODg8PD48OTo9PUA8OTk7
Oz46Ojs9Oz49PUE8Nzk7Pjk7PDo9QDw7Ozs+ODpAQD4+PD48PTg6Pj07Ozs6PDw8PD09Ojc1Ojg1
Ojw6PD43Oj5APjw4OT4+PDw4Oj49Ozc6Oj09QTs9Oz07Ojs+OTs6Pj06Ozo6Pj47PTo9QD45OTk3
Oj06OzxAQD4+Pjs9PDw8PkA6NTo6Ozs7Oz1BPjw8OzMwLC4zNDAwMjQvMi80My8yNDAyMzMzMTEx
MjUzMjQyMS8uMjUzNDU1MjAyNTUvMjEuMjQzMzIyNTMwMzAwMDExMzE1NTQ1Mi8xMzM1NTIvLi4x
NTMxNDMyMDAxMzEvLjAvMDM0MzI1NTI1My4wMjQzMjM0MjMzNDAyMjEzMTQzMjEvMDAuMTE0MzQ1
MTAwNDo0MDMvMzc4NTM0MzIzNTUzNTc1NDIzNDQyMTEzMS8wMjUxLjM0MTIzMjM1MzAzMy8sLzM1
MjEzMDMyMzU1NDQzLzM1NTIzNDMyLjA1MTEuMDEyNDUxNDIzMzQ0My8xMzA1NTExMjU1MzU4NDQ1
MTEwMTEyMjIzMzMyMzU1MTQzMjI1NTI0NTU1MzAxMzEyMzExMDQzNTIxMzAxNDU1MjI1NTU1NTIz
MjIyNDI1MjM0Mzg3NTU0NDU1ODQwMzIzMjMwMzQ0MzczMzM0NTMuNDMwMzU1NDQ3NTIzMjQ1NDMz
NTUzMzQ1NDQyNTk0MzU1Nzg1MDAxNC4uMTMzNTk3NTIzNDU1NDMyNTUwNTc3NTMyMDMzMzU1NDQy
MjQ1NTM3NDc7OTU1NDIyNTIwLzU1MDE0MDQ1MzU4NTU1MzQ0MTM1NzUzNTQ1MjExMDU0MzI1MzUz
NDQ1NTM0NTU3NDU1MzA0MS83NTU1MjMyMTM1NDUzMzU3NDE0NTUyMjUyLzEzNTU5ODQ5MzQ1NDMz
MDU3NzMxMS8wMTE0MzMyMzQyNDczMDU1NDAyMzQ1NDc3NTEwMzUzNzEvMzU4MzQyNDQxMzQzNDEz
NzU0NTUxMzQ1NTQ1NTIyNTUzMjM1NTQxMjQ0NDQ0NTg0OTUxNTQ1NDMzNzQ1MDQ1NDQ3NDM1Nzcy
NDMzNzUyODIzMjU0Mzc3Nzg4NDU4OTU5NTM0OTc3NTU1NDUxMTU1Mjc1MzMyMDM1NTI1ODQ0MzM3
OTg1NTQ1NDU0ODU0NTMyMzU1MTEyMjM0MzczNDU3NDM1NTU1NDg1NTU1MjU1NzU0NTg1MzU0NDU1
Nzg3NTU1NzQxMDMzNTQxNTU1MzI0MzM3ODc1NTg1NTQ4NDIzMzQzNDQ1MTU1NzQ5NTg3NDU1MzM1
NTU4ODU0NDU0NTU4NTI0NTQyMzU0NDQ0NTQ1NTU3NTQ5OTU1NTIxNTg0ODk1NTU1NTIyNTU4Nzk4
OTc6NzU1Mjk4ODc1NTUyMzU4Mzc4Nzo1NDg1NDg5Nzk4Ojw6OTU1NTM0MzMzMS8vLDAxMTAsLjMy
NTEvMjQyMzIwMS8uLywsLzIyLi4wMDU6PD5ERT05RU5WUkA4MzI1OTU4OjU1OTg+PDs6ODk5ODg6
PDk3MjIzNzk1MjI3Nzc0MjQ3ODMwNzc1NTM0MjEzODc0NTk3NzUzODc1NzUzNTU5OjU1Nzk4NTc3
OTk3Nzk4Nzg4ODQ0ODk6ODg5PTg3OTk1NTc4Ojg6Nzc6NTQyNTQ5ODU3NTc3PDs7Nzg3ODo4NTc4
ODU5NTk4NTk1Ojc4ODk4OTo3ODc6ODk5Nzg1NTc1OD06ODc5Ozg3PTo4ODc6PTw6ODo3ODg8Ojs5
Oj46Ozk5Nzk8ODs6OTc3OTs1NTo5ODc3OTQ1NTc3NTQ5Ojk4PD03NTU1NTg5OTkzNDU7NTg7OTg3
NTU3ODc1NTg1OTw6Nzs6ODg5OTo3Mjo4OTs7NzU0Ojc3NTU3NTM0OTk1MjQ4OT03Nzo9Ojg3ODUz
NTU1ODo3ODo1NTI0NDU1NDc5NTU3NTU3Mjc3ODM1NT05NTUzMTI3Ojg1NDU4OTc3ODU4OTk1NTk1
NDgzMzU0NTU1ODg5NDI1NTQ0NDU1MjI1NTQyNDMxMzU1NDUzNDc3NTU1MzI1Nzg3NTQ1NDQ1NDU4
NTk6ODcyNTc1MzU1ODEzNTUxMzQxODU1NTU1NTU0NTEzMDU1MzI1Mzg5NDQ3NDU3NTQyNDU1NTQw
NDU0NTg4NTU1NTIyMDI1NzU1MzQ1NzU3NDU3NTk6Nzc1MzU1MTU5OTc0NDQ0NTk1NDU1NTg3NTg5
NTc4NDI1NDc1NzM1Ojg1Mzc0MzU1ODk4Nzk3NzM1OTk5Ozs5NTg8ODU1Nzc5Ozk1ODk1Mzg7NTU1
OTU0Nzc1Mzo3NTU5ODg1NDU1NDg3Nzo6NzU1Nzg6ODc4NzU1NzU1NTU5PDQ1NzU3OzczOTU5ODQ1
ODU1NTU1NDk4NTg1NTg7OTQ1NTU1ODg4ODU3NTk6ODk6OTg5Ojs7Ojs4ODc5Ojk5NTc7NTU1Nzc6
ODU1NDM1Nzo5OTo3NTQ1NTU4OTgzNzQ3ODc3NTQ3ODg1NTM1NTU0NTQ3OTc1NTUzNTQzMjQ1Nzk3
NTQ0ODU5OTo3ODk5OTc5PTo1ODs5NTU1NTg1NTg1NTQ4ODo4OTw9NTM3OD49Ojc4ODc4NTg4NTg1
Nzg4OTk6Nzo8Ojo4PDc1OTo4ODs6Ojs6Nzo5OTo8Ojs5PDw5OTg6OTc6OTs6PT49PDo6Oj09Oj08
OTw7PDo3ODs8Pj48QD48PT07PTw9Pjs+Pj09PT49Ozw8Pj49PD49Pjs6PTk3OT4+Pjw7PDw4Ojk8
PD05Pjw9Ojc3PTw9ODs+OjpAPDo3Ozs6Oz07Pj09ODU6PT46PDo7Pj4+PEFBOT0+PUA8Pj5APTs+
Pj07Ozo6PDo+QUE+PDw+PTs6PD49Ozk7OTo8PD06Oj0+Ojs6Pjw7OTtAPjk5Ojs9QD47Q0I7OTw8
Pj47Ojw7OTk6OkBCPjs9PDs6Ozc6Ojw7OTc6NTAxMTAxMDAzMzMzNTQ0NDQ0MTAwMjU0MzU0MTEy
MzIwMjU0NTU3NzU1NDQzNTEwMjEvMjM0MjA0NTQ1NTAyMjAuLjAxMDE0NTUyNDMzMDQ0NzQwMzI1
OTU1MjMzNDMyMTI0NTU3NDExMDEzMTU1MDAwMzIvNDQ1NTI1NTM0NTU3NzEwMTE0MzIxMDMyMTE0
NTI0NTMzNDQ1NDAxNDUxMjU1MzM3NTU3NDU0Nzg1MzQyNDMxMTQ1MTU0Mi8zNTQ1NDQ1NTUxNDU1
MjQzNTUyMzEsLjMyNDUyMTMzNDMxMTU1MzQvMjUzMjQ1NTQ0NDQ1NTQyMzU0NTQ1ODU0NTQ1NTMz
MTQ3MjQ1NzU1NDQ0NTUyMjI3Mi8zNTU3NDQ0MzU1MjQ1MTM1NTU3NDU1NzU1NTUwMzU1NTM1MzU1
OjU0MTQ3ODkyNDQ0MzI1NTQ1NDU0NDQ1MTE1MzM1NzM0NDM1NTMyMTAzNTMwNTQ0MjMwNTIvMTM1
NDM1MzAwMTU4NS40NTQ1NDU1MzM0NDg0MzMzNzI1Nzg0NDU4NTU4NTMzMjQyMjc1MjQ1NTU1MTI1
NTU1NTczNTgxMDQ1NTQ1MzI1NzQ1NDUzNTU0NTU4NDU0NTc1NTg4OjcyNDU1ODg6OTQ0NTM0MzMx
MjU3NTUzMzU1NTQ1NTMzNTU3NTQyNTU1NDc1MzU0MzQ1NTc0NzU1NTQxMDM1OTk3NTIzMy40NDU0
MTUyMDAzMDE0NDQ1MTMvNDgyMzQwMDEzMzAvMDI0NTc0NTMwNTIyMjQyNDIvMTU3NTQzMjMzNzUz
MTM1LzE4NTIxMjEzNDM1MTAuMDU1NTU0NDU1NDUyMzU1NTU1MDI0NTU3MzE0ODk3NTIwNDk1NTM1
MjU3Nzc3NTQ1NzMyNTg1NDU0Mjc4NTM3Ojc0Mjg3NzM0NTg3NTc5NDU0NDczNTU1NDc4MjU3MzMz
MzU0NTU0OTg1NDE0NTk1NDU5NzQxMzQ1NTIxOTU1ODU1ODk3NTI0NzM1NTU0MzM1NDU1NTc1NTc1
MzEyNDQ0Nzc1ODU3ODU1NTc3MjU3ODk5NTQ3NzU1ODk1NTc0Nzk1NTg0NTc1Nzg4NTU6NzU3NTU4
ODUxNDQ3NDA1NDU4NTU1MjI0NDU3NTQ1MzQ3NTU0NTU1Nzg1NzU4OTMyNDQ6NzU1NzQ4NzU3NzQ1
NTQzODo1NTc3NTU1ODk4ODM0NTU4NTIzNzs7OTk4NDU4OjUzNzUzMTIwLzMyLjE0MTExMS4xMC40
MzAwLy81Mi4wLzAyMCwsLi4uNTw+PkBDQT5DSUpKPTQ0MjE0NTQ4NTU4ODo9PDg6PTw6Ojg3ODg1
NTQzMzM4NTQzODcxMjIyMjgzMzM1ODg1NDg3NzU1OTU4Nzc4OTU1NTw6PTU5ODU6Ojc7ODU1ODk4
OTk3Nzs4ODk1NTg1MjI1OjU4OTU0Nzo5NDU6OTc3Ojg6Ozs8Pjs6ODk8OTs7NTo6OTo4Nzo6Nzo1
NTU4NTQ1Nzs8ODg4ODo6OTg3OTU1Nzg1Nzg8Ojc3Nzg4NTU4ODQ6Ojc3NTo6NzU3NTc1PTg4Nzg4
ODg6OTU4OTg5NzU4Ojo3NTg0ODQ4OTg8ODg1ODc1NTU3NDU0OTg0NTc3NzU6NDM0Nzc4Ojg3NTU1
NTg4ODQ1OjkzMzQ0NTI5OTg1Oz41NDQ1NDU1ODU0NTc0NTI1NTo4OTg1OTc1ODc1NTg5NTc0MjU1
NTc3NDQ3NTQ3NzM4NTIzNzo3ODgzMDQ3Nzo1NTAxNzU1MzU4OTg1NzUyNDc1MzU1OjgzODU0Nzc1
NTQ1NDU3NzQzMzU1NTo3NTc1NTU1NTc4PDg3MjE3ODQ1NzU0MzU1NTU1MzM1ODU5ODU0MjU4NzU3
Nzg1NDI1NTc0NTc1MjQzODM1MzQ1ODw1Mzk1NTc3MjUyNzg0NTU1NTo4NTU1NzQ4NTUxMjQ0NDc6
NzUzMzQ1NDU1ODg5OTU4NDU1NTUyMTU1Nzc3NzUxNDU1OTU1ODk0MjM0NTo5OTU0NTU3NDQ1NTU1
NTU3Ozw3ODU1MTI1NTo3PTc1ODU1NTU3OTg1NDc4NzU1MzQ7NzU4OTQzNTkyNTUzMjU1Nzk3NTU1
MzU3NDA1OTg5NTUyMzc5OTg0NDM1NTk0Mzk4NTIxNDc4Nzk4ODU5NTg1ODU0OTg3NTk8NTQ4NTM3
NTUzNDU3NTU3OjQ1NTo1NDU1NDg1OTk3NzU1NTk4NzQ1NzU4PTg0MzQ1NTU7NTU3ODQ1Ozg5Ozg1
NTM3NTI1OjU4NTU0MzU1Mjc5NzQ3Nzk3OTc4NTc0Mzc3NTk3NTc3Nzg4MTI3OTg7PDc1ODk4NzQ3
OTo7ODg1OTg4Nz04NDczMzs7PDozNDg5OjU5OTU4Ozg1Nzk6ODk3ODk4ODk5Ojo7PD03NTc4ODk1
Ojk1ODg8Ozs6Nzs+Pj07OTw8Ozs+OzU8PD06Pj46Ozk6Ozo6Nzw7Nzw9PDs7Ojw+Pj0+Oz09QDw7
Ojo5Ozo8OTs+Pj48Pjs6PT47PD46Oj4+Pj46Ozo9Pjw+PTo9PDs6OTs+Pjs1Nzg8Pj4+PDk4PDo5
Oz08Ozc8OTk6PDw9OjpAPT4+Ozs3NDk7Ojw5Ozw+PTs7ODw+PDo6Oj4+Pjo7PD49PkFBPTs6PTk7
OTs8PT07OTs+OTo8PD47PT49PDw7PDk7PT5APkI+PT09Ojo9Ojs7PD09Pjw+PDo7PkA8PD49PD0+
Pj09QD4+Oz4+Pjo+Pj49Pj0+Oz49PDs0Mi8yNDExMjEuMDUzMzQ1NDU1NDIyMzg1NTU0NDUxNDMx
NTQyMDI0Mi8uMjAvLzQzMzEwMDIzMzEuLiwxMjIxNDEwMTUzNTMyMjEwMC8wMjc0MDU1MS8yMDM1
NTExMTAyMDE0MTM0NzI1NDExMjUyMCwvMC8xMDQxMDMxNDMwMjQzMzMzNzMzMTIzMTAxMTIwMTEv
MjUzMzMyMzU0NDI1NTEyMTU1MDAyMjIxMjM1MzAzNzIyNTQ0MTE0MzA0NDMvLzQ0NDU3MzMyNDU0
NS8wNDIwMzUxMDIyMTIyMzIzNDM1MjUzNTAxNDEwNDQzNTIxMzI0MjU0MjU3NTU0NDUzNDg1NTQy
MTI0NTUzMTI0MzM1MDE0NDM1NTc1ODIzNTMyMzQ1MzIzNDU0NzUxNDQ0NDU1NTU0MTM0NTU3NzQ1
NDI1OTU0MzUzNTU1NTU1NTU4NDUzMDU4ODU1NTU3ODkzMC8yNTU1MzQ1Nzg1MzU0NTUzNTUyNDU1
NTU1MzQ1MjU4NTU1NDQvNDU3NzQ0NDQyNTQ1MDI0MTU0MzIxNTUyNTgzMjQ5NzQ1OTUyMzIyMzM4
NTU4MjIzMjU1NTU1MzQ1NTQ1MjQ0Nzk5NTUzNzcxMzc1ODc1OTU1NTU0NTgyNTU0MzM0NTQzMzU1
NDUzNTEzMjc4NDU3LzUzMzIyMTEyNDU1NDU3NDQ1NTU0NTUwMTIzNTQyMzc1NDEzMTMzNDgxMzQs
Ljc0NTU1NTQxMTIxNTU0MjE0NTMyMS4vMzQ1NTMyMzMyMjQ0MjIzNDQ1NTIxMjM0My4wMzQyNDMz
NDU1NTgyNTMyMzE1NTQ1NTQ0NzI0MTEyNTQzMzMzNDU5NTUyNTcwMTU1ODI1MzczMjM0ODU0NDU1
NTcxNDU1NDU1NTc1NTM1NTU1NDQ1NTU1NTQ4NTU1NzQ1NTU0NDU4MzM4OTg3NTM1NTU1NDU3NTU3
MzU1OTU3Ojg1NTQ1ODUzMjU0NTE0NDU1MzQ1ODI3NDUyNTc1NTE3ODc4OTU0NTI0NzUsMjEzNTUy
Mzk1MzUyNTM1NzU4OTcyNzc1NTUxNDk1LzQ5ODU1NTU1NzU1NDE1NTUyMDQ1ODk4NTc1NTk1MzU0
Mjc1Nzg0MzU1NTU1NTU6NTQ1NDc5NTIxNTc4NTg3NTU1MzEzMzczNTU1OTUzNTU4NDU1Ojc1ODU0
NTQ1NDI0NDI0NTg1Ly8wNDQzMzc8Ojc5OTk8PDw5NTk1ODgwMC81NDI1NS8sLzIyMDAxMTIxLi4v
NDU1MjE0MC4yLjE0MjA0PTw8Ozw+QENCQUI6ODU0OTczNDQ0ODU0NTg5PDtAQ0I5NzU3Ojc5NTU0
MTE1MTAzNDQ0NDE0NTU3NDMzNzgzNDI0NTU1Nzg3NTg5NzQ1Mzc4NzU1Nzk1ODU1Nzo1MzQ3Ojc4
ODc0ODU1ODg1NDE1ODU1OTk4NDQ3Nzk3OTo4Ozs4ODo8ODo3NTU4NDU7Ozs6OTo4NzU4NTU3NTg1
ODUzNzc1Nzg5Ojk6PDg4ODg4ODo3ODk3OTw8Ojg7OzlAOTc1NDQ4OTk8NTc9Nzk7NzU6ODc5NTk4
NTk6NTU6OTo3Ojk7Ozg6Nzw1NDU7OTg4NTQ3OTk4NTQ1Nzg5NTc4NTg4NDU6Ozg0OTU1Nzg1NDU1
NTc4Ojs5PDo0NTg6Nzg6OzU0Nzk4NTs0NzQ1OTg3ODc1Mzc4NTg3NzQ1NTo6NTI3OzUzNTU1NzMx
MzM1Nzc3NzU1NDIzNTQzNzMyNDQ0NTU0MzUyMjM0NTU1Mjc5ODU3ODU1NTU3NzQ1NzQ3ODQ1OTg1
NTU4NTU1NTg1NTg7Ojg1NTUzMzU1NTg6ODg1NTUzMjI4NzU1Nzo4NzQyNDU1Nzg1NTU0Mzc5NTg3
NDQ3NDQ5OD06NzQ1NDg4Nzg1NTQzNTQ4NTUzNTc3ODozNTU1NTg4MzQ3NDE1NzU0NDQzMzU1MzQz
ODk1MzM1OTU3Nzc4NTU4NzU0NzU1ODc8OTU0Ojc3NzU4Ojg1ODk1NTU1MTU3NTU1NTg4ODk4ODc1
Nzc4NzQ1NDQ1Ojc1MzU1NTM4ODU3MjE0NTg1Ozo0MzQ3NTU1NTQ1NzUzNTQ3NTU1ODc1Nzg4NDU0
ODU0NTU3NTk0Nzc1NTU1Mzg0NDM3OTU4ODc1NTQzMjU1NTU5Nzc1NTM1NTg5NDQ1NTgzNTg1OTUz
ODk3NTU0NDg5Oz45NTUzNzk4ODU6ODU4NzU1NzU1ODU3NzU1NTU4Ojg5Ojc1OTo4OTs3NTQ3NTUz
NDs7NTg5NzU1NTI0NTc1NTU1Nzc7ODc3OTs4NzU3NzIyODk3NTk5OTU1ODc1NTs5ODk5ODs4Nzg3
OTg3OTk6Ojc3Ojw4PTw3NDg1ODs9OTc0Nzc4ODs5OTk5Ozw4Nzo7NTg9Ozg5Nzo6Ojo4Ojg7OTU1
PD08Ojo6Ozo7Oz06Ozk6ODw6Ozs4ODg6Oz0+Pj44Oz1AQT0+Pjw6Ozw6Ojk4Nzk7ODc3Ojw6Pj08
PTU5PT46OTs+OT08Pj49Pj08Pjs5O0E9PTo9Pjs5OTo8Pj4+QDw7OTs9Ozg4OTw7Oz08QDs3NTk1
OTk8Pj5APjw9PD0+PDs6PDs9PDk6Pjw5Oj08Ojs8OTs+PT0+OTk9PDpAPj4+Ojs8QT49OTs5OD43
Ojw+Oj4+PTw+PDs5PTw6O0E+Pj47PTo7PDw+Ozk9PDk9PjtAPjs+Ojo8Pj47PT07PEA+PTs6OzxA
QD4+PT0+QT47PUA+Ozs6Oj48QDU0NDQxMTExNDM0MjMyMTMxMDAyMDE1NDMwMTAwMjEyMzQyMzQx
MjM1MzI1MTUxMDE0MzMzNzIzMTMzMTExMjMwMzExNTIzMjQxMTQ0NDQ0MzMzMzM0NDU3NDE0OTQz
NC8xMDMyMDQ0NDEvMjMyMDEyMTAzODU0MjAyMzUzNzQ0NTU0MjQ1MjUyMjE0MTM0NDM0ODUyNTQ1
NTI0MjQ1NTE1MzQyNDU1MjQ1MjI0NTI0NTUzNTQ0NzQyMTEzMy8xNDMzMzUxMTExMzEwMjIyNDE0
NDIyNTUyMzAxMzQxMi8xNTI0NDQzMzIyNDIvNDIyNTQyMTM1NzQzNTU1NDMwMTIzMzU1NDQ1NzU1
MTEzMjI1NTU0MzAyNTU0MzM3OTU0MjMwMjMzNDk4NDU0NTczNzU3NTU1OTczNTU3NTM5ODk3Nzg3
NDE3NTU1MzQ1NTUzMzQ0NTQ0NTU1NTExNTM1Nzc3NDU1NTQ0NDI3NTg5NDU1NDQ1NTc1MC8yMzU0
NTU1ODk3MTIyNDQ0NDU1NTQ1NzUyMi8zNTU1NzUyMzc1OTc0NTM1MzAzNzg1NTI0NDU1MzUwMzM1
OTU1NDc1Ojc5NzQ1NTQ1NzU3NTU3ODU1MjM1NTU1MzEyNDg0Mzg3NDU1NTQzNTM1NTUyMDQzMzU3
NTQ1OTU1MjM1NTo4MjQ4NDM3NzQ1NDU1Mzc0NTU1NDM1MzM0NDM4NTMxMjEzNDQ1NTQzNTQ1NTQz
MTU3NDQ3MjMwMzEwNTQzNTUxNDIyMC4yMDQyNTU1MzQ1NDE0NTUzNTUyMTE1MjExMTIwMjU4NDQz
MzU1NTI0MzQ3OTU1OTczMTMyNDIxMTU4NTg1NTo1NTg0NTQ1NTU1NTUxMjU1NTo1NDg0NzQ1OTU1
NDQ1MjQ1Nzg1Nzc1NDI1NzM1NTU1NzU4NzU3ODU1MjU3ODc4NTg5ODU1MzM1NTUyNzQ1Ojg1NTMx
NTgyNDMzNzU0Nzc1MzQ1NTU1NTczMzc0NDU1NDMyNTQ7NTEyMzM1MzU0NTo5Nzc1MzU4NDQ1NTg3
NTU3NzU1ODg1NDU3NTM0ODc7OTU3NTg1NTUxMzI3NTI3OTU0OjU0MzIyNDQ0NTczMzQzOTUyMzU3
NTQ5ODc1MzM3OTc4Nzg3NTU0NDQzNDIyMjU6Ojc0MTM0NTk4NTU3NTU4NDM1NTc0NTg3NTc1NTg4
NTc4ODs1MzExMTIyMTI1NDU5Nzo5OTg1Mzc3MzU1NTc0LzI1NS8zLC80MDEyMzMwMzU1NDI0NTUy
MTA0MzIyMzIzNDU4PDs1ODs7PDs1NzUxOTcxMTQvMTM0MS8zNTc8Oz5BQjw0LDI1NTc8NS8uLiwy
MzI0MjU1MS4xNTMyMzU0NDQ1MzI0NTU4NTU0NTc1NTU3Ojo1Ojc1NTU1NTk3NTQ3Nzc1NTQ0Nzg3
ODc0Nz01Nzo3NzU4NTU1ODo6OTc3NTQzMjQ1OTw5Ojg1Nzc1PDw6NzQ5NzU4Ozo6NDU4Nzc1PTs5
OTk1NTo7Ozs6Ozg4ODk9OjU3OTs5NzQ3NTg5NzU5NDI3NzU7ODc5OjU1ODc4OTU3NDU1NTU3Ojk6
ODc0NDg4OTk3Ojk6NTo4Nzk0ODg4OTo5NTg5ODg5OTg5NzQ6PDo3Nzc1OTo3NTU0MTU0NDc3NTU4
ODk1NTQ4Nzw3NTU4OTg5ODU0NTk4NzU1MTc1NDk5NzU3NTU4Nzk4NzMzMjU0Nzg8ODcyMTU4NzU1
MzM3NDUzNTc5Nzc1NTcxMzU7Ojg4NTc3ODU0NTQ0NzUyNzU3NTU0NDM1NDM1Nzc5NTU1MzM1NTMy
MzE1ODU1NTU1NTU0ODc0NTc4ODU1NTQ1Ozw4NTQ1NTk3ODU0NTM1NTk8Nzg5NTQyMjA0NTUyNDg5
NTc5NzkzMjQ6NDc1NTg1NTU1Nzo1NTc7Ojk4Ojs3NDc1OTU3NzU3NzQ3ODg1Mjg1NTc3NTU1NTU3
NDg4NTU1ODczNTUyMjU0MjU1ODQ1NDQ4Nzk4NDU0NTU1NTU1NzU3Nzg3ODUzNzk1Nzc5NTg4NTU1
NDQ1Nzk1NzU0NDU1ODo4Ozk1ODc5NTU3Nzg1NDUzNDc0MjM1NzU0NTU1NzUzNzU3ODozMzU4NzU1
NTQzMjU1MjM4ODM1NTM5OjczMzc1Mzc4NTA1Mzc7NDU5NTU1NTM3NTU1Nzk3MjM0MjE1NTc3OTc1
ODc1NTU1NTg3NDU6NzU3MzEzMzc4ODc7OTMyMzc4Nzc1NTU3OTk3MTM7NzM1Nzc1NTg1MjQ0NTQ1
NTQyNDU1NTU3NTQ1Nzc1NTc5MjU6ODI1Nzc4NTg1ODk5Nzc3Ozw6NTc1NTU4Mzc4OTo1NTg3Ojk5
Nzg5Ozs6OTU3ODU1OTc4ODQyNTc7PDs1Nzs6ODg3NzgzNDg5Ozk9PT03OTc5Ojg4ODk8NTg6Nzw6
Ozo9NTg7PDw+PTo4OTk5Ozo5OjU4Ozs6OTo5PT48O0A9PDo8PD47Ojk9Pjo3PD09PDo8PTo7OTs6
Pj4+QTo5PD5COzs8PDs6Ojw+Ojk8PUM7Ojw7PkI9OTc3PT4+QT4+PDs6PDo8QDw7OTs6ODtAPjw6
PEI+OTs6Pjo6ODg6Ojs8Ozo7PD48PDw+PD49PTs9Ojg4PDc5Ojs4Ozk6PT49Pj48OTo+Oz48Oz07
Ozo7PD0+Pj47PUA+OztBOjU6PDs6OTo3Nzg6ODo9Pjo5ODs+O0BBQD49Ojk+Pj4+OTo7Oz0+Ozo5
Pj46PUFAPjs7PT1AOzs7MDEzMjU1MDM1NDIwMjEzNTQ1MDAzNTUyMiwwMTAxMzQ4NTUyLC40MzQx
LzAwMTI0NTM1MzAyMzQyMjIsNDU0NDIvMzAyMjQ0MzMxMjQ1MzMzMCoxMTQ1MjQ0MzIvMzUzNTg1
NDMyNDMzNTUyNDMyMzIzNDAxMzU0MjIzMTU0MzQyMjAwNDQ0MjUyMzQ1MjIxMzEvLjA1MzIxMTIz
NTUzMTE1NDU0MDIzMTQwLzIxMzMvMTMzMjEwMTAxLzIyNDMxMTIxMTMzMzEzMTEyMTMzMjEyMjM1
NTQwMjQvMjQ1LzI0MTIxMjU0MDIxNTM1NTQ0MTI1NTUxMjM4NTU0Mzc1MzMzODU0NTM0NzE1MjU0
NTc1NDEyMzIwMDI0NDU1NTU1NTg0NDg1ODUyMzIyNTc1NTQ3Nzc6NTIzNDU0NTU0NDQzNTU0NTQ1
MjQzMTU1NTk5MzQzNTE0NTg1NDMyMzMwNDg1NDc1NTQ1NDQyNTU3Mi8xNDEzNTIyNTUyMzI1NTM1
MTI0NTU3NTU3NTc6NTQzMDQ3NTU0NTM1Nzg6ODM1NTExMjUzMzQyNTM0NTM0MzE0MzEyMzQ1NzMw
NTUwNDUzMzQyMjc5MTUzNDAyNTU1MjUyNDQ0MzQ0NTIzODc4NDUzNDc3NC8xNDIyMDE0LjQzNTMx
NDU0MzEyNzIyMzIzMzM0MzE1NDI0NzczMjE1NTc1NTg0MjU1NDU1MzU1MjQxNTMxMzUyMzEyNDMz
MzQxNDIvMTUyNTc0MDQzNDIzMjMxMjQ1NTQ0MjIyMzUuMDE1MzM0MTMzMzQzMjE0My8vMzI0NTUz
MzM1MzAxNTU1MzI0MjM1ODU0NDUvMjQzOTs5NDU1Mjc1Nzc1NTIyNzIxNTMzNzMyNTczMzU3NTM1
MTU1NTEwMzQzMzQzMTQ1MTE0NzQ1MTMzMTU1NTU0MjUzNTg1NDAuMzU1NTIzNTU1ODc1NDI1NTc0
MjIyNTU1NTIzMzQyNTk5OTU1NzQ4NTQyMzU1NTc1NDM1NTU1NTU3NDE1NTQ4NzM1NzU4PDc0NDU1
MzIyMzMyNzI1OTQzODc0NTczNTIxNDQzMTI3NTUzNDMxMzQ4NTU0NDUzNDM1Nzg3MjU4NTU0NDM3
Ojg7NzU1NTc4NzU0MzU3Nzk3NDU1NTU3NzU3Ozg0MzU1NTU0Nzo3Nzk4NTM1NTU1NTM0NTg3MzU1
NTIwLywuMDIzNDU0NTo5Nzc3OTc1NTUyNTI1ODgyMjQ0NDUzMjU0MzU3NDUzNzIzODs1ODUzNTQ1
MzExMjI1NDs6OTc5PDw8NzU1NDI0NTIzMzQyNDIuMiwuNTU5Oz5BOjU1NTI1NTIzMjI0NTM0Ly4w
MTUuMDEyMzQ1NzU3NTIzNTQ3NTU1NTg6Ojk1Mzc7OjU1NDI4OTg3Nzg1NDU4Ojg1MjM4NzU1OTs7
OTg0NTc1NTQyNDg4NzU1Ojo4NTU4NzU4Ojk5Ojg5OjgzNTg4OjU5MzU1Nzk1NDQ5ODs6Nzk4OTU1
NzQ5NTk3ODU5Ozs1OTg6ODU1OTs6Ojo3NDI1OTo9Ojc3Ojk0NzU5Ojs6Ojs4Nzo1NzU0NTg5Nzs4
ODo3ODo5OTU1Nzg3ODQ3Ozc6Ojg4Nzg4Nzk1OTk1NTk5Ojg1NTcyNTs5NTc5ODk4ODU1OjU3NTc1
OTQ4NTk1NTU3NTIzMzU5NTU1MzQ1NDU1NTU1ODUzNTU1NTo1NzU1NzMzNzo4ODQ1MzQ3NTUyMzQ1
NTg1ODg3MjQ1NzQzNDk1NTU1Nzc4NDQ1Nzc3NDQ1NTQ1NDk3NTQzNTQ3ODo3NDQ1MzU4ODs0NDI1
NTQ1NTQzMzQ1NTU1NTc3NTQzNDU6ODQ0NTg5OTU0NTQ5ODU7OTMyNTM1NTI0Nzg5NzU1ODg8OzUy
MzczOTc1NTg4Nzc5NDUzMzU1NzU5Nzc4NTU1NDc3Nzg1NzU1OTU0NTc0Ojo3Nzc5OTc3NTU3NTg1
ODQ0NTU0NTc1NTU4NTg0NTk1NzM0MzM4NTQzNTMxMjQzNDczMzc1NzU3ODc1MzI1NTU3Nzc1MzI0
NTU1NTUzMzk1NDU1NTQ0NzU3NzUyNDQzNDU0NzU3NDU5NzU1NzU0MTQ0NTQ1NTo1NTQ1NTU1NTk1
MzQ1MzM4NTg1ODM5NzUzNzU0NTUzNDg1MzU1ODkzNTc4NTI1NTU0NTc5Nzo5OTczNTU0MzU0NTk0
ODk5Pjo4NDU1Nzk3Nzk5NTU0NTU5Ojk6NTU1Ojk0MzU6OTc3NzczNTg3ODU4NTQ0NzU1NTU1NzU1
Nzc1NTo7NzEzNDU4NzU4NTQ0NDI0NDQ1NTI3OTk1MzUzNDQ0NzU5ODU3NTU1NzU3Nzc1ODU3Nzo0
ODc1Ozw8NzU0Nzg4ODo6NTg3PDk4NzU3OjU4OTk1OTk1NTk6Nzg1Nzc1Ozo4Ojo5NTc1Nzw7ODk6
OTo6PDw6PTk5Ozw+Pjk1Ojw5PT08PDs8Ozs7Ozw9Ojs6PDo6Oz07OTo5Nzo4Oj09Pjs8PTw9Pj07
Pj06Oz07PUA9Pj09Pjs8ODk8Pjk+PDw7QD48PEA9Pjs6OzxAPTw6Ojk9OT06QDo5Ojo9PTw9PD4+
OTo9PT49PDk9Ozs5Ojw7Ozk8OTs8PD4+PT4+Pjw8Ojs6QD46PTw5Ojo8Ozk4OT08PDs9PTw4OTo+
PDk6PD48PTs6Pj08PD4+Oz08Ozs7O0A4OUBAPD07PEA+PDg+QDs9PDw5Ojw+PT09Oz07OTs+Ozo7
Pj49Ozw+Pjg7PTs1Mi80MzU3Mzc3NTAxMjUzMzU5NTE0NDE1MTAyMjc1MzM1MzEyMzEzMTIzLi40
NDQzNDUzMjQwMzIyMzM1NDIzMTM1NDQwMTA3NDM0NDU0NTU1MTMyNDM1MzQ3NTIyMjMzMDAwMzQz
MzAvMjI1Mi8yMzIyNDM3NTI0NDI0Mjg1MzQzNTMxMzIwLjQ3MC4yNTU1NTAyMjM0NDMvMzI1NTQx
MTA0NTcyNDQ0NTMzNDMyMzQzMzMzMTUzMzU1NTUzNDE0MCwyMjI0NTUyNTMxNDM1NTQ1NTQ0NDQ0
NDU5NTQyNTIuMTM1MzM0MTEyNTQzMzQ0MzAzNDIxNTczMDU0MjUzMDAwMDMzNTQ1NDg0MjQ1MzIy
MzU1NTAyMywyMTUyNDUyMTQ0ODU0NTQyMzMxNDg1MjU1MzU3NTU3NzQ0NTU1NTMxMjQ0MjQzNDUy
NTE1NTI1Mzc4ODMyNDk3MDI1NTc3ODQzMjM5ODU1NDQ0NTg1NDU0MjEyNzo3NzQzODQ0NDMzNDM0
MjE1NzUzNDU1MzIyNTM0NTQ0MjAyNTk4OTQzMjUyMTI3ODU5MzExMDQ0MDU0MjAwMzU4ODc1NTU1
NDUzNDQzODk3NTU0NDU0MzIzNTUzNDIyNTU3NTExMjI0MDUwMDQ1LzMwMDI1NzU4NTQxNDU3MjIx
MDI0MzMyMzUzNTc1NTo1MzI0MTEzNTg1NTQwMTQ0NTU1NTU1LzE5NzMwMC81NTUwNDMzMC8xMTU4
NDQzMjUyNDU1NTU1NTMxMzQ1NTMyMjEzNTMxMjQzMjIwMzAxLjA1MjI1NDIwMTAxMzMyNDI1NTU1
NzQ3NTM0NTEyNTUzMzQ0MjQ0MzQxNTc0ODU0Mzo3NTU1NTQ1Mzk1NzQ1MTU1NTU0NTc1Nzc1NTU3
NTUyNDU4NTg3ODMxMzk1NzUzMjQ0NDUyMzU0NTEwNDQ1MTQ1NDU1NDQyNTIzMjQ3NDM1NDUyODo3
NTM1NTQ1Nzc0OTQ1NzU0NDM1ODU1ODQ6NzUzNTg1NTUvNTU0NTg1MjU4OzUzNzQzNzM1OTQ1NzQz
Ojk0NzcyMzU1NTQwNDg5Ozc7NzMzNDUzNTk1NTQ0Mzc3Nzk0OTg3ODUyMzM3NTU1NTs4NTMyNTQw
NDIzNDQ1NDU1NTU3NDUzODQ3MzEzNDQ5ODQ3NTQ1NzQ1NDU0MjI0NTQ1ODg1MzU3NTQ1NDU1MjEy
My8yMDAvMDE1NTU6ODc3NTc0NTU1NTg4Pj01NDMzNDc1ODM1NTAxNTQ1Mzg9Pjo1NDM5NzUyMzU3
NTUzNTk5Nzs0NTo5NTM1MTU8NTMzOjczMzEyMS8zNzk6NzU1NzU1NDQ0NzM0MTMxMjEvMDAyMzMw
MTMwNTU1OTU0NDU1MzU1ODc4ODg4PTo1ODU1OTs4Oj06OjU5OTs1ODc4Nzs6NzU5OTk7PDg6NTg6
Ojg3ODc6NTU1ODU5ODg3NTU5Ozo6ODc6Ozc4OTg6PDs5PTw7Ojg4OTg7PDk3NDU4OTc4Ojk4Nzg3
OTg4Oz05NTc8Ojs+NTU7OjMyNTQ3OTU1Mjg7OTU4ODU1NzU9Ojo5Nzk4ODU4ODk8OTgzNDk8PTg4
NTc+OjU1NTc5NTg5ODU3ODk3NTk4OTk5Nzk1NTk4Ojk3OTs6NTg5NTQ1Ojg6Nzo4Ojc1NzU5Nzw5
Ojk3NTU1MjQ1NzI0NzU1NTs1ODg3NzU3ODUzNzU0MzU4Ojk3NzU0MzE0Ojg1NTU3NTczNTU1NTU0
NzEyMzU0NTMzNTUzMzU0NTU1ODg0NDcyMzU4NzI0NzM3OzU1MjUzNDU4MzIzMjg3MzU1NTU3OTc1
NDU1MzU1OTc1ODo1NTc0NTQ0NTUyMjMxNDU1MTc1NTM1NzQ4ODk3NTg1NTc0MjMyODU4NzU3Ozo1
NTU1OTQyNDs1NTI0NTU3NDQ1Nzo1ODU1ODg4NDcyNDQ0NDM3ODU4NzM1NTM3NTMzNTU0MjM4NDAy
MzMyMzM0NTc0NTM3OzQ1NTQ1Nzg3NTU1MjU1Mzc4ODQ1NDU1ODQzNTczNDU7OTc1NTQzNTMzMzQ1
MjU0NDU4NzE3NTU4OjQ0NTc1ODs1Nzg3NzU1ODU1NTU0NTg1NDc1Nzg0ODc1NDc4ODczMTU1Nzg1
NTk4NTg1OTc1NzQ1NTU1NzQzNTk3NTU4NzU4NzU1OTg0ODk1NDQ1NTc4Ozg6PDo0Nzc4NTMzNTg4
NzQ0MjU1NTU4NTc6NTUzNTU3Nzg3NTg6OjcyNTg0NTU1NTU0NTg3Nzc3ODQ4OTU3NzM4NDU1OTc3
NDo3NTk3NzU1NTU1NzcyMzc3NzMxMzU1NDMzNTU1MzU0MjM1NDQ0NTM3NTU1NTk1NTc1NDU1Nzc4
OTg5OTc1NTc3ODQ1Ozk6NTg6NTo5ODc4ODc5ODk7OTo4OTk6Ojw6Ojw7OTw4Ozs5PDk4OTg7Ojs7
Ozk7PD08PDs+PTo4Ojw8Ozc9PDw9Pj09OjxAPDo4OT49Nzs9PDo7PT48PTs7PT09QD0+Ozc5PD09
PTg4PD4+Ozo4Ojw8Pjo4Ozw+QEA9Ozs7O0E+PD07Pj48PUBBPjw6Oz46PjU7Nz0+PDo7PkE+Pj4+
Pjw6PDw+Pjo7OTo6Qj47Ozs+Ozw7PT5APDo4PT5APTg6Pj07PDo7Pj09Ozs8NUE9Pjk8PDw9PDw+
PTw8OTk4Nzg5PTs8Ozs1ODs+PT45PTg8QD49Oz09Ozo6PDo8OTo5OTc9Ozw8QUA8QDo7OTs8PTs+
Pj4+Ojw8ODE0MDAxNDU1MzcxMzU0MSwyMjQxNTU1MTA1NTI0NzQ3NTUyNDM0NTIyNS8xMjI1Mi8y
MjAyMTM1MjE0MjAxMi4xMTEyMjIwMjA0MS8vMjIzMzIyMTQxLi8yMjIzMzI0NDQwMDEyMzIyNTcx
MC8yMjU0NTQvMzQzMTMyMzAzMzEyMjIxLy4uNC8zNzU1MDAzMTI1MjQvLjI0MjUvLDAxMzMyNTM1
NTU1NDEyNDI0MzMyMzMxMTIyNDI1NzU0MTUxMTUwNTU1MC4zMjEvMjAwMzQ0MS81NDM0NTMwMTU0
MjAvMjI1MTE1NDM0NTU0NDQ1NDE1NzM0NDUzMTExNDUzMzU1MzM0NTM0NTI1NTU1MzIxNDUzMTIz
MzU1NTQ0MjU0MTAwNDM0NTMwNTU0Nzc3OTg1NTUzNTg1NTQ0NTU1NTMxMDIyODU1NTMzNTc3NDc1
NDI1MzQ1NTc1NDU0MjA1MjQ1NDc1OzQzNzU3MzIyMzMzODk3NTk1Mzc3MzQzMjUzMzU1NDUyMzQ0
MzMyMjU1ODU4Ojg1NTg5NzUzMTM0NTUzMTMyNTU3MzU4ODU1NTI0NTM0NTU3NDIxMDM3ODg1NzMz
ODU0NTQ1MzAyNTc0NTU1NTQ1NTU0NzMxNDQyMzI1MzM0NTU3NDg3NTEyMzI1NDM3NTAyNDQ0MjUz
MjM0NTUzMjU1NTQ0NTU0NTIyMzU1MTEzMzEuMzc0MzMyNDQxMTcyMjMwMTM0MjUzMjU1NDM1NTc1
NTQzMzU3NTU0MzU4MTA0NTU0NDQwLzQzNDQzMzI0MS80NTU1NDM1MjE0NDEzNTU1NTM1ODgzMjAy
MjIzMzU0Mzc1NTQ3NTU3NTUzNDM1NzQ1NDM3NTI0MTI1MzEyMjU1NTU1NDMxMjM1NzU0NTcxLzM0
Nzc1MDQ1NDIwNDUzMjQyMjU3NTU0NzU1NzU0NTUzMDU1OTg4NTQyNTg1MjQ0MjI0LzQ1NTAyMzc5
ODU0NTU1NDIzMTEyMzM3NTU0NDc4NTQ3NDU1NTM3NTQ0MjA3NTUyMzU1NzUzNTIyMzM3OjgzNzg1
ODc1NTU1NDQyMTU1MjU0Nzg1NTU1MzE0Mzc1NDQyMzg0NDg1NDU1ODU1NTM1NDQ1ODU1NTUwNTU3
NTM1NTg6NTU3OTo4NzU3OzUzNTc0MzU1NTc4NTc1NTc1NTU1MjE1NTI3NzQ1NDM0NDIxMzIsLjEw
LjEvMTg4OTU0NTc1NTU4NzM1NTk+Pj45MjExNDg1NTI5OTc1NTU0NTw8Oz09PDk6OTc7Ojg1NDg6
OTQ6RkA6Ojk8ODU1NTc5OTg+PTs3NTU1Nz0+PTo0NDQyMzIyMzc1NTMvLzUzMjAzMjU3NDMzMzM3
ODc6OTc0NTM1OjU1OTQ1NDc0MDQ1NzU3OTk1NTc6NTUxOTc7OTU0NDo4NTU4OjU4Ozs1OTU4NTU4
OTc3Nzo3NzU1ODU0Nzg1OTk4NTM1Nzc3NTc1NTc1NTI0NTg1NTk1Ojw5Nzk7OTg4NDc6OTk1ODc5
Nzg5Nzc4PDw5Ojc4Ozc3Ojs4Ojk6ODk1Ojk1NTU3Ozg3ODk4NTg8OTo1OTU4Oj09Ozc5ODg4NTM3
ODc1PDs7OTg1Ozk5OTc3Ozo6OTU1Nzc1Nzc3NTc3NTU1ODc1OTQ1NTg3ODg1NTg1NTU4NTU1ODg1
OTc4OTc5Ojg1NDU1MzM1OTk0NTk4Nzg4Ojc0NTM1OTQ0MjE1OTM5NTU3NTU1NTUwMTM1NTAxMzQ0
MTE1NzQwMjM1NTQ0NDM0NTc1MjE1NTg1MjUzNTk1Nzg1NDUzNTM0MzU1NTQ3NTI3Nzc1My83NTU1
NTU1NDg3NDQ3ODU3NDU1NzEwMjI1ODU3OTU1OTo0Nzc4OTU0NTU1Ojo0NDUyMjQ3OTczNDU1NTU1
MzU1MzU0MjM0NTUzMjI3NTQ1NzU0NTI1NTUzNzQ1NzcyNzc3NTQyNTUxNzk4Nzk7NTQ1OTU1ODg3
NTQ1NDU3Ozw4Nzc0NDU4Ozk6NzU1MTM1NDU1MzEzNzgzNTQ3NTg1NDIxNTU1ODM0NDI1ODc1NTU3
NDU3NzU0LzQzMzM0NTc1ODUzMjc7ODc1OjU1MzUzNTUzNzc1MjQyNDU0NDc1NzM1PD03NTU0Pjw6
ODM1NTc4NzU1NTk1OjQ0OTg6NTc1NTU4NTU4ODc6OTc0ODU3NTQ1NTU1OTU1NTo5Nzc1ODk6NzU1
ODU4NTU1NTc4ODc5OTs0NTc0NTU3ODU4MzU3NTU1NTU3NTk1NTU1NTc3Ojo0NTUyNzk4NTQ3NDM4
NTk1NTU3NTM4NzU1NzQ1ODQ1NTM0NTg3NTc0NTc4OjU3ODc1NDQ3ODU1NzUyMzU0NTg3NTQ1OTQ1
ODczNTU3OTc0NTo6MzU3Nzg4NTc1MzU3OTk7Ozc4OTw1NTU6OTo7Ozo6PTo6OTk6Oz06OTo8OTc7
PDw7PT08PEFBPjw9Pjs7PDw6PDw+PDs8Ozk6Pjs6OTw7OTc3Oj47Ozs6PDo4OTo7Ojs8Pjk4PD09
Ozo+PUA9Ojw8Ozc8Ojs3ODs5PDs7PT08Ojs5PDs7PDo+Pj49Ojs8Ozc4Nzs+Pjs7ODw6Ojg8Oj48
ODs7Ojs8PD0+PTo9Pj0+Oz0+ODo7Ozo8Ozg7QTo5PDw4Ojo7PTw+PDo9Qj08PDs9PDo8Nzo6OTs+
Pjw6Ojo9PT0+Ozc3Ojw+Ozw+Pj09PT1APD09PkA+Ojs6OTw9Pj47Ozs5OkE+Pj5AQT1APj0+Pj4+
Ojc7MTE0NTU1MjExLzM0NTExMzcyNTUyMDMxMjExMTQzNDU0NTMyMTIwLjEvMzAxMTAyMzMxNDUy
MzM1NDAzNTcyNDIzNDQ0NS8yNDIvMTMxMjMuLDEzNTIyMCwyNTUyMzMyLy81OTIsLjM0NDA1MzMx
MzQzMzExMDQ1NTMzMjQ1MjM1NDQ1NTU3NTUzNDU0MjMyNC8vMjAyMzUzMjMxLzQ1NTUxLzIvLjQ0
MjEzNDIxMTQ0NTU3MzMyMiwwNTEyNTM1NDIwMjMxLzM1NDU0NDUzNDI0NDg1Mjc3LzAyNTQzMTM0
NDMyMzMzNDExMTU1NTQ1MjExMDMyNDU1NDIyMjMzMzIzMDIvMDI1MzM1MjU0MTU1MzUyMTIwMTUy
Mjg1NDIzMjQzMzcyMjU0MzQzNDU1NTczNDEzMzUyNTQzODIzMzU4NDQzMTUzNTc0NTg1MTE1NzM0
NzMyMTU1NTU1NTU1MjI1NTQ1NDM0NTQ0Mzc5ODQzNDMyMjQzNDk1NDU1MjE0NTM0NTU4NTU0MzI1
NTU1NTM1NDM1NDMxMzU1NTQ0NzUzNzczNDMyNDU1MTE1MzQ1NS8wNDQ1ODUwMTI1MzQzNDU4NDU1
MjI1NzI0Nzk1NTc0MzE0NTU1MjIyNTk7NTQ0NzM1NTk1NDk5NTg1NDE3Nzg3NTU1MzMzMjA1NTIx
MzU4NTQ1NDE1NTQxMjIzNTQ1NTU1MjI1NDIzNTQ3OTU1MzEyMzMyNDQzNDIyMTIyMTQ0MzU1MjMy
MjQzNDQzNDUyMjUyMzQ3NTIyNDU0MTM1NTA1OTc1NzUyMTQyMzQ1ODczMzg1NTU5Nzk1MjQ1NDIy
MzQzNTU1Ozg1ODU0NzU1ODU0NTQ0NDQzODg1NTU0NDM0NTg0Mzg1NDc0NDU1ODU1OTk0NTUyNTQ0
NzcyMTU1NTc5ODc1ODU3NTA0ODc0NDMzMjIzNDMyNzMyNTU1OjkzMzA3NTQ3NDcyNTQzMjU1NTUy
OjgzNTU1Nzg4MzQ1NTc4NTU4MjI1NDQ0NDU1MDM0MTU4NTMzNTUyNTQ6NTU1MzE0Nzk0NzU5NDc1
NTI1NTU1NTIwNTUzMzU1NTk1MjU5ODMzMzM1NTo5NTUzMzIxNDU0NzU4NTU1NTg4NDQ1OTc1NzU3
NTc5Ojg0NTU4NTU4NDU5MjU1NDM1MjI3ODU3ODMyMjc4MzU0ODk0NDU5NTUyMjAxLy8vMTIzLiwz
MzM3NDM1MjU0Nzk1ODU4NT5DQj4zNDU1NzE0NzgzNTc1NDQzODw+Q0I+PT09PTs5PTw7Ozc4OTk+
Pjc0NTU5NTc6NzU8Pj45OT48ODk+PkRFQDg1MDEzNTg1NDc1Li4wMDEwMTMxMzI0MjEzMzEyNTk8
ODQyMTU4NTI0ODk4ODU1NTU1NTI4NTk6Mzc7NzUxODo1NTM1NTk7ODU5OTU4Ojs4Nzg5Ojg4ODo4
NTc8Ozg1NTc4ODk8Ozg4OTk1NTUyNzk5OTs5NTU5NTU4Ozk4Ojo9Pjo5Ojg3ODU6OTU6OTk7Ojw6
OTk5NTc4OTUzNTU1NTU1Nzc1OTU0NTg7NTU1Nzg4PDo5NDI5ODU0Ojs4Nzg6NDU1Nzs4OTc3NzU5
Ozk1NTU7Ojc7ODg3OTg4Nzc1NTs5OTg4ODU3ODk5OTo5ODU7ODcvMTM1ODc5Ojs4ODU1NzUzNzg4
NTQ0NTk4PjQ1Ozc1NTc1MzU1ODU1NDM0NzU1MzIzNTUyMzMzNTU1NDIyNDg1NTQ1MDM1NTUyNDU1
NDQ0NTMwMDU5ODc0NDQ0Mzc5NTU3ODQxMzQ1NTMyMDAxMzU1MTE0NTU6NTM0NDI1NTg3MjQ0NDE1
ODc3NTM3NTU1NTg4NTU3OTU0NTU1NTk7NTk1MzU1NzU0NTU1NTU1NTU1Ojw7OTc4NTU4NzQ1NDMx
NzU4NTU1NzU4NTQ4OTg1Nzs1NTU1NTQ1MzU4Ozs5NTk6OTQ1NzQxMDU1Mzg4Nzg1ODo5NTU1ODc4
NTU4NTQ1Nzk5ODg6ODU1NzUyNTk4NTQyNTc1ODM1ODo5Ojk5NTQ0NDU4ODU1NTU4NTU5NTc1NDQ1
MzM1NDQ4NTk4NTo4NTU4NTU1NTs8ODU1NTQ3NzQ0Nzk4Nzo5NTU1NDU1NTs4OzQ1NTg7PDU1NTc6
Ojc1Ojo3NTM3NTw5Nzg3ODg5NTIzNDU1NTM3NTQ4NzQyNzg1OTk1OTgzNDU3Nzc3NDc5ODU3ODcz
NTU5PDc4NTg5ODc4NTM1ODk5OTU4NzU1Nzk4Nzk5OTk0NTg4PTw5OTQ0NDU5ODk1ODU1NDU4ODQ0
ODM0NTQ1Nzc1Nzk3NzU5NzU4Ojk1ODg1NTc1NDMxNzc1ODUzODk0NDk8NTg1PDs3NTU3OTk1NDg4
NTk4Ojo3OzU1ODo0NTU4OTg6OjU4OTo8PTs5PD46Ojg4PDo7PDw9OTs6PTw8Ojs8Ozs+PDk8Pjw+
Ojs6Ozw8Pjk6Ozw+PTc7ODo9Ojw+OTs6PDw9Pjs+PDk9PDo8Ojk5PT47Ozw8OTs8Pjw4Oz45ODw+
PTo7Ojs6Ojs6OUFAPj09PT1BPjs5OT08ODw9PDk5PDw6ODo8ODc6OT49PTs+Pjs9Pj49OTo8Ozk7
Pj1APDw+PTo+PD47Ojo6OTs8Ojo8PjtAPjs8PT0+PTw8Pjs8PD4+Ojo5OTk3OD0+PTw6Pj47Oz49
PD0+PDo7OTU5PD09ODo+PT4+Ozo9Pj0+QD5BQD1APj49Pj46OTw6PD47PT4+QT44Oz08Pj4+PD4z
MzM1NTMzMTAwMDE1OTU1MjU0MTI3NS41NSwvMjMzNDAvLzAzMDI1NTM0MjUxMzQ1MzIsMDA0MTAz
MzEwLywwNTUzLy8xMzMyMDMwMjE0NDA0NDEuNDczMTAwMDIzMTM0MTQ1NTQ0NTM1MjU1MjI0NTU1
NTEzMzMzLzAyMzEwMzU1NDUxNTUyNTQwMTMyNTQ1NDE1NTMyMDExMjEzNTU1NzQwMjIxNTExNDUz
MTEyMjIxMDMxMjI0NTU0NDUxMjAzNDQzMjIwMDMyNDU0NDMxMTU0MDI0NTI1NTMzNTMzLzExMTMz
NzUzMzQ0MDg1LzEzMjE0NTI0MjIzNTQzMzIxMzU0MzIzMjMzNTUzMTU1Nzc1NTMwNTU1MzU1MTU4
OTg3NTU1MzMyNDIzNTAyMjc3NTU1NDE1MTMzMzQ1NTQzNDMyMzM1NTU1NTU0MjQzNDU3NDQ0NTI0
LjI0MzIvNTUzMTQ1NTEyNTc0NTQ1Ojk4NTIxNTU1NTc1MzMxMzM1NTc1NTUyMTQ0NTk0MjMxNTUy
NTM5OjgyNDkyMzI1NDUzMzIyMzE3NTIwMjM4NzUyNDg1NzQ0NTU3NTQ0MzU1NDQ1NzUzMjU1MzU4
NTE1NzQ1NDIyNTU0NTM1MzUyNDg0OTUxNDg4NzU1NzM1NTQ3MzU1NDU5ODU0NTc1NDc1Nzc4NDU0
NDU0NDM1MzIyMTU0NDE0NTIzNDczNDQvMDMyNTQzMzI0NDE1NS8zNDE1NzU1ODQxLjU1NTQ0MTI0
MzU0NTgzNTQ0MjExNDI0MjAwMTMyMzQ0MzM0NzUxNDU0NTUzMTM1NzMzNTU1NTM1NTM1NTU1NTEy
MDIyNDU6NzU0NDQ0NTc5NzIzNDU0MzU5NzQyNDUyNTg1Nzc5Nzc3NDM5NTU8Ojc3Nzg9OTk4NTMx
Nzw3MzU1Nzc1NTUzNTc3NTQyNDc1NTQ3MjU0NTU3NDU1NDMxNDU0MTM1NTU0NTU1Nzc3NTQ3Nzc4
NTc5NTM1NTM0NTMzNTU1NDc1MjI1NTMzNTUzODU1NDQ1NDUzNTg1NTo9NzU1NTc5NzMzNDIyNDU4
MjM1NTU1MjU1NTE1NDQzMjEzNTQ1NTg3NTU0MzI4NDU1NDQ3OTg0NzQ0Mjc5NTUzMzQ1NTEzMzc1
NzQ0NTU1NzUzNTQ0MzIxNzQyMjM1NTU5NzkyNTU0NDEyMzIwLzAwMjAvLiwwMSwvMzIvLzA0MzQz
NTU0MzM3Ozs7Ojc4ODw7QD45OT47OjU3OTo1NDU1ODU1NztAPTs8Ozw+QEE+PT46Pj5APjw9Ozg3
PDo5Ojo1NzhBSUE5Ojo5Ojo7PkJGPjU3ODc3MzU4ODU4MzEwMTU3NzM1NDExMTc4ODc6PkBBODQ1
NDc1MzU3PDs4Nzg3Ojo4OzozNTQ3Ojs5OjU5OTk7ODk5Nzc3OTk3NTk5ODg6ODc3Ojs5NTUyLzU1
Ojg3NTg4Ojo7NTs4OD46OTg6ODc1ODg5Ozc1NDU0NTw8ODc4Ojw5Nzs7NTU5NDU5NTg6OTg1NTg3
NzQ5Nzk4NDg3NzUzMzU3NTQ3OTU1ODc1NDU1ODk3NDQ1NzM3OTk4PDg1ODo4NzU1NTc1ODQ5ODo1
NTQ1ODc4NzU5Ozg1Ojg0Nzo6PDk4ODc1Nzk3Ojc3NTQ1ODc4NTU3ODc1NDU4NTo4Mzo6OTQ4NTQ1
NTU0ODszNTU1NTc4ODk1NTc3OTc0MzQ1NDM0NzU3NTM0OTk1NDUxMjU1MjI0NzUzNTU3NTEzNDIw
MDE1NDAzNTU4NTM1OTg3NTU3OTg1NzU3MzU1Mzc3Nzg0NTU3OTk4NTU1NDQ1MjQ1NzMzMzo5Nzc1
MzQ1NTUzMjc3Nzg4OTc0NDU1NTg6NTc0MzU1Mjg3ODU1NTQ1NTg5Nzw7NDU7OjQ0NDM1NTo3ODk3
NTU1MTU3NzU4NzU3Nzc1Ozo0NDMxNTU3NTU7OTc3MzEyNDc1Mzc1MzU3OzU1NTEyNTc1NTg6PDc3
NzU0NTQ1OTUyNTg5ODc0NTc4ODg0Nzg3Ojc3NTU1OTU0ODUyNDU3NTk1NDk5NTUzMjQ3NTc6Mzc5
MzczNzU7OTU1NTU1NTU1OTU0NTU4NTU4ODo5NTU4OTk1NTo4NzU1NTszNDg7NzQ3NTc3NzU6OTc4
NTU3OTQ1NTM1OTU3Nzc3NTQ1MzU3NTw6OTU1NTQ0NDg1ODk3NTg1Nzo6NTc5NTM1NTU1OTc6Ojc5
NDU6NzU5ODg1Mjc3NDk1Nzo8Nzo4NTg1Nzo6NzU3Nzg0Mzk5NTQyNTU1ODQ1NTU0NTU1NTQ1NTg4
OTQvNDU1NTk3NTU6OjU1NzM1Nzc5ODo4OjQ1PDs5NzUzMzU5Nzg3OTQ1Nzc3NzU1NTU0NTU1OTg1
NTc3Nzo1OTo4ODw+PDw7Ojk5Ozo7NzU3ODk6Nzg1OTo6PDg3OD0+PTo4ODc7Pj4+ODk8Ojo1Ozs7
Ojw+PDw9OTo8PDk3OTo6Ozs9QDo6OTk7PDw+PDc9Ozw+Ojg7Oj4+Ojo7Pj06Ozg5Pj07O0BBPT08
OztAPj48PT45OTo8Ozo9PT0+Pjs8PTk6Oj09PEE+OkA7PT47Ozo6Ozs7PT0+Pj0+Pjw9Pj49QUFC
PTs9QEA8Pj4+Oj0+PkA+Pj4+Ojk8PTk5PDg6Oz5APT4+Pjw1PT1AQTs7Pj48Pj08Ojg7PD0+Qj45
PDw9PTs9Ojw+QEA6Ozs8PEE9PDo5Oz09QD48OT07PT47PT49PDs7Ozo7ODw6ODw+OTU8PDM0NTEy
MzUzMTEuMS8xNTM0MTM4MjIwMzQyMDIyNTMvMS8wLzMwMi8wNDQvLzEvLjE1MzAsMDEyMzMyMzQx
MTU1Mi8yMzMzMzQwMjU1NTQyMTQyMTMxNTMvLjEzMDEzMzIxMS4xNDQvMDMyMzUzNTMzNDc0MzI1
NTEyNDM1NzUxMDI0NDU1NTM3NTMzMDAvMjMyMTEzMTAxMTMzNTU1MzIyNDQyNDUxMzQzMi4wNTIx
MjEyMjE0MTQzLjAxMTI0NDUzMjMwMDAyNTUzMzU0MjU6NTc1MzQyMDIzNTc4NTIwMTEyNTUyMzQz
NTQxMTM0MzU4NTQyNDc1MjAwMDI3NTUyNDU0MjMwMTU1NDMyMTU1NTUyNDU0NTEwMzUzNTU4NTMy
NDI0NzUzNTA1MzU0MzI0NTE0NDU0NDMyMjQ3OTU0MTM3NzQ1NDM1NDM1OTk1MzU4ODU1MTAwNTU1
NTc1MzM1NDMzNTQ4NTM1MTQ1MzM0MjQ1NTMzMTM0NDM0NTU3NDI0MzU1MzU1NDUxMjUyMDAzMzM1
ODQxMzU1NDMwMzQ0NDMyNzMzMjM1ODU0NDQzNDc3MzQ4NTM1NTIzNTU1ODQyNDczNDU1NDI0OTg3
MjUzMzIzMzM1NTc1NDE0NTI1NTM1MzE0NTUyNDIyMTI0NTU4NTUzMjIzNTQwMjQ0NDM0MjE1MjIz
NTU1NTk1MTQ0NTg1Nzc0MzIzMzU3NTQyMjUzMzU3NzcyNTU5NzQ1NTUyMTI0NTQyNDUzMTAzMzQ0
LzI0NDMzNTUyNTQyLy8xMzUyLjI0Nzk1NDExMzMzNDU0NTQzMzU0NTIxNDI0NTU1NTAyNDMzNDM0
NTAsMzQ1NTU1NDQ1Nzg4NzI1NzU3NTQ1NzUxNDU1NzU3NTk4Nzs3ODU0NTQzNTU4NDg3NTc3Nzk4
NzMzMTA3NzQ0NTU0NTM1ODc1NzU1MzU1NzUzNTM3Nzg1NDc1NTQzMjQyNDU4NDU1NDM0MjE1NTU3
ODUzNTc6ODQ1NzU1ODU3NTk1OTUzNzU0MjU3PTg0Nzk4ODg4NTc4OTc4NTc7OTU3NzIzNDc0PDs4
NTQ1NzMzNDU1NzU1NDQ1ODk1MDQ1NDc7NzMzNTU3NTgzMzU1OTU0NDU1MzQ1OTk8ODg8NzU0Nzg1
MzM0NDMzNDU1NTM1NDUzNTU3Nzg4NTU5NTIyMzEzMjAyMzQ0MzAvLC8uLC4vLDAwMDM1NzQzNDU4
NTU1OTc1Mzg9RUY8Pjs1ODw5Nzg9Pjg3OjU6Ojw5NTo8PT09PkM8QTw9QEBBQUE9Pj03Nzs+Nzc5
PDw8PEdMQzw6Ojk4OD49PkVEQ0A+Ozk4Ozs6Nzc1NTU1NDk8Ozg3Ojc4ODc4Ojw9QDw1NzUxNTUz
Nzk3OTc3OTc6ODU1NDU6Nzg3NTU1NDQ1ODU1Mzg4NTc6NzQ1Mjc1OTU7OjU4ODczNzo3MTM1NTU6
Ojg5Nzc1Ojc1Nzk1NTc3NTg4Ojk1Nzc5PDo5NTo4NTw9OTo1Mzc3PTw5OTg5PD04Nzc1OTg4ODg4
OTc1ODU3OTg3Ozg3NTQ4Nzk1Mjg+OTg4NTs1ODU1Nzg3Mjc1OTc1ODs6NTU5ODg4Nzg5Nzc6OjU5
OTs3Ozo3MzU6NTQyMTM3MjQ4NTk1NzU1MjU4Nzc0MzM1ODU1OTk4OTs6OTg3Nzc3OjU1Nzk0OTk4
NTU1MzM4NTM1MzU1NTg4NTQ3NTQyMzU1NTQ4NTU0NTU3NzM1NTc1MzM4ODQ1OjU4Nzg0NDc0NDUz
NzU1NDU1NDU1MzU1NTU3OTUzNTU0NDQyMjIyODU1Nzg3Nzc3NTc5NTQyNDc3NTU3NTM1ODQ1NTI4
OTc1MjM5Nzc1ODc5NzUzNzk1NTg1NTg1MTM4NTU1Mzc3NTU1NTg4OTUzNTk0NTc1NTUyNDU0NTQz
MzU1NTM0NDg3NzE3OzUzMzU1NDU4OTU1NTQ1Nzg1NDg0OTc1ODg0NDU6NTg3NTc1Mzc9ODU1NDc3
OTc0NDg6NTQ0MzQ5Ozc0NTI0NzU3NTk0NDQ3NTc3ODU1ODg7NDQzODk3Nzo4ODU0MzQ1ODs3Nzc3
NTU1NTc4Nzg4Nzc5NTc4NTU1MzU6ODQ3NTU1NzU1Nzk5OTU4ODU4ODU3NTQ1NDM0Nzc1ODo3ODU3
ODk3OTo1NTU1Nzk5ODk4NTUzNTU7OTk4NTs5ODc1NTc3Ojk6OTk3NTU1MzQ1NTg7OjczODo4ODU0
NTc6Nzo1NDU1NTc0Mzc5NzU6Nzg1NTk3NTU1NDQ0NTU1NDIyNzUzNTU1ODc0Nzc1NTg3NTU3NDU3
NDU3NTc3NDM1NDM1NTUyNTQxNDU0Nzk1NTQ0Mzc1NTU0NDg1NDU1NDc1ODo4OTg5Nzk8NTU6Ojc0
NTo7ODk5ODk4ODU5Ojk4NTU5NTk9OTk6NTo3ODU6Ojk5Oz08Ojs8PDw7PD06ODk5Ojc6ODo5Oj48
Oj09PDw+PTs9QD09PTo+Pjs7Pjg7Pj01OT08Nzc6OT0+Pjw9PkA4OTo7PDw8Ozs+Pjk3Oj4+PDs4
Ojw+Pj47Ojw+PTw8OzxBPjs+Pj47Ojo7OD4+Pjo8PDw8Pj09Ozs8NzU4ODc4PUA+PDo4PD48Ozo7
ODw8Ozs8Ojw9Ozo6PDw7OTo8PTs6Ozw9PDg9Pj07PDs9PDs6Ozo8PjU5PTs9PDk6Pjs8PD05ODo6
OTw8Ojk8QUBBPTw+PjxAOzo7PTs7OTs7Pj48Oj08Pj0+Pj5APTs8PDs6PTs5PT08LzIxMDIwLzM1
NDExNTc0NDEyMy8wNDAwNDQyMzUxMS8uLzMyNDI1MzAwMDEwMjEuMTQxMjAsMDAzMjEyMTAwLy8y
MzEuLC40MzAwMjEzNDMyNDMyNTUyMi4xMzU0My8xMzU0NDUyMTU1MjE3ODMzMzIyLzQ1MzE0MzMw
NDU1NTIvMTIyLzA0MTQ0NTMzMTEvMjMxMzMxMTEyMzQxMzczNTEzNDMyNTUyMzUzLjM1MzIzNDQz
NDMxMzUzMzEvMTUzMTQwMDQ1MjUwNDUyMzI1NTIzMzMzMzIyMjEyNTM0MjExNDU0NTQ1Li8zNDE1
MjAwMTQwNTMyNTgzMzQ0NDU0NDQ1MjEyNTQyMTQ1MzQzNDU6ODMyLywsMTU5ODg3NDQ1MDIzMzQ1
ODU1MjU1MjQ0NTUzNDI3NDM0MTAyNDI1MzQ0MjExNTQzNDIyNDQyMTMyNDAyMzE1MDMxMjEyNzU1
LzMxMjAxMzQ1NTU0MTE0MzU1NTU1NDMvMDI1NTU1NTQ1NDQzNDI0MjU0Mi4vNDQxMjQzODUyMTQ1
NTczMzU0MzEwMTM0NTg4NDQ1OTMyNDU3NTU1NTIyNTQ1NTU0NzUxMjU0NDU1Nzc4OTQwNDUzMTUz
MjMyMzU1NTU3NTUzNTUyNTUzLjEzNzE0NDExMzMzMzQ1ODc0NDM0NzU0NTM1NTM1NDExNTU3NDk4
ODo4NDM1NS8xMTIxMDE1NzQwNDIwMjU1NDU0MDE1NTU1MTM1MzE0NTUxNTIzNDUxNTg1NDU1MzQ0
NTE0NDQ1NTM1NTU1NTUyNzU1NDIxMTQ0NTMzNDMyNTU3OTgzNDMzMjAxMDMzMjM1NDU1ODcyMjMz
MzQ0NTg5ODU3NTU1NTc0MjU1NDg4Nzc4NTQ1NTQ4Nzg4NTU0Mjk3NTM1NDI1NzE3ODc5OTc3ODgz
Mzc3MzU1ODU3OjU1MjQ1MjU1NTc1NTE4NTU4OTc0NDg4NDc4ODo3NTM1NDM4NTU1NDc1NTQ1NTQ1
MzQzMzM0MTM3NTE0NTU3MzU0ODUzNzc1NTU3MjU1NDQzNDc3NTU0NDExNDQ1NDIzNTU1NTk1NTU1
OTc1NTU0MjU3NTU1MTQ1NTU3NTc4NDM0NTU3NDU1NDM0Mjg1NTU3ODc0ODc0ODk4ODs4NTU3Mzc4
NTk8OTc1NTQ0MzE0MzMyNTgzMzM0MjEyMDAwMjMxMSwsKy8rKywuMjQ1MzU3NDQzMTUyODs4Nzc4
Ozk8PTxFSUA9PTo4Nzg4NTU6Ojk4NTc5Ojk3PkFBQEA+PUE+PUFAQD4+QUE9Pj46PDo8PkA7PT1E
RktAOzg6Ozs8Pj4+QERMRzs6NTU3Nzo5NTQ1NzQ1OERNR0E9OTc4NzhAQD47OjMxNTMzNTU3NzMx
NTk3NDU1MzU6OjU1Nzo5NTU4ODU1Nzc4NTczOTk4Ojg4NDc6OjU6OTc3NTc7PDg5ODs3NTQ4Nzg5
OTg5NTg3Nzk8Ozc1NTU5PDo3OTg5Ojk1OTU3NTM1NTU4NTU7ODc5NzU1OTk7NDU1NTU1OTg1NDk5
OTo7OTk4NTU5OjQ1NzU3NTk8PTw1NTg1Nzc1ODk3NTQ1NTk5NDU3ODk4NTo4OjU4Pjw4Nzg4OTg4
NzU1OTU1NzU3NTU1NTQ3ODQ1NTU4Ozo0MzI1Ojk4NTU3OTU3NTg6OTg3NDc0NDQ5Ojg1Ojg1NzU1
ODc3NTIzMzc3NTczNTU4NTU0NTU1NDg0NTU1ODQ0NDg1MTM0MjU1NDI1My81Nzc3ODQ1OjU0NDUy
NT00NTk5MjIyNzg1NTU8OTU3NTIyNzUzMzU1OTc1Ojk1MzU1NzQ1Nzg3NzQzNDc5Nzg7NDI1NTcy
ODg3NzU3NTUzMzU5NDc0MzI1NTc1MzQzMjc1NTc3MTc4MjEyMzU5ODc5ODU1NDQ6NTM4NTMyMjU1
MzQ1NzU1NDU1NDQ1NTIyODQyNDQ1NTU1Nzc1NTQ0MzQ0MjU0MTI1ODoyNDg1NDM1NTQ3MzU1OjU1
MzU5Ojc1NDU3Nzw3NDg1OTk3NDQ1NTU6OTQ0NTg1NTU0MzQ0NTQ5Ozo1ODg3NTk1NzU0NTUzNTc4
NzU3Nzk1NDU1NTo5Ojc6NzU3OTg3OTg0MzIyNzc3OTk1Nzk3Nzc0ODc1NTM1OjQyNTc3OjczNTU1
MDQ5OTUyMzU1NDU3NTk5NTQ1Ojg4NTU1NTU3NzU6ODQzNTc3NDU1NTQ1Nzc3NTU3Nzg1NzMxNzg5
OTU3NzU1Nzc0OTs7Ojg1NDU3ODc6NTg1NTU3OTgzNzU1Ojo1NTg1NDQ1ODg1MTM0NzU0NDU4Nzg3
NTc5NTU1NDU6NTQ1Nzc3NTU4Nzg0NDQ3ODczNTc1NTc3MzQ1NTg4NTU5NTg4OTU3ODU1NzU5Nzk5
ODk5OTw7Ojc1ODo4ODU6NTg7Ozs4OTs9Ozg5OTo7PDo8OD09Oz4+PD47PDs5Ozo7Ozk8Pj09Ozo+
PDo6Nzo6ODs6OTo7Ozo4Oz45OTs9Pj49NTs7PD07PDw5OUBBOzk6Ojw+Ozo4Ojs8PTU4Pjs6PDxA
Ozw8Ojs6Oz5APjs5PTo9PTw9PTw3ODs6Ozw8Pj48Nzo6Ozw+QDs+PTxBQT47Ozk5ODc9Ozo4PDk+
PDw5Oj5AQT08Ozs9PTo5PD49PDo8PDs9PT48Ojo6Nzc7OjxAPEA+Pjk+Pjk5PD5BPjo7PD49Ozg7
PEA+Ojs5Pjw8PT49Pj09Pj4+Pj4+Pjs6Ojs7Oz07Oz08PkE+Qj48Oj48PDsvMjExNDExMDIxMTIx
LzIxMzQzNTIyLjIvMjA0NTM1NDQyMjIyNDI0NTMwMDEyMjI1MTUzMzM1NDMxMTMyMDIxMzUyLjM1
MjExLy4yNDQzOTQxMzExNDU0NDExNTUzNTc0MjM1NDQzLzAyMy4vMjAzMzIuMjMxMjEyLzEzNDUy
NTIwNDMyMzQzMzUzNDExMTA1NTUyMzEyMjIsMjExMjMzMzQxMjEzNDM0NTQ3MzMxMjQyMDAyNTEv
MTQ0MTEzNDQ0MjU0NDQ0MjMyMDQ3MTUyMDMzLi4yMzM0MjI1NTQwMzMzNDU1MzIzNTMyNDE3MzIz
NDMyNTIwMTM0MzM1NzQ1MzAzNTExNTU6ODgzMjIxMDQ0NTM1NTQ0NDI1NTU1NzU1NTg3NzUzMzM1
NTg1NDM3NTU1NTQ1NDMzNTU5ODg1NDUxNDk1Nzo3ODc1NTg4NzU0NDQ6Ojg5NTU0Nzc1NDIxNTM0
MzM6Ozc1NTQzNDU3NDQ1MzU3NzU3NTM1NTc0MzUzMjU3ODQ1NTU1MzMyNDU1MDA0NDI1NzU1NDI0
NTQ4MzUxODgxMzAzNDUyNTg4NzU1MjUzMzUzNDU1MzMyMTU0NDM1Nzc0NTg0MTU0MjQ0MTI3NTUz
NDUzNzU0NzcyMzQzNDc1Nzk0NDUyMjQ4NTU1NTQ1NDE0NDU1NTQ4NTIzNDU0NDE0NDc3NDAxMzIw
LzA0NTU4NDI0NTI0NTI1NTgzMTAwMzM1NDAxNzU1NTU1NTU1MzI0NTU4NDI3NDQ0MzUzNTQzMjIz
MjAzMjM0NTk1NTIyNTUxMjM1NzU1MzUyMzQ0NTMzMjEyMjU1NTU0NTk0Nzc0MjE1NTU0MjI1Nzc3
NDU1NzUyNTU1MzU1ODc1MDM1NTc1Nzc3NTc3NDIzMzUzNTQ1Nzk1NTczMjU3NTQ1OTU0NzI0NDQ0
MTU1MzU1MjQ0OTcwMzk3MzQ1LzIzNTUvMzM1OTU3OTUzMjM0NTc1MDIyMzIyLzM1NTU1NTQzMzg1
NTU0NTU0NTMyMzU1NTU0NDM1NTc1NTIzNzUzNTU1NTU1NDU1ODc3NTczODM0NDU1NTU4NTc1NzU1
NDU1MTU1ODk3NTU0NDc1NTUzNzc4NTU3ODQ1NTQ3NzU0MzU1MDI1NzU1NDI1OTU3NTM4Ojk3NTc3
NzUzNTU3NTU4NDQ0NzQ0NDAxLiwxMC8wMjEwLi4wKysuMjU1NDM4NTU0MjQzNTc1NTQ5ODs6Oj0+
PUVFPj4+PTk3Ojk4OD0+QTw6Ojg7PD4+QkdFREREPj5AQEA+Pj4+PkFERz46Nzs9PTo7PENDRUFA
PEE9PT5BPD5CR0xNRzs0Nzg+Pjs3NTU1NTk+QkxPSUk8NTU5PUNANTk9Ojk1NTQ0NTQzNDU4ODU3
OjUzMzU1NDk1NDg4Nzg1Nzc5NzU3NTU1NDQ3NDc1Mi81NTU3Nzg4OTU1NTU1NzU3NzU1NDQ1OTc4
NzUzNTU4OTc6Ojw7Ozg3NTU8PDg8PD46ODc1Nzs6OTo6ODU3Nzk4MzU1NDo5ODg3NTQ7OTczNDc4
NTU4NTg4ODk3NTg+Oj47OTs6ODs3NzU3OTg7ODc3Nzc3ODg6Pjc1Mzc6ODU0NTc4ODQ1NTU0Nzg3
Nzg5OTg3Nzc6ODgyNDg4NTw8ODc1NTo3NTc1ODc1Mzg1Ozs1NDM4OTU4PTU1NTc0Mjc3Nzg1NDU0
NTU3NTc3MzM3ODU1NDQzNTIyNzg4ODIyMzQ1NDU5ODUyNTQ1NDU3NDE1NTMxMTEzNTMzNDU1MzU3
NTU4OzU1ODk1NTg5NTU3NTU1NzUzNTI1Ozo4ODc1NTQ1ODg5NzU0NTc1NTc1NDU1NzU0NTc1NTQz
NTgyNTo3Nzc1NTU3NTQzODU1NTM1OTU1NTg6NTIyMzc3OTk1NTo6NTU8OzU3NTU1NTc3OjU0NDg3
NTI1NzU1NzU1Mzg3OTo1ODU0NDE0NTQyNTQ3Ojg1Ojg0ODg0NTU0OTc4NTc6NDU1Nzg5NTMyNTk4
NTM1Nzk1MzU1Mzc8ODU0NTU0NTU1OTg0NTM0NTU1NzU1NTQ0NzI5NTc1ODU1ODU0Nzk1NTQ1Nzc1
NTU1NzUyNDUyMzU1MzQ3NTM1MzQ4NTQ1NzkzMzU1NTc1NDk7NDc3NDg5NTU1NDU3Ozo5MzU1NTM1
NzM3NzMzMzU1OTg1OTQ1ODo7OjUyNDc1ODUyMzc1NTc5NTg1Nzc1Nzo3NTU0NzM3ODc3ODc6NTQ1
ODU4NTk5ODg1MTQ3NTc1ODg5NzU1NTc4OTs4NzQ0Nzk5Ojg3NTc5ODUxNzU1Nzk1NDU6Ojk1ODU1
NTM0NzU1NDU1ODQyMzc5NTM0NTUzNzk1Nzc4NDE3NTM1ODk3OTU1ODo3NTs6ODk3Nzk9Ozg1Nzg5
Ozo1Nzc1Ozk1OTw7ODc3OT4+ODU6OT06Ozs1Ozc3NTk7PTw8ODo4NTg4ODk4ODg4Ojk5NTg6Oj49
Ojo7Oz1BOzk+OTU6Ojw7Ojw6OTk7PT48Pjs8Oz49OT0+PUA9OTw+PD4+Pj08Pj4+Pjo5PDs9Pj44
Nz0+PD09PT07PDo9PTs9Ozw7PDw+PTw9Pjs5OT05PTw9PEFAPj47Pj49OT5APj06PDk7PDw+PTk6
PT0+Pjs+PTs7PD09Ozc5Pjw9Ojk6PDw9PTk8PkM+PDs8Pjw7Ojg5ODw9OzxBOjs9PkA+PTw6Oz4+
PDs6Oz4+Pjo7PDs6Ojs+Ozk+Ozc6Ozg9PTs7Ozs8PTg4Ojo7Oj5APTM0MDM1MzA0NDIzMjU6NDMy
MTIyMjEwMzMzMzU0MjQ1MzIwLDAyMjE0MjMwLzAwLzAyMjM1MjEwMi4vMDE0NTMzNDIwMDA0MzMy
MzQvMjMzMy4yNDQ1MjUyNTc3NTExLzIxMzM1MTMxMjU1MTE0NTQyNDUzMzI0MjMzMjU1MzE0NzMz
MjU0NTQ0NTAyNzMzNzgxNDU1NTUxNDU3NDQzNzU1NTUzMjQ1NTg1NTQ0MDEwNDU1NTUyMjQxMjQ3
NTM0MjQ1NzU0NTM0NTUzMzUyLzE0NTM0MTAxNDM1NzUzNDUzMjMyNDc4NTU1MzI1NTg1NTM0MzU0
MTExMTUzMzQ0MzU3NTU1MTQ1ODc4NzAwNDMxMjIyODUwMzUzMzQzNTQ1NTc3NDc0ODg4Nzk1MzU3
NTU1MzQ1NTMxMzUyNDc3NTU1NTk3NTQwMzQ1NTAzMzE0ODU1ODM0NTc1Mi4yODcyMzQ0NzQyMzk1
NDc3NTw7MzI3NTQ1NTUzNDQ0MzQyNTo3NDM1Nzc4NTMzNDc0NDM0NDI0NDU0NTg1NTQxNTU1Mjc1
MzQ1NDU1NDU1NDMzMzEzMjEyNTQ1NTUzNTQ0NDAvMDQzMjExMTMyNDQyMTM3NTU0NDIzNDc1NTMw
NDUxMzQzODc1NTg1NTM1NzIzMzM0NzU0NDIzODczNDI1NDI1Mzc3ODk5NDE0NTQ1NTQ1MzUzMjU1
NDM1NTIxMjMyNDU1NTM0MTQ1NTc1NDI0NDE1NDUxMDMyMDc1MzU1MjI0NDQyMDU1NTMzMjAxNDU1
OjQ0NTQxMDQzMzExNTU5MDEyMzU0MzU6NzU3NTQxMjQwMTc0NTUxNDQzNTIzNTU1NTM1MzM0NDc1
NTc1NTU0NTQ1NTk1MTg1NDU1OTg3NTk0ODU1NDc3NzQ1OTg3Nzc3NTgyMjI1ODczNTM3ODUzLzM1
NDQzNTM3NTU3NTU1NDI1MzQ1NTU1OTs0NTUwMTE1NTQyNDg6OjUzNTM1NzQ0NTg0NDQzNTgzNDc1
NTU1NDU1NTU1NDIzMzI1MzIxNTM1NTs6OjU0NTU1NTU1NTc5Nzk5NTM1MzQ1NTg1ODU1NTU3NzU4
NTQ1OTUzNDk0NTU0ODU1NDExMTU1ODg3ODk1NDU4NDE0OTU1ODUzOjQ4ODU3NTU0MjI0NDUzMjM1
MzI0NDQ3NTA0Nzg1NTExMDAyNTU3MSwuLC8rMDg1Nzo3Ojg3NTg6NzU5NzU3Ojg3Ojc7O0BCQj47
Ozo5ODU3OT4+Nzo6Nzo6OTs9PkBAQkNAQEE+Pj5AQT06OTk+Oz5DRT43NTo9Ozs+Pj5APj4+R0A9
PDo8QUdGSURMRzo6O0FANTUwLDQ4ODc9Oz1AQj45NTg7Rjw4OTszNTo5ODU0NzczNTc5NTg1Nzk5
NTU6NTg3ODc3NTk3NTU4Ozs5NTU1OTc3NTg1NTU1Ojg7OjU6ODc1PTo1NDc5NTk1OTk3ODU4Ojo5
Ojc5ODc4Nzw6ODg5NTg3ODc1Ozg3OTg3NTc1NTU5OTk5Ozc6OzU3Ojs4ODw+OTg7OTo4Ojs5ODc3
OTk4Oj05Nzk4OjQ1Ozk1ODk3Nzc3MzU3OTs4ODU1OTU5OTU4ODU3OzU5PDk6Ojo5Nzk7NzQ3Nzo6
NTc0NTQ3Ojg4OTc3NTU3NTc3NTc3Ojs5NDU0ODc5OTU4NTc4OTU1ODc1ODgzNTc6ODU3NTIzNDc3
NDc9ODg0NDM1NDUyMzE0MjQ0ODg0NDQ1Nzk3NTUzNTU1Mzc6NTU1NTc0MjU1NDU1NzcwMzQ1OTw3
MzMyMjM0OTQ4NTM1NzU1MjM1NTg1Nzo1MTc3MzI0NTg4NTU6Ojk5OTU1NTU3OTUyNTUzOTc1NDQ0
MjU1OTc1NTQzNTkzNTgzNTQzNzU1NTg1Mzw1NDQ1NTU1MzU1ODU0NTU3NTU1NTM1NDU3NTU1NDI1
NTQ0NDU3NTo1NTQ6ODg1MzI4Ozo1NTc3ODU0OTk1ODQ1NTk1NDQ3OTU1NTQzNDU3Nzk3NzU3NzQ4
OjU5NzA0NTM1NTcyNTU3NTk0NTU5Nzc3NTU0Nzk4ODU1OTo7Ojc1NTw1NDUzNDU1Nzk3Ojc3NTc0
NTU0NTkzNzg3MjU1Nzk3NDUzOzc0Nzc1Nzg4NTc1NTc6ODc5OTczNzs4Nzk5NzQ1ODU3PDo4Nzc4
PDs1NzQ1NTc4NTc1Nzg3NTM3NTg5ODI1OTk4NzU1OTo6Ozk3NzU1Nzo4OTs1Nzo7OjU5Ozc1NzU3
NTU4NDU9PTc4NzU4NzU1NzQ1NDQ4ODg6Ojg4NTU3ODU9Ojk6OTU1NDQzMzM1NTM3ODc1OTozNDU1
NTg1NTg1ODQyNTU4NTM1NTE1NzU3NzU1OTU0NTQ0NDQ3Ojk4NTk8OjU1ODk6Nzo4Ozc1OTU0ODg6
OTk6OTU1OTk7OTU3ODU3Nzc6Ozs4ODc5Oz05ODg9Ojg8Ojo6OTs8Pjs6Ozw7OTs5Nzc4Ozc4Ojo7
Ojk7Ojo9Pj4+PD49PTs+PD46PTs6OzxAPjs6Ojo7PTs9Pj06Ozo8Ozs6OD08PDs4Pjo6Oz06OTs9
PTw8Ojk5Pjw4OTs9PTo7PD07ODo7PT48OTg4Ojo9PTs4Ojo6O0BAPD09Ozw+Ojo7Ojo+PD49Ojk9
Pjg+Pjo6PTc6Oj0+PTo7PD07PD08QDs6PTw9Ojk7ODo4ODo9Ozg4Ozs+PTw4PUA9PTo8PD06OjxA
Pjs8Pj47Ojw+PT08PDg5PD0+Pjk7PD47OjlAOzw6Oz47PDo8NTE0MzQyMTQyMzU1MjU0LzMzMC8v
MzQ0MTIzNzU0MjMyMi8wNDM1NzUyNDQ0LzM1NDAzNDEyMDAxNTQxNDIzMTEyNDM0MjMxMjI1NTMz
MjExMjQxNDMyLzI0MTAwMjMyMjQxMTEyMzM1MzQxMzIyLzEzLzIyNDEyNTcyNDMxMDA1NTAvMzIy
MjI0MzU1NTUzMzQ0MjIxMjEyNTIwMzQyNDU0MDI3ODIxMDAwNTQzNTMyMzMyNDUzNzg1NTU0MjM1
NTczMjUxMTQ0NDU1NTU0MzUyMzQzMzIxMjMzNDczMjczMDIzNTM0MjI0NTIxLzQxMDE0MjExMzE0
MTQyMzU4NDU0MTc4NTQ3MzU3NTUxNTMxNTg4NTQ1NTc1NTU1NDUyNzU0MzM1NTk1NTU1Mzg4NDU1
Mzo1NTUzNTc4NTUyNDU1NzU4NTUyMDU1NTUzNTU1MjU1NTM1NDQ3OTg1NDQyNDUzMzU0NDM0MzUz
MjI1NTg1NTU1NzczMTIzMDE3ODMwMzM0NTA1NTgzMDIzMTg7NzIxMDU1MzQxNTMwMTEwMTM1Mzcz
MTI1NTM1NTU3ODIxMTk3NTU1NTcyMjU3NTE1NTU3ODc4MjM4NzcyMDIxMzI1NDg3MzI1NDE0Nzg1
MjEzNDU1NTc1NTMzNTQ1NTQ0NTMzMjExNTI1NDIzNDUzMzUxNDU1NDUzNDU1NTU7NTQ1Mi8vMjAx
NDI0MTM4MjA1MjE3NzEzMjQ0NTMwMjUzNDM0MTEyNTQ1NzU0NDM1MzczMS80NTAxNTU1My4wMTEw
LzI3NDEwMTUxMzExNzExNTUyMTM0NTEyNDIzNS8wMjU1NTQ1NDU0NDMzMjUxNDQxNTUzMzQwMzUz
MDU3NTo1NDQ1ODU0MTQ1NDQ1NzQ1NzU1NDg3MDUyNTUyNDU0NTg5Nzg0Nzc0MzU1NTU0Nzg4NDU1
MTU3MzU3NTc1Nzg1Nzc1NTMzNzU1NTUxMTU4NTI1NDU4NTM3Nzg4NDU1ODU1MjU0NTU3NTM4PDE0
NTU4NzU1MjU4NzcyNTIzNzs3ODUzOTUzNDUzMTM0NzQxMzg3MzE1NTc0NTU0MzQ1Ozg1OTgyNTU0
NTc6PDUzNDg1MjE0NTc0NTM1NTUwMjc0NTg3NDU3MzU1NTU3Nzg3MTI0MzU1NDQ3NTM0NTU1OTg1
NzU0MjI1NTEuLDAwMTExMTIzMzIsLy40Ozg5OTc5OTU0NTo4NDU1NTg7Ojk5Ozw5Oj4+Ozo7Nzo6
ODU5Ojo5Oj09ODk+QT5EQj1ERUJFQkA+Q0pHPkE+PkNGQkNCQUQ+OjlCR0ZCRENHQD5BOzs9PTxA
Q0lJR1BPPjxCRUU7NzcwNDQ1OTs5OT4+NzU7PT5APDk6Nzg1NDU1NTg1MjU4ODQ7Nzc1Nzk3NTg4
Nzg1NTc4Nzg1NTA1ODQ1NTQ4ODU5OTc1NDI0OTU1NTc6Nzk3NTg4NDc4NDQ3Nzg5NzU3ODg6OjQ1
Nzk6Nzo5Ojk5Ojc4NTg4NzU4NTc3Nzk4OTk5PDs4NTc6PTg1Nzs3ODk1Oj08OTg4NTo8PDk6OTg4
Nzg6NzU5ODc3OTU6OzU1ODg5OTw1Oj46NTQ1ODU4Nzk4ODk4OTc1NzU0MzU4Ojc4Oz06ODk5ODU1
NzU3NDQ3NTU8NTQ5OTU3NTU1MzQ3NTU5OTg7OjQ3NTk3NTc0NTU1NTQ3MzU1NTQ1NTIzNTExMjc4
OjU1NTU4ODU1OTU1MjEzNzc4NzkzMzU6NDMyNzg3NzM0OTk4NTIzODk4NTc0NzU5ODc1ODU0NzUz
NTU1Nzc1NTk3Nzo7NTc1NTc1NDQzNTo0Mzc3NTg1NzIuNTU4OTU4NTM0NDg4NTI1OTk1NTg5OTc4
NTU0NTc3NzQ1NzczNDU1Ojk5ODk3OTs4MzU3NzU4OTo1ODk1NTQ1NDU7NDU3NTQ1MTM1NTc1ODU0
ODU3MzU1NDQ5Ojk3NTc1NTc1NzU1NTU3NTQ1Nzc1NTQ3NDg3NTUyNTQ0NTg3NTQ1NzQ1NzQ0NTw7
ODg3NDM3NTQ0NTU5NTQ1NzUyNzk3NTk7ODU3NTc6NTo4NDc4NTU5ODU0Ojk6ODk4NTQzNTU5NTc3
NDM1Mjk4NDU1NzU1ODM1Nzg1NTU0MjU4OjQyNDg1NTo6Nzg1MjU1ODc3NTQyNTo3NDc6Ojc0NDg3
ODk4NzU1ODU1NzU1NTU1NTc3MzQ1NDU0NTk4OTg4ODQ4Nzo4NzU6PDk0ODo3NzQ3NTc4NTU3ODU1
NDU3NTg3NTg5NTU1MzE3NDQ1ODU6ODQ5OTc4NTM1NTU1NTU1NTk3ODc4NTU4NTQ5Nzc4NTc3NTU3
ODUzOTQyMzI1NTo5NTQ4ODg1NTQ1ODM0NzU3NDQ1NTU5NTUzNTc4Nzg5OTU4PDU5PTs5OTc0Ojo7
ODk1ODs9Nzo6OTg7ODs5ODo5ODo5ODo6OTs7Ozk7OTc8Pj49PTk5OTs7Pj49OTw8Ozs+Pjk5Oz04
ODw6PDo7PD4+OTs+Pjs5PDo8OTo8Ojs9PDw+Ojc5PkA9PDo1Oj04PT06OTs7Oz45PT07OTU4ODk5
PDo9Oz48Ozo6Ojs9PDw7Pj0+OTk4Nzw7Ozs6Ozw6OTw7OTg4OTs8PEA+Pj06PkI+Ozo7Ojs5PDw5
Oj49PD47Pj43OTo9Pj0+PT0+Oj5APDo6PDo8QTs8Pj09PD44OT09PkNBPDs6Oz5DPj4+Pjs9Pj49
Ozo7Ojs9PTw+PkE9PT0+PTk8Oj08PD4+Pj46Ozw6PDs0MjQxMDQ0NTIxMTUzNDIyNzczMi8zNTU1
MjEyMTIyLjQ0MzU3NDUzMTQ1MjIvMTMzNDMzNDQwLzUxMTAyNDAxNTAvMDI0MzUvMTQyMjIvLy4x
MzE1NDUzMDEzMzM0NTIzMzAyNTEzMi8vMzIzNTU3NTU3NTIuMDUyMzQyMTQ1LzMyMTAxLzQ0NDU3
NTUzMjMxMjcxNDM0MzU1NzQxMjU0LjM0NTIwNDQ0NDQ0NDcyNTUyNTMyNTM3NTMyNDMyMzIyNTU1
NzU1NTQyLDQ0NDU4MjI0ODU0MzQyMzA1ODk1MjQyMzU0MjAzNDU1MjM1NTc0MzIvMjc1Mzc1Nzo3
MzIzNTU0NTU1NTU1NTM3NTU1MjUzODUzNTU0NTQ1NTU0MzU1NTQ1ODQ1NTc1NDUvNzk4NTQxMDMx
NTU1MjUwNTU0NDM0NTg0MzQ4NTg0MzMyMjMzMjIyMDQ1NDU0MTIyMjU1NTs0OTgwMzQzNTQzNDcz
Mjc3MzIwNTU3OTk4NTU5NTUyMTM3MzQ1NTQ1MTQ3MjQ4NzQ1MzUxODk3NTc0MzAzNTM0NDQzMTQz
NzQ1NTg1NzIzNzk6NTM0MzcyNTg5NzI0NzU4OTQ0NTU3Ojg0NTc4NTMyMTU1MjU5NDQ1NTQ1ODc1
MjAzNDU1MzMzMjc3Nzc1MjU0MTU1NDU1MTI0NTQ1ODg0NTMzMjExMjIyMjE0ODc0MjA0MzMzMTIz
MzU1MDI0NTUxMTQ0MjI1NTMzNTE1ODc1NDQ1Mi4yMy8vMzU5NDQxMzUzNDM0Nzg4NTIzMjI1MjA0
Nzc4ODU3NTMxNTUuMTM0MzM1NTM1NTU0NTk0MjM3NTQyNzQzNTgxNDU0MjM1NTU1NTM1NDg4NDQz
NDM1NTk3MjI1ODQ0OjU1NTU1ODU4NTQ5OTc3ODU1ODU3NTc6OTc3OTc0NTU1Ojc1NDU0NTMyNTQy
MzQ1MjU3NTU4NDQ1MzQzNTQzMzUxMzc1NTk4NTUzODQzMTM1NDk4OTc3Nzo5ODU1OTo1NTczMjcz
NTg1NDU1NTQ1NzgzMzQzNzg1NDU3ODg0NTU0OTk1NTUzMDI0NTU1ODM0NTc4MTU1NTQzNTk1MjU5
OTk4ODU1ODU1NT01NTU0NTUyNTg1NDc3OTs1NTEzNzU1NTIyNDc3NTI0MzM5NzM1NDc3Nzo4NzU1
NzUzMDMwNDU1NDExLDIzMTMvMDg6NTc4Ojo5NTU4Nzg4NzU1Nzs3ODc3Pjs8QDw6Ojg4NTk6Ozk3
ODk8PkFFQD07PEE9PkFHUlBFPT5CQ0FBPj5GQ0NFRUFBRT46QEM+PT4+RkRAOzw7Oz49PEFHTFJL
SUtHQURAOTc3ODg4OkNDRT47OTk5OTo8PTk8Pjs5PDU0NTo6ODk0NDU1NDQ5Ojs4NTg5NTc1NTg1
Nzw1ODc4ODc1NTc6OTc5Nzs6NDU4NTo7OTc1Nzc0NTQ1NDc4OTk4OTU1NzU3Nzo6Ozo1NTo3NTo6
Ojk4ODlBOTk5OjU0NzU3NzU4Ozo3ODc1OTc3Mzg6NTg8Pjo5Nzg3Nzo5OzUzNTw6ODk6PDo6NzU5
ODg8PD0+NzI3NDU3ODs6ODU1NTc4OTQzNzk4Ozc1ODg6NTg1NTo6OTg7OTo3PDo5Ojo6OTc7ODg3
NTc1NTU1MzU1NzU3MzU4ODU4NzU5OTc1OTM0NTUzMzUyOT03NzQ1MjU1MjU1NTQ3NzU1ODU1NDc6
NTQ3NzUyNTQ1NTI0NDU1MTQ1NDU1MjI1NDQzMTQ1Ojk5NTM1Nzc0NTc5ODQ3NzU0NTQ3ODM5OTU0
MjQ1NDI1NTc1NTg6NTEyNTk4NTM1NTU1NDk6NTQ1Nzc0ODU3NzU0NDQ1NTg5OTc1MzU1NDc5Ojg4
OTk4OTU1NTc3NTUxNTk3NTU0Nzk8NTQ1NTUyMzM1ODk1NzU1NTU1NDQ1Ojk0MzQ3NDk4NzQ0Nzg1
MTM3NzU1NTc1NTk1NTU0MzM1NDU1MzU3NzU0MzU4OTg5NzQzMzEzMjU3NDU1NTI1NDI0NDQzNTU1
NzU1MzU1NTg1ODc3NTU0ODQzNTU1MzQ1NDUzNTU3NTU1NTs0LzM4NzU1NzU1ODg1NTU1Nzg4NDQ1
OTc1ODgzNDc0Mjc5OzU1ODg1NTMyMzU3NTQ3NzU3NDg4ODk4NTU1NTg6NzU1NzMyMzU3NTQ5OTU0
ODU4NDQ1NTI0NTg6NzQ4Nzk1Ojo0NTc1OTk1NDQzMzU1NTM6NTM1NTU5ODc1NTU0OTUzNTc4NTU3
NTc3OTkzNTg7NTU1NTI0NDU3NTg1Mzg3Nzg1MDM1NTU3OzczMzM1Mzc4NzUzNTU0MzUxNTUyMDEw
MDQ0ODo1NzM0Nzc5OjU0NzQzNzc3NTU1OTc0Nzo0NTQ1NTU1NzQ0Nzg1Nzk4NTc4Nzs6OjU1NzU5
Ojo3NzQ3Nzo5ODk4NTo8OTw6Ozs6PDs8PDU8Ojo6Oz06Ozo6Ojo9ODk8Ojo5PTo7Ozs4O0E8Ozw8
Ozk4Ojw5PD48Pjw6Pjw1PD49OjQ6PTs6PDo5PT4+OTw9Ozk8PUA9Pjw6Pj49Pjw7PTo8Ozo9Pj49
PD47Ojo9Ozo8Ozc7PkA9Ozw+OkA8OTw8ODc6PTw7PjxAQDw+QT47OT4+OTs7OTo4NTw8Pjw7Ojs8
PTo9PD5APjo5OTo6Oz4+PjtAQD4+Ojs8Ojw9OT09PT4+PTw8PD5APj0+PT5APj4+QEA6ODg6Pj47
Oz09Pjs8O0A6OkM+Pj49PkA8QEE7PT09PDs9OjMxMTQ0MzUyODU1MTIyMjI1NTE0MjMzNTIzMzEy
LzM0NTQ0MDUyMDQzNTUyMTM0NDM0MjE1MzAvMTAvLzQ0MzQyMTIzMTM0MS8yMy8yMjIxMzEyNDUx
MjUzLjI4NTIzNTMwMTIxMzIxMjU3NTI1MDE0NDIxMDE0MS8zMjMzMTE3MjUzNTU1NDU1MzIyMzI0
NTUyMjU1NC4xMTAxLzA0MjEyMjU1MzQ1NDMyLzA1NDk0MjMyMCwxLy4xMjUzNDQ0NDU0MDEyMTQ1
MzM0MC8xNDUxLjcyNTUyMzI1OjU1NDAvLDM1MzEyNDc4MDA1NTUzNDI1NTIyMzM0NTU3NTU1NDIz
NDUyNTQyNDU0NTExMjQyMTQzNTc0NDc4NTc3MjE3Nzg1ODUzNTUzNTU1MzU1MTM3Nzo6NTIzODQ0
ODU0NTMzNTU1OTQyNTg0NTQyMzUxMjU1NDU1NTU1NTU0NTUzMjM1MzQzMzc1NTUyNDU0NzU1MjM1
NzMyMjQxMjU0MjQ1NDQ1NzU0MzU1NTcxNDcxNTU1NTI0NTIzMzM1NDU1Mzc1NTIzNTQyLzIyMTUz
MjI1NTU1NTMwMzAzNTQ1NTk1MjEyMS40NzMyMTEzNTc3NTI0NTIzMTM3NTU1NTM3Ozo1MzQzNDg1
NTUwMTMyMzU1MzU1NTc1MzIyNTQ0NTU0MjQxMTUzMjExMjMzMDM1NDU0NzQyNDAwMzM0MTU1MjMx
MzAzMTIxMTI1MzAwNDU3NzQyNTk5NTIyMzA0NDIsMTU5NDQ1MjI0LzA1MjIxMjQ1NTQzMjU3MjEz
NTc1NTQ1MjI1MjU3MzEzNDU1MDExMjQ0NTUyODk1NTQzNDU4NC8xNTU1Nzc4MzMzNTUzMjI1ODI0
NzU1MzQyNTU0NzEzNDM0NTg0MzU3NTM3NTM3ODcyMTU0NzU4NzU4ODU7Ojc5ODQyMzM3NTc1ODU0
NTU4MzMxMzk3MzU3Nzc1ODg3NTU3NDQ1NTU1NDQ0MzMyNDU3NTkzMTM0NDQyNzQ0NTI1ODg1NTU4
NDUyNTQ0MzU4ODk6NTM0NDc1ODU1NTM1ODU4OTU1MjU0NTU1NDU1ODo7ODc1NDQ1NDIyMzEzMzU4
NTU4NDM1ODUwMjc1Ozo4NTg6OjgzMzUzMzU0NDc3NDU0NDQ0Nzc5NTQ3OTQ0MDM1Mzc1NDI1NzUu
MDI0MTI1MzMyNTIyMzMxNDUwMzQ1NTc9OjU4NTc1NTg5Ojg5OT05PDo6Q0Q7Nzg7Ozw8Ojs7Ozw3
PkNFRD4+QkA+QElcXklAOjk9QD0+QT49PD5GRD5BQ0dHQj5BPUJAOztAQDs7QkNBQUlTT09JTEdF
QkE7NzU6OztFTkxFPj1AOTQ0Oj5APDo7Nzs8NzcyMzU3NzQ0NTc1NTc0MjUyMzU6Ojk5NzU0NTM0
NTU3NTU3Ozs6Nzc4NTk6OTc3OTg+Ozk1ODc6NzQ3NTc5Nzc1NTc4NTU7Ozk3MzU0NTg0ODo9Ojg5
NzU7Ojg3ODk5Ojk4NDc0OTo+PTs1Ojc7Ojo5NTo7PTo1OTk4NDM1ODc6OTU0ODg6PkNDQUBCPkFH
RkpGPjs1NDU3NTg0NTc7ODk5OTk3OTc3OTg5PDg1NTU0Nzc3Nzo1Nzg5ODg7Ojs1Mzc4Ojg4NDU3
NTU0NTc0Nzk3NTU1Nzk4Ozg4Nzc1NTU1NTQ1ODg3MzUyNTMzNTc7Nzg1NTc3NTU3MzU1NDc1NDIz
NzM1NzQzMzU1ODQzMzU1ODk0ODg1OjUzNTc5NDIzNTM1NTU0ODU1NTQ1NTg5NDU3NzEyMDg1NTU0
NTc3NDU0NTU1NDU1Nzk6ODg7OTU7OTU1NTU4NTw5NTQ3MzI1NTU5NzUzNDU1NzUzNTk1NDc1ODU5
NTo1MTQ4NTc1ODgzMjU3NDQ3NTU1MzE0NTU1Nzc1NzcyNTQ3NTs1MzI1ODc6NTEyNTM3NTczNTg4
MzM3NTU4ODc0NTk1NzQ0NTUzNzg1NTQ3MzQ1NTUzNzUyNDQ1NzUzNTU4OTk6OTo7Ojo8Ozk6Nzg7
Oz03NDU4NTQ5NTU0NDU4NDQ3NTc1NTc4NDU5NTMzNDI0NTU0NTQ1NTc4OjU1ODtAOzU0NTc5Ojg5
NTg5ODc4PDw8Nzk1Nzc1Nzg1NTU7PDU1NzU3NTc6Ozo4NTk4NTU6Nzo7PTk3MzQ1Nzg5NTU5NDU5
Nzk3NDM1Nzo1NTc1NTc4NTg3NDU3OTg4Nzc3Nzc1MjM1ODg3NTU1NTU4NDc1NzUyNDU1NTU1NTU1
NTU4NTU1MzQ1NTc7PDo1NTQzNTIwNTM1NzU0NzUyNTg1MzU0NDUyNDU1NTUyMDU1MzU1NTU1MzU1
ODU1NDM0NDU1NTc3NTU1NTU8Oz01MzU1NT08OTczNDc3NTk1ODk4NzU1Nzg8PDo4Nzo4ODU1Ojs+
ODc4Ojg4OTg7OjU5PDo8QTs7PDU7PD4+Oj5AQD07PTs6Ojs6OTk7Ojo9Ozo6Nzs8PT48Ojs8PD09
PTs6Oz48PT0+QD45Ozw6Oz46NTg7Ozw9PTw6PD49Pjk4OTs9Ozs7OTs8PTxAQDs5Ojo9Ojs6Nzw8
PDk8OTg6PDo8QD48PTs+Ozs6Oj07PDw9PD07OTg9Pjw8OT06OD49Ozw7Ojw9Pjo+Pj08Ozo8Pjs6
OT07ODg6OT5AOzk8Ojw+Ojo7Ozo+Ozk6PDw5OTk8PDs+QT48PDo7PDw+PT48PDo8Pj4+Pj49Oj0+
PjxAPjs9Pjw8PD09PTw+PDw9Oj4+PD5AMTU3NTk4OTg1MjM0NzIyNDIyMjM1NTQ0LzUyNDQ0MzIv
MDM0MzQzMzQwLjM0MzI0MTIxMzIzMTQ0NTIyMzQyMi8wMzM0NDEuMTU1NTIyNTQvMzU1NTU1NTU3
MzExMTU3NTMwMDM1NTUyMjEwMDM1NTU1MzI0MjQ1NzE0NC4zMzUyNDU3NTM0Mzk1NDIxNDQ0NTMx
MTQyNDM0NTM0MTMzNDU0LyowMDIzNTUyMi80MzQzNTUxNTM0MTU5ODUzMzA0MjIzODgzMzIwLzI0
NzU1NTQ1MzIwNDQzMy8xMTU1NzQ0NDM1MjIyNTU3NTQyMTM0MzIzMzI1NTQzNDAzMzU1MzIxMTE0
MzUyNDMzMDU6NTczNTQzMzQ1NTIyNzU0NDUzNTc3ODUxNTQyMjEzNDU0NDIxMTQ4NTU1NDQ1NTc6
ODM1NDM1NTU0NTU3NTU3NTU4MzM1NTM1NzkyNDU5NDMzNTU1NTAzNDUzNTQzNTc4NDQ1MjMyMjM1
NTMzNTUyMTMzNTMzNTU1ODU1MzU4NDc3MjIzNzk1NTc3NTU1MTUxNDQ0NTI0NzMzMjE1NTc3ODU1
NTUzMzMyNDU0NTIwMzQxNTM3NTQyMzMxNTU3NDI3NTMxMzAzNDU3NTM3NTMyMzU3NTc1NTQ1NTI0
NDU1OTU3NDc1NzQ0MzU3NTQ3NzU3NTEwMS80NTQxNTUyLjIzMzUzNDc0MTI1MzMyNDMzMzc1MjQy
NDUxLzEwMTIzLzU1MzIwNTUyMDIzMC8zNTM0MzQ4NDMxMTQ1NzM0NTQ1NzQ1NTc1MzM0NDMzMjMz
NTEwMTQzNzU1MzM0NzEzNzM0NzQzMy8yNDs1MTMzNDU3NTgxMjUzNTUzMDI0NTU1NDQ3MzQ0NTQ4
NTMzNDQ4MzQzNDIzNS8zODQ0ODQzNzI4OjM0NTU3NTQ1NTQ4NTU1NTEzNTMxNDg3MjE4ODg1MjU1
ODU3OTMyMjc1NDQzNDI1Nzg1MjU0NTU3NTU5NS4xNDUyMzcyMzUzNTgxNDc5NTc1NTU1MjQ1MzU1
NTU1NzU4NzQ1NTs1MjI4NTQ5OTUzNTg0NTU5NDE1OTMyNDU4MzQ1NTU4ODU4NDU4NDU1NzU1Mzc1
ODk1NTc1MjIwNDc1NTMxLzI0ODQ1ODQ1ODQ1NTUzMzU6NTU1MjM1NDU1NDU3Ojg4Mzg1NDAxMDIw
NDEwNDU4Pjo1MTI1NDExNDEzNTk8OTU3OTo1NTU1Nzc3PT5AOz07Pj47Ojw5Ojo8Oj49PDs8PkVG
Pj5FQDxCTFBNQT49OTk6OT4+PkBEQTw7PkA+QENAQD4+Pj4+Oz0+PkBFQz5BSU9QUlNLQz09Qz46
OUFAQ0ZKQz0+Pj06NTg9PUA5NTk6ODk1NzQ1NzUyNTk3NTU1OTk3NTg5OTU0NTU6Ozg5NzU4NzM0
Ozc1NzU1Nzs5NTg5Ojk1ODU1NT08ODU5Ojo4Ojo5OTk4Ojo5NDQ0NTk6Nzo1NDc0NzU1NTc0OTo5
ODk3OTc1Nzs4Oj07NTU3ODk0Nzw4ODo7Ozg6Ojg9Ozk3Nzk6NzU0MzpBRUZLSkdKR0ZFR0pKSkdH
SUI3NDUyMjU0NTk8ODg1NDU6PDU1NDU4OTc4NzM1Ozg3OjpBQj4+QD4+PT1JTkdMUEdHNzQ1MzM0
NTQ3NTc1MzU1NTc1NTU0Mjo6NTU0NTUzNTk6NTU1MzUxNDU4ODcxNTg3NzQ3ODUyNTIwMzU1NTU4
NTQ0NTU1NzU1MzM4ODMzMjQ0NTU1NDU3NTgzNDM0ODg1ODU3NzI0ODU1MjIzNTU1Nzk5NzI0NDI3
NzU1NzczMjc3NDU1OTo1NDxKPjk6PENBPD1CPjk1NTU0NTUzMzI6OzQxODUyMzQ7ODU0NTg1NzU5
NzU6OTg4NTQyMjQ4Ojk1MzE1ODg1Nzk4NDU0NTU5NTQ0NTU1NDU4NTU4NzQyMzMzMjM5ODk5NTQx
NzUzNTU3NDc7NzU1NTc3NDU1NDE1NTU1NDQzNzUzMzU1OUA9PkZNRkdJSUpKRUNHR0xHPEFHSUZD
QTs1NTU0MzU4NTU5ODMyNTg1ODo0MzU1NTUyNTo4ODgzMzw1NTc1NTUzODk4NTU1ODMwMDU1NTU3
Ojg0NTU1NTo4NDU1NDM3ODc4OTUzNDQ3NTk5PDc3NTM3Nzg9Ojg3NzQ1NTU1Nzg0NTo1ODU3Nzg5
OTc5NTU1NTg5ODU1ODc0PTU1NTk3NTk7OTc1NTU1NTQ1OTk1MjU5OTc5NTQyNDQ3NTs5NDc6Ojc4
OjU3NTQzNDc3Nzk1NzU0MjQ1MzAyNTU3NDM0NTQxNTM0MjU1NDQyNDMxMjU1MDAyODczMjU3NTU1
NTg1OTczMTM1Mzc7ODU1NTM1MzE0NTU3NTg1MjU3ODc1NTg6ODo1NDI1OTw1NTM4OTo3NDc4PTU0
OTg4OTg8OTU6ODU3Ozc4OTo8OTw4OTk6ODc5PDk4OD05OT08Ojk4Nz0+PDs8Ozs5ODs9PDo3Ozw6
OT49Oz4+PDw7Ojw5PTo9Ojk+Ozk5Ojk8Ozo7PDw7Ojk+PTs5Nzg4Pjs6Ojw8PDs8Oj08ODU5PTxA
PDo7Ozs4Oz03ODg4Ojo5PDs5PDw6Ozo7PD48ODs6ODo+Pjo4Ozs6PTo5OTg5PEA7OTk3Ojk8OTc5
PTw7PT48Ozw4PD4+Qjs1Oz47PTs4OTw6Ozw9Nzg7Pj05Ozo+Ojs+QD47PTw8Pj46Oj48PEA+PTw8
PTs7QUA9PD49PTw7Ozw+Qjw+Pj0xMS81OjU0MzUwMDMwMjAxMTA0NDIyMzQ0NTUxMTMyMjIvMTMy
NDM4MTIzLjQ1MTQyNDMzMzIzNDQzNC8xLzAuMjMzMDA0MzMvMTI0LzMwLDA1MzM0MjIwMDQzNDUx
LzI1NTQzMzIyMzU1NTc1MjE0MDI1NTUzLzMyNDUwMzQxMjAwMzU1MjIwMDQ0NDQ1MzMvMjU1MTE0
NDQ1NDU0NTMxMTA0NTU0MDE1NTcyMTA1MzM0MTI0NTQyLzAyMTE0MjQ0MTM1MjEyMjM0MTM1ODQx
NDMwMjM1MzU3NTAxMzI0MjMzNDMzMTI1NzczMTM1NTgxMTU0MDMuMjAwNDQwMDAyNDU0LzAwMjU3
OTI1NTMzMjU1MzIwMzI0NTU1MzA0MzIxMjU3NDc1MjAyNTU0LzIzMTM1NTQ1NTUzMDQ0MjU0NDU1
ODM0NDIzNDIzNTUzMzQyMjc1NTU1NTEvMzc1NzU6ODgzNTQzMzIyNTIzNTc5ODE0NDU1NzU1MzM0
NDM4NTUzNTg1NTM5ODU0NTQzMzU0NTc4NTQyNTQ1NTc5NTc0MzQ1NTM0NTU4NS81ODU1ODo1NDQ1
MjUxNDU1NDM1NTQxMzU4OjozMTIvMjQ1OTM0NzU1NTI1NTIzNTQ0NTEyMjM1NDI3ODQ0MzIzMjU0
NTU1ODQzNDU3OTU1Nzg4NDU0NDM1NTMyMzU1NDQ1NTc3MzU3NTU1NDEyLzI0MzM3MjU1NDU0NTMz
MjU3MjIxNTU1NDAyLzQ1MjM1ODc3MzQzNTQ0NTk3NTU1MzI0NTE0NDMvMTMzMjIwMjE1NTQzMjM0
MzM1MzM1ODk4NDMzNDIxNTM0NDc1MDU1NzU1OTIzNDMzNDU1Nzg4NTU1NDU1NTU0NzU1NzM1NTM1
NTUzNDQzNDUyMjE1NDQ0NTU1NzU1NDc1NTU1ODU0MjI1ODc0NTUvNDg0MjQyNTczMzQ3NDIyMzU3
Nzc3NzU6Ojc0NDM1NTQxMTEzNzgzMzU0NTQ0NTc1NTM1NDMyMzQ0ODMzNTU1NTg3NTcxMzc0NDU1
NDM1NTc1NTc1MjAxNDg1NTU1NDQzNTc4Nzk1MjU1ODg3NDQ3NTU3NTU1NzU3ODU1NTUzNTUyMzUz
MS40NTA0NDU4NTU3NTc1NTczNzUzNDU1NzMxNTU1NTg0NDQ0NDU3Ozg3NzcwLzEzMDAvLzAxMzI1
NTxBQDk3MjU3NDUwMDI3NDk7MzI1NTg7Nzg5Ojg5PTk+PD49Oj46Oz06Ozw8Ojo9PT5CRUZCQEBB
S0tHQD09Ozk6PDs9OTg5Oj5CQEA+PEBBQTw8Pj0+Pjs9QkJGREA+RkJFTVJNTUtDPjg7QDg6PEJC
RkZCPT48Oj09Nzc8OT44NTc9NzU0MjU1MzU5NzU1Nzo1NTU0NTM1NTU1NzU4OTg7Ojo1NDU1NDk7
PDs6ODg4NDQ4Nzs6NTg4NTg7OTk1ODg6Ojc5Ojk3NDg+OTU0NTk4NTc5ODg5NTg4NTUyNzs4NzU1
Ojg5Ojk4Ojk1NTs6OTUzNTU6OzM6OTc6PDs9QERCPjk3ODhDTU5NTE9QRkdMSUdHTlBJREdNUEs5
NzQ1NTU1NTI0Nzc1PDc5OTg3NTMzODk3NTU4OURPWWJnXlldYl1YWWFlWFRZWFtWRDo6OTc0NDU1
NzQ3NDEyMzU1NDU1NDQ1ODQwMzQ1NTQ3NTU1NzU3ODMyNTU0NTg1NDU4NTUxNDI1NTM6Oj07OzU1
OTg1MjEzNTg1MjQ1OTU3PkNDPjc1ODUyNTU1NzMwNTc3NTQ3Nzg0NTU1MjU4NTUyNTU0OjU4NTk1
NTg3ODk3OTU4OTc3RlZKR0JEQkJEQ0NFQz0zMzc3Oz48Pj4+OzUzMzQxMjU3ODUzNDc4NTU5Ojs7
NzQ1NTU1ODU1NTc3ODU1NTU1NTQ3NTk3NTQzNzg3NTU6NDM0NzI0NTc4ODc1NzUzNDU1NTk1Nzcz
NTU0MzU4OTUzMjE1NzU1MjQ1ODU1MTQ4ODgzMzU9UEdLSktGSkZJTExKSkpERkRGSk9QTE5WR0U8
OTg4ODg3NTQ1ODg0Mjg4NTc3RD41MzQ7NzQzOTUzMzU4NzU4ODU1ODU3NTg5OTk0NTU1Nzo1NTc1
ODU3OTc1NTQ3PT07MzQ1NzU4Nzg1NTg6NTU3OjU6Ojc1Nzc5OTs4NDk6Ozo6Ojo5OTs5Nzc1NTM4
PDs3ODU5OjU3OTo3Ojk4OTczNTU4PDo5NTUzMjU3NTc5NTc5Nzg1NTg4ODk4Nzc1NzI1NTQ1NT04
OjQyNTU0Nzk1NzMyMDEyMzUzMjExMTAwMjM0MjMyMDUyMzUyMDIzMTEzMTAxNTUzMzQ1ODUyMzQz
MzEzOTo1MjU0NTQzNzU4NzU0ODg1NTU3NTo4NTU4NTU1MzQ4PTk1OTo4Oj04Ojk4Ozc8PDg5PTc5
NTc5NTc7PDg9Pjo1PDw8Oz5APj45OTw8PDw8OTw9PTs9Pj07PDw6Ozs8Oz5BPDk8PDk+PD07PTs+
Ozo9Ozw8PDs7Nzk1OTw9OT48PT0+Ozw8ODw+OTo7Qj45ODo+PDo9PT48Oz4+Ozo5Ozw+PD09Oz4+
Ojs7OzxBPj03Ozs8Pj48OTk8Pj4+PTk4Pj46NTc7Pj07ODk5Oz0+PkE9PD0+Ozg7OTk9PDo8Ojk4
OTo+Pjw6PD08Ojo7Ozs6PDw+QT0+Pjw9Pjw9PkA9ODo7Oj47Oj48Ojw9QUBBPjs8Pj49Oz4+Ojs7
PT48Ojo9PDo9Pj1AQD08ODIyMTMyMDMxMTAzMjM4NTQ4MjI0MzQxLzI3NTMwLzMyMTUzMTAyMC4y
LzAzMTEzMzIzNTQwMTIxLjAvNDEyNTIxMTMwMDIxMzMzMTEzMTAxMDQxMTA0NDMzMTMvMDM0NTQ1
MzAwNDMxMjMzNDM1NDE1NTcxMTEyNTMyMzUvMDQ1NTQ0NTc1MzU1MjAwMzI0ODIzNzQ1NTM3NDAz
NDQzMjMwMjQ1MjM1MS4yMzU4NDM1NDU0NDEzMzU1NDEwMDIwMTAyLzI0NTcyLzQvMzIyNDc0NDIw
MS8xMzUxMjQ0MzM1MywyNzkyLzM1NDMxNDM1NTAyMjUyMjM1NDExMTMzNTM3NDU3NzQ0Mzc1NTQ0
NTQxMDIzNDIzNTQ3NTQxMzUzNTU4Ojo4NTI0MzM0NDUzNTQ1MjQwLi80NTA0MTU1MTE0MzU3NTU4
NTU5NTU1NTI0NTU1MjQzNTU1NTc3NTEzOTUzMzU3NTg6NTUyNTMzODU1OjkzNTo6MzI0NDU0NDU3
ODM0NTU1NTM1ODU1MzUxMzU1NTM1MzM1MzUzNDM0NTg3MjUzMTU1NTUzNDczMzExMDEzMzU1NDEz
NzMyMzM1NTM1NDU1NTcyMS8zNDU1NDM3OTg3NTU0NTU0Nzg1NTQyMzA0MDE0MzM3NzU3NDMzMTI3
MTQxMzU4NDU3NTQxMjQ1NS81NTI1NTIzNDIyMjc4NzQyMDAyNTUyMjIvNTMxNDc1NTQzNDU4NTMx
Mzc0MDUxNDczNDUzNDQ0MjI1MzIzNTQ1MzQzMjAzMzQyMTc3NDQ1OTgyMywzNzU1NTQwMDc1NTMy
MzMxNTMzNTM1NTU1NTQ0MDQzNTg1NDM3MjE0MzQzNDExMTI1OTc4Ojo1NzcyNTs3NzUyMjQ0NTQ1
NTU1Nzc1NTg1Nzs3NTM0NDU1Ojk3NDc3NTMzNzU3NzU1NDU0NzU1MzM0Nzc1NDU4NTg8OTU1NTU1
NTU0NTM4NTk5NzQ1ODc5ODIzNTQ0NTU3NzU0NTU1NTs1NDU1NTg1ODU1NTU1Nzk0ODc0Nzk0NTQy
NTc1NTMzNTM1OTU1ODg1NzM0OTU0MzIzNTU1MjIzMTI0MzQ3NDM1MjI1NTU1NTc4NDMvMzc1NDg3
MzQ0MzM4NTg1NDMyMzQ3NTc1NDU1NTcwNTc3Nzc1NzU0NDQ1NTgzMjMxLDAsLi4vMiwvNDU1ODw7
OTg5NTExNTo5NzM0NTk1NTg4OTo8ODs0Nzo5Ojw+QEZBOz0+Pj48Ojo9Oz0+QUFBRUtGR0dLRkJB
PDw+PDg8OTs9ODo+REM+PD4+PTw+Pjw4OT1CRUZLR0ZFQ0BBPkNNTklHSUI6OTxEQzs9RkZGS0dE
QEFCQDo5Ozs5OTs6Ojw3MTQ1NDc3NzU3NzQ1ODM4PTk1NTU1NTIyNTc3NTU4OTU1Ojo7NTg5ODU5
NTc3NDk3NDU4NTU5PT48Ozo8NTo7Ozg4ODo4Nzg3NTg5ODc3OTs3NzU4Ojc1MzczNTk5Nzg5NzM1
ODk7PTs7ODo6Ozg8OTg6PTs7QD5BQkNFQUpOQT5KZ1lPT0xKTk5LTlROTlBQVUxJSk5MTUpAOTQ1
NTQyNTc3Ojk3NDc1NTg3NTc1NTU3NT1MZ3F0cmdoaWJpbmZdXGJhXV5fVVlcUExLRDw1ODc0MzU1
Nzo4NTI1NTU0NTg4OTs4NDU1MjM5ODIyNDM1NTg6NzMzNTo6NTU1OTU1NTIzNDVUeXhQNS8yLzM4
NzUyMTA1NTc5Pj5BQ0xJQDcyMzQzNTU5NzU4NzIzNTEzNDU0ODk3NTU0MjdAQD43NTQzMzU0NzU3
ODMzNTU4QEVJR0dHSUdGSkdGSUdER0BCQUBESkdJREQ+Ojo5NTQ1NTg3NTQyNTc7QkA+QEBCRD41
NDIzMzI1NTk3NTMsNTQ1MTI0MzQ0NTU1NTg0Mjc3NTU1NTU0NDMyNDM3OTs7OTs5OTo4NzczNzIz
MDQ5ODg1NTc4NTM0NTQ1NTU5NzU0Nzg5O0RNS2hQRkVKR05QR0pHRUdGRUNHR0dHR0pER0ZGPjo3
NTU6NTc4NDg6Oz5FPjtHR0E7Ojo3NTU0Ojg3NTU0NDQ3NTc1OjU3OTQ1ODczNTg3ODU1MjU9ODk1
NTU0Mzc3MzQ1NzU1NDc5PDk1MjU1Nzc4Nzg4NTU4NzU3Ojc1ODc4NzU1NTg1NTg3MzU6NTg3NDc4
NTU3Nzg4Ojg4ODQ1Nzk3NDc3OzkzMjIzNTc1ODU3NDc1Nzc3Ojg0NTU3ODU6ODU1NDg3NTU4Ojc1
ODg0NDQwMTEwMTIzLzMvMSwwMiwvMDMzMDAwLi8qLC8yLiwuLC4sLzEyMDM1MzE0NDI1OTU1NDU1
NTM5NDM1NTUzNDM1ODk1ODg3Nzg1NzU5Nzk6Ozg3Ojs5ODU4Ojo3Ojo5OTU5Ojg6OTg1OTg1PDw4
Ozk6ODc3ODo8ODc+Pjk4NzU6Ojo7PTo6OTs7PDo+QDw8Ozc5OTo8Nzk9QT45Nzo6Ojk8PT46Ozo6
PT0+PT45Ojg7Pj5BPjw8Ojs+PDw+PTw9PT09Ojw+Oj4+PD06Pj07PDw+Qj49PD07Ozs6PT07PkA7
OkE7Pj0+Oj08PkE+PjxAPjw+PT49QT49PDo+Oj4+Pj1APT5BOjo8Ojk6PDw9Ozo7PT4+Pjw6Oz4+
Pj1BPT4+Ojk8OTk1Ozo6Ojs6Oz1BPjw4Oz1CPjo7Ojs+QURFQj0+Pjw9PD48Oj07OT09Ozs6Nzs6
Oz49Pjs+PD08PTw9MjIyMi80NTQ0NTIsMTUvNDc1MzIzMS8zODQzNDAyNTQ0NTM1NTIxNDM0NzIz
MzEyMjIxMjUxMDAxMTM1NTEuMzIyMzMwMTMyLzEwMC4uLzM1NTEyMzQzNDMzMzQyMzIyNDMzMjE1
NTQ0MTIyMzAxOTMuMTQyMDAyMDAwMjIyNDU0MjIyMTQ0MTI0MjQxNzUyMzMxLjAyMzEwMDQzMDAx
MDIyMzE1NTU1MjU1MzQ1NDMzMjE1NTM1NDE0MzE3NTQ1MzI0MTUyMDQ1NzU0NTMzMTMxLzIyMTA1
NDIyMjMzMjIzMjIxMDI3NDIvMTU5NzIzMzU1NTIyNzU0NDU1NzU1MzAyNTUxLy81NDQ0NDUyMjAy
NTU1MzU1NDEzMzU3NTM1NDQ4NTc1NTg1NDU0NDU1NTU4NDU1OTg1Nzk4Nzc1MzQ1NTg5OTc0MzM1
NDMyNDUzMjUzMjQ0NTUyNTc1Nzc1NzUyMzE1NTQ1MzM1MTA0NTM0NTM1NDQ0ODUzMTM1NDU0NzQ0
NTMzNTU1MjI1NTQ1NDU1MzQ0NTc3NTMyNTM1MzU1NTU5NTIzNTQ3ODU5NDUyMzk3NTU1MzI0NzQ1
NTU3NzU1MzU1MTE3MzI1OTU3NTU1MzM0MzQ1ODk1MzQ0NTIyMTQ1NDU4NTU1NDM3MTQ4NTQ1NDQ4
NTIyNTU0NTQ0NTc1MTQ0NTc1NzQzNTU1MzMyNTQzLzM0NTMvMDQ1NDM0MzU1MTAxMjI3NTM0MzEx
MDIxNzIxMTU1NDU0MjUzMjM4OjUzNTM0NTI1MzIxMzQzNTUyMjI1MjA1NDQ1NTMxNTU3NDU0NDUz
MzczNDc4NzM1NTM0Nzg1NTU5NTU0NDQyODU0NzU1Mjc0NDU4ODU1NTQzNDQ1NzU0Mzc1NDU1NzU1
ODs5NTU3MjU0Nzg3NDA1OTk1NTU3Nzg6ODU1ODc0NTk1NzUyNTUyODQ0ODg4OTcyNTU1NzU1NDc3
NTQ1NTI3NTUvMTU1NzQ0NTU3ODc1NTk6ODg5NTU4ODw3NzczMjU3NDM0NTU4Mzk4NDM1NDU5OTI0
NTI1Nzc4MzM4NTg0NDU0Mzg7NTM3OjU1MzQ1NDI0NDQ1NTg5OTc3Nzc1NDczMzU0NTU1Nzc1MjM3
Nzc1OjUzNDUzNTU1NTk1OTc1ODg1MzU1NTQ1MzMxMjUzNTU0MjMzMSwvLC8wMTM0NTg7OTs9PDw3
MDE1NzU0Ojo9OTk3OTs6ODc3Ojk6ODw+Qj49Pj47PT5DQkBBPj48PD4+Oz5FSUdERkM9Q0I+QT49
Pjw9Oz1APkBBQT4+QD48Pjw6Oj07PkZGR0JDQjw8PkFGRERHR0VCRDw5O0JMQT5ES0pLRUNDQUM+
QUVCOTc6ODo9Qj03OTczNDU0NTU1ODg1NTU1NTg1NTM1OjozNTczNTQyNTUzNDU3ODc3NzU3NTU1
ODM0ODg1NDk5NDg4NTQ3ODU0NTU3OTg1NTU5ODU4NzQ6NzU4ODo3ODk3ODU3OTc1OTg4Ojk1NDc6
OjtAPT5CREVARUdHR0xYV1hHQUdMTEdCVmtlUFBPUFZXUFRXWVZUTVBVT1NNTExNUEo8NzlGPjk6
NzU5NTg6Nzk4NDUyNDk3Oj09XXh3cGtqbWppa2pqdmlfYGReXmFhXF1daGFNTUQ9ODM0NTU1NzU1
Nzk5PD1CRzw3NTU1NzU0NTQ0ODU0NTU1NTc3NDQ1ODk+OTs9Ojs5ODg7SobOzos+KSwxNTU1ODc3
NTM1ODlDR0BDQENHPDU1NTM3ODM1MzU5OTU1PDw+O0BNRktCPTo8PUVHUFRHODc4OTUzNTw+SVNG
R01OTElMRkdJSUpJSkdJTE5NYmZUTk9LT09PUlBSSUM7NTk3NTQwMzU4PUlFREJDQUNFXU81NTU3
OTg4OTg1NDA1NzM1NzU4NTM1NTc0NDQ0NzU1OjU0Nzc6MzQ1ODU4PT0+PT4+PkFCPjk1ODQ4NTI5
ODg4NTU4OTU3OTc1NTQ0Mjg4OTpBSldNXU5GTUlHS0dFR0pHSkdHR0dGRUlKSUZJRk1MRDw1NTU4
NzU5Ql9ZQkQ9QUZGOjg5ODg4OTo3ODo6Nzg1OTgzMzs5NDk3ODc6OTs4NTU1NTk3NTU0NTc3NTo6
Ojg7PDUzNTk1NTU1NTQ1NDIyNDU1ODU4NzMxNzczODg4NTc5Nzc1MTU3NDQ0NTMzMzU1NzU1MzU6
ODk8OTc5ODQ0OT06NDU5NTU1NTg0MjM1ODo3NTU1NTg3ODQ0NTU1NTs4Mzc8PDg0NTU0MzU4NTcy
MTQyLy4xNDIvLi8uMS8wNDMyLzAuLC4vLy8vLC4sKiwrKissLCwyMjUzODc3NzU0Nzc7Nzk3NDg0
NTc1NTU0OjU5NzU4NzQ1Nzc3MzQ6NzU1Nzw3Nzc1Mzo1NDQ1Nzk5Ojk4ODs5Pjs3Nzw6PT4+Ozo6
Ozo8PTs4Ozs6OTw+PTs8NTk7Ojo6Ozg9Ozw+PDg+Pj0+Ozw7Oj07QkBAPkE+Ojg5PDw7PT06Pj5C
QDw9Pjo6Ozs3Ojw7Pj05Ozk6Oj1BOjo6PTs7Oz0+PDw8Ozc7Ojw+Oz06Ozs+Ozk8OTs3Ozo7Pjs8
Ojo+PDo7PDw9PTw7PDo6PkE+Ozw6Ojo8Ozo6Ozs6NTk5Ozw9Pj47Oz5BPDtAQD08Ojo9Ozk8PT08
QEA9PT1APjw+PkA7Ozw8ODg9PTo8PUE+PDs7OD09Oz4+Ojo7Ojg7Pj4+PTs8Ozs7Pj06PT46PDw+
PTs9PkA8Oj0zNDUyMDUzNDU1MzIzNTM0MzM0NTEvMTQzMzQyMzI1MzEwMTM1NzQyMzIxLi4vMDIu
MDEyLzEyMTQzMzQzMC4wLjAvMTMwMTE0NDM1NDE1MjMzNTg1MzMyMjU3MzMwMTEyNTQ1MzE1MjAy
NTIwMDMxMjIzMjEzMDA0NTUzMDM3NTIyNTUzMjE1NTQ1NTI0MzU0MjUyNTM3MTMzMjMxMjM0NTMz
MDI0NDQzNDQzNDQ1NDQ0Mzc0MjU1NDMzMzU0NC8vMDEuMjQ4MjMyMzU1NTUzNTU3MTQ1MzM1Mi8x
MzIwMzQzNTMzNDM1NTkzMzU0NDQ0Nzo7NTUxMDEzMTIxMzQzMi8zNDU0NTIvMDc1MDEyMzMxNTM1
NTczNTg1NzU3OTU3NDg1NTcxMTM0NDI1NTEzNTc1NTU1ODo1NDM1Mjc1NTU1NTQ1Mzc3NzMzNDE1
NTU1ODU3ODUxNDQxNTU1NTIzNTUzNDI1NTc1NTU0NDUzNzg3NTc4MzE1NTUxMzc4OTg1MjI3NzQ1
Nzc0NTU1NTUxMjU0NDMxMjIvNDUyMzI1NTc4NDEzNDQzMTU1MzQ0NzM0MTM1NzU0NTM1MzE0NTQy
NDU0NTIzMTAzMzQyNTU0NTcxMDgzMjIzNDc1MjM1LzA0NDU1MzM1ODUyNDU1NTE0NTg1MzQ4NzE0
NDA1MS81MTI0NTIyMDM1ODg1NTIzNDUyNDMwLjIwMjExLjQ3NTUyMDM1NTU5MzQ0MzAxMDAyMjMy
MjMzMTIwMzU0MjEwMDAzNTU1NzU0NDMyNTUyMDE0NTQ5NTM1MjIyNTU1ODM1Nzk3MjQvMDU1My8x
MDIyNDUzNTQ0NDU3NTI1MzM0NDQ3NTMzMTc5MzIzNzU5Nzg0NTUzNDk0NDM1NTM0MzM0NTQ1ODQ0
NTQ1Mzk4NTQzNTU1MjM1NTU3NTUzMDQ0Nzo3NTU5OTM1NDQ1NTUzMTEwNDU1MzQ3NTU1NDMxMjIx
NDc3Mzk5NTQ1NDE1OTQ1NDc1NzUzNDQ1NTU0NTQ1Nzc1NTg1Nzg1NTg4NzU1MzgyNzMzNTc1MzM0
NTU3NDMwMjc3MzQ4OjU3NTQ3NzU1MzMzMzc3Nzc3NTU3ODU4NzU0NDM0MDI0MTMyNDc3NTg5OTU1
NTU7Ozo4Nzc5PDkyNTU0MTM0NTQ1Mjg4NDU1NzU0MDIyMjIuLzEuLi8uMjI0NTc3Nzo5ODU8PDo3
NzU3NTU4ODo1NTw6NT08ODw+OD1CQkNBPkBFRD47Ozs9Pjs+Q0M+PkFCRUJCQUJCQkE+PkA7PT1A
Ozw8PDw8Pjo8Pj4+Pjk5OjpARkQ7PD49Pj5CR0lMRkBDQ0dFQ0NERUpCRkRFR0ZDQT4+QT5CQz44
OTQ1OT5GQDg3OTc1MTU4NTU0NTU5NDc3NzU0NToyNTQzMzQ1NTc0MzU1OTg8NTQ1NTk3OT48OTo4
NTU4OTQ4Ojw3Nzk1ODc1ODo4Nzk6NTk4Nzc1ODk4OTVAQTs5Nzg8Ojc9PT1CT0lCPjs4PkFEQkVJ
SUpMT01LTE5PWFdLT09EQURKSkxYYFdYWVhYZ2JeWVxZWVtXV1hUVk9JS0tLSkdHU1VHOjU4NTM4
Ojc5ODU4OTk1OD5BS1xze3Fwa2traW9xa3aBcmZiYGRiXGlhYmJpaFBLTEdFPDU0ODg5PEdJR01W
XGJkUEc9NDAxNTU1NTU3NTU6PUA+OTs7Pj4+QUQ+QT5FRkNAQkRdquDit14sKTE4ODc5Qjs8PTw6
PUFHQD1BR0dBPT4+Pjw8OTg0OUI0Nz1Vf3NNR1VPSkZFSUxSXV1lW1RJPTg0NTU+SWdwWVNNR0dH
UFBOSUxMTElHSUtUWVBgYVdUU1BQUE5QUlBTREA+NTc4MjM1NTxPWU1HSUpJR0VZZkAzNTU0MzEy
NTU1NTc0NTU1NzQzLzM0NDU1NTU1NzU1MzU3NzU3Ozo5Oz48PT07QkJAPkRHU1ZVV0IzMjU1NTg6
ODU3ODc1NzU4Nzc5NDU1OkVHR0VFTkxLSU5JTEpEREdHRkZFREZFSUlHR0dHSUVGQj4+Q0o9OztX
i2lCPTw8OTUyODQ1ODo6OTQ1NDU3NzU1NTQ1NDs1Nzo6NTM3NTU1Nzo7Ozw6NTgzOTo9QkRCQUBA
PkE9OTs3Ozk4NTk3Nzg6NTI4NTk3Nzk6NTM4NTc5NTg3Nzg1NTo1ODM1MjQ5ODM1ODk5ODU5Ozc3
Nzk8Ojw3PTgzNTk3NTc1NTg3Ojk6ODc4ODU1NTo5PDg3NDg5ODU4Ojg1NTo6NzQyMzcyNDIvLzEs
LCwwMDAxLi8vKywsLjAsLywrLCosLi4pKioqLC8qJysuLDA1Nzc1NzU0NDU7OTUzMzM1NzU0NTk9
Ojg1Nzg3NTU1NTU4ODU3NTU1NzU1ODg5Nzk5Ojg1NTg3NTc3NTU3Ozg1Nzg1Ozg7Ozo6QD01Ozo9
ODo8OjU8ODc5Ozw6PDw9Ojs7Ozo7PDs5Ojs+OjpDQ0ZCRUlMTEpKST47Ojo3Nzo4NTw7PDk+PDs7
Pj46Ojs7PDk7QD48PTs9PDs8PT4+QT47OzpAPT46PkNBPD05Nz4+PTs3OTxBPj48PDk9PDw8PT06
Oj08PjxAPj4+Pjc5Ozo7Ozs8Pjs9PkE6Ojw+PDo5ODo4ODo5OTs7PDw7Pj09Nzo8Pj49PD46PDk4
ODw7Pjw9ODs4OTg4OTtAPUE+Ozw9OkA9Pjw7Ozw8PTs7ODg7PkA7PD1AOz45OD08Pjk7ODw8PD08
Oj0+PjQ1MTEzNTQyNTIyMzQxMDE0NDUyMjU1NTAvNTMzNzU1MTA1NTAwMjM1NTA0MzQ4MjMyMzIv
MDMwMDQ0NDIyMi8xLi8xMjEyMjc1MjQzMS4yMDQ1MTEzMjEwMCwoMTc0NTI1NDIxMTQzMTIyMjQ1
NzU0NTc4ODUyNTIwNDMyMzQ1NTI1MzQ0NTQ1MzM1ODQyMzI1NTI1MjU0NTM1MjM1NDQ0NzUyMzI1
ODEwMTQ3NTMyNDM1NDQzMjIyNDUyMTMxNTQxLjAyNTU5NC8vMjU1MzM3NTQ1NzU3MjQ0MzQ1MTM1
NTQxNDc1NTQ0MjAyNTU1MjQ1NDI3NDEzMzU1NTcyNDQyODc0MzUyMTU1NTg1OTUzNTU1NTk1NTU1
NTk7ODU3NTM0NTQ1NTU3NTU3NTIzNTU3NTU1NDQ1NDUzNDQ5NTk3NTQ6ODc1NTQzODUwNDIyNDU4
ODk1NDQzMzQzNTU4NzIxNDE1NTIzNTQxMDM3NDQ1MjQ4ODMzNDU0NC8vMjU3NDUzNDUyMTM3NTU1
NTU0MzUyMzg3NTU1MjIxNDk3NTU0MzE1NDU1NzMyNTQ0NTM3OjczMjQzNTE0NTg0MjEyNTAzODUz
NTI0NTc1NDMzNTE0NDU1NDQwMjU1MjIzNDQyMjk1NDQ0NTUzNTQ0NTU3NTQzMjQ3MzU1NTMvMjI0
MzAxNTQ1MzAxMjUyNTcxMzUyMjU1MC80MjEwMjIyMzMwNTUzNTM0MjUzNTMxNDUwMjQzNTUwMTIy
NDQ0MjM1MzMyMTQ0MTIxNTQzNTU0NDEzNTQ1MTE1MzA0MjQ1NTc1NDQ1MzU1MTQ1NTIzMTIxMjcy
Mjg1NDU0MjM1NDIzNDMwMjI1MzIyNTc0Mzc1MTM1NDQ1ODMzMjMzMjQ1NDU1MjQ1NTUyNTMzNTU0
ODU1NTUzNDU3NzQ0Nzg4OjU3NTc4ODU1NTQ1ODQyNDMyNDQ1OTs3NTIzNzo1ODc1NTU1Nzk5NzU4
ODQ1MzU1NDczMzg5ODc4NzQ4NTQxMzQ1NTU3Ojg5MzQ4NTk4ODg1ODo4OTc5NTU4NDQ1Nzo1MzEz
MjU3NzU3NTc5NTU1OTU0NTMxMzU1NDo7ODc0NTQzNTM1MTU0NDc0Nzg3ODUxMzU4NTU5NTQ4NDI0
NTQ1NTQ3Nzg3MjMxMzU1MjI4OTU1Nzc0NDM0NzMzLi8vLy8sLDAvMzM1NDQ4NTUzNTo+OjtBOTg4
Ojs+OjxBQD04NTk6OTlAPT5CQ0FCOj5CQDw6PT4+Pj5CQD1CREdFQ0JAPj5AQD4+Pj45Oz5BQj47
PDk5Pj0+OjU8Oj0+Pjo5PT48Pj49PkFEQ0I+PEVHRUJBQUFHRkJEQkdBRERGR0pKRUVKT0w+ODM8
RkZCQDs3NDIzODc1NDQ1Mzg1OjczNzg1ODc8NzUzODgwNDUzNzUxNTIwNzU4ODQ0OjU4NzM1NTc3
NTU5OTUzNDM1Ojs4PD09ODU5ODU4Ojo1NTM5PVNXQUBAQEc+PD5FR0dSVkxUWUxNUE5KS0xOT1BS
UlBOTkxOT0xPUElDQkVQYllXVl1rXG54bnt0amRlYmpoXmBgVVBQUEtHTE6Db0c+NTM0NTU4Pjw5
Ozo+REdTZ2lnbXJybm9wc3NxcHJ0cnRvaGRkZWZiYmJoX2JlVEpJR09GQDtBUFdhYmZnaWhiaGRf
W08+NTUwMjU5OkA+QktQVFBQVFVTVFZQVE5NR0dNR0dKTVaJu76VWTc5PEFHRk1QTU1UT0lFQj45
PEJNWVBLTEpJTkxFPjs4QDk0Pna5k0M+V0tCRU9TUlxmZGVgWVNUST5HUmFibW1XW1NPS0tTUE5Q
TUxJR0xOUllcWV1qYldUVVRQUFBUUFBGQ0I6MzU1ODU4QlBbU0dKUFNPSlRWT0dHRUdKRkBEPjg1
MzQ1ODI1NTg3NTU0MjI1MjM3NzQzNTU1Nzg1Oj5BQUBDQUBCRkVCQkdQV15rTUVDOjU5NDM1NTc4
Nzc3NTU1NTU3MzM+RUpHRktJSUtLSkdFSUNFR0pGR0ZJSklEREZGR0NLR0ZHRUFCRD5CRlBeUEZG
REA+OjUzMDU4ODg1Nzc9QTk4NTg6ODU3NzQ0Nzk1Nzg5Ojc5OkNDRj4+QEJHS0dLS0pKSU1NS0pG
QEA4NTc5NTI3NTk1NTUzODk4Nzc5ODQ0NTg1Nzg1ODg1Nzs5Ojk3OTs4NTU1NDc4Nzs8ODUzODU1
NTU3NTc5NzQ3ODc3NzAyOTo0NDQ0NTQ0NDU4ODQ1NzM3NTU6Ojg1NTQ1NTQzNzM0MzIyMjIvMDIs
LC4sLy4uMTQwLC4sKiwuKi8sLC4rLC4sKiwsMCssLiwwMDU7Ozc1NTUyMzU3NzU3NTo7Ojg3NTU1
ODQ4NTQ5Ojg1NTM1NzU0NTg5ODc3NTU4ODg7Ozo5ODw1PDs8Oz49Ojg5Ozo6Ozo8Ojk7OTc1Ozo5
PTs9Ojs6OTo7PDs9Ojk+QD4+PDw3PklGSk9PT09QU1RVV1hSRz47PD05NTk8PTk6Pj4+Pjs8PD4+
PTk+QD06Oj4+Oz0+PT08Oz07PTo5PDs7PUA8Ojw+ODk+Qj4+Pjs+PDo+ODM4QUE8PTw4ODs8Pj07
PDw+PUA+PDo9PT49Pj49PDk8Pjw6Ojs8PDg4PDk7Ozs9Pj44Oj4+PTk7Pjo8REE8PTs6Oz07Ozw7
Ojs5Nzo+Pj07PDw7PDo7Ojg9ODk8Pjw9Pjg7Ozo4Pj49PDk7Pjw7Pj08PkA+Pjs5Oz09Pj0+Oj07
MjAxMjEzMzIvMDMzLzM0LzIsMTU0MjQvMDMxNTMzMTAxNDUzMTM1MzEyMTIyLy80MzMzMzAwMTIz
MzIwMzUzNTQzMjM1NzMwLzIzMTIzMTIxMDEyMTI0MjMzMzU1ODMyNDU4NzIzNTUzNTQ3NTM1NTU3
NzQ1NTUyNDU1NTMzNTQ0NzQzNDI0NDUzNTU1MzQ0NTU1NTQ0NTQyMTM3MjI1NTQzMzM1MjQ1NDUy
MDIxMzE1MTExNDM1NTUzNTU1ODQxNDAyNDUzMjgzODU1MjQyMzQ1NTExMy8zMzIuMjU1NDMyNTU1
MS8xMzIyNTMzNTc0NDI0MzIyODM0Mzc4NDc3NTAwMzIwMTMwMzUvMTQzMjIyNTU1NTU0ODMzNTc1
NzU1MjQzNDU1NTQ1NDM1NTQzNDU0NTU1NDc1MjQ1NTUzNDU4OTU1MS4xNDUzMzI1MzU1NTMzMzM0
NTU1OTczNzU0MjI3NDg1NzQxMjM1NTM1Nzo1NTg1NTU1NTQ3NDQ1NTQ1NDk1NTU3ODgwMjM1NTMz
MzQ4NTg5NDU1MzM0MzM1MjI1NDQ0NTIxNzc1MzQ1NTQ0NTIzNDI1NzQ1NTQzMjM0MzM0NTUyMzM1
NTc1NTEyNzU0NzQzNDQ1ODUzMjU1NDQ1MDIzMzQ0OTQ0NTU0MjAxLjI4Ojk1NDI0MjMyMjQ0MTI0
NTQ0NTUvMDI3MzM1NzU0NDU1MjQyMjIzMzMxNDc0NDQ4OTMyNTQyMDE1NTIyMjQ6NDQ1MzQ0MjMz
MTMxMjQzMzc3MzQzNTk1NTQ1MzMzNTc0NTQzMDU1LzEzMDM0NDQzNzUzNDM0NDExNTgyNTQxNTUz
MzIzNTQ5NzM0NDU0MzU1NTUzNTM0NDQ0NTU1NDAzNzQxMTMzMzU0NTc4NTM0MzU3ODc1NzE1OjU1
NTU1NDU1Mzg1OTo3NTU1NTc3Nzg1Nzk3NTQ1NTg1ODU1NTc3NTU0Nzc4ODc1MzQ1NTg1MjQ3NTM0
NDQ1Mzk7NzU1OTMzNDI0NTI0NDQzNDQwMTQ0MjU1NTQ1NTc3ODk3NTM3NTU1NTI0MzczNTc1NDU1
NTc1NzU4NTc1NzU0NDE1NTMzMTM3NDQzNzQ0NDQ4NDU0MzU1ODM1NDU1NDUzNDU0MzQ1NzU1NTIy
NTc5Ojk0Nzc0MjM1NTg4NDU1Mzc1MTc1My4uLi8uLiwuMC8yMzM5NDUzNDU1OUNFQD49Ozg1OTc5
PT06Oz49PTs4PD5AQkA9ODk7Ojk6Ozg1Oz4+QENFQUFDRUVBQEJGQ0JAQD48OT07Oj47Oz08Oz0+
PT05Pj5EQD47Ojs+RElOSkI9PERQWUtGQ0JCQUlFPkA+Ozo+QUNER1JdYVdFQEJFT0Q6Oz5DQUJE
Pjw0NTU5OTs3MzU0NTUyNTg3NTM3ODc1NDQ3OjUyNTU1NTU5ODMxNDQ1Mzc3NTU1NTU1NTg4Nzc4
Nzo4ODIyNTk8PDc1OTU6NzM1Ojc1QEFFS0pEQ0lKRkpLSkdLSUdNUFZYZWJZUk1QT1JSVFdWUlBP
U1BQTE1WUEVFR05ZWVNTV1hZaGtxdm5pbnZ/eG9vcmt0YltPS0dLS2BdRUVAOjo7Ojw+QkJBQ0de
ampvbmpxb21rbXFzdnRycXN0cnNrZ2loZmVkYmdnZGVYTExFREtQVGFra2pma2trZmRiYV1ZWFZC
NTEyOUJOV1tbYmViYF5iX2FiXl1fWVlfXVtbV1BOUFxmaF1GSk9OUFNSVFJQS05LSk9TRT5BS1BQ
T01LSU1ZUEtGR0c+NzU9cnlYRURJS0tSTlNQUFJZWVtYVVhQV250a2JraVRVU09QTE1LTk9XWVNP
UEtQXl9fYGBZVldYVlRQUEpUXEw+PEE1Mjc0PkZMUFhQUFlgU1VZUE9YWFNQU1NNTlRQRj04OTk5
ODo8PT49TlNCPkZEPTxFOzk6OTg5Ozg8QEFHR0REQURJSkxMTVJOTU9MS0pGR0U6NzU1NTc1NTg1
NDUzNTQ1NzlBR0VFR0dJRktNSkRCQ0pMR0dHSkdHRUNFRUdEQUdDPURHSk1MSkVNSUlHTElFRkA9
Ojk1MzE5PkFHR0xUTEdFR0ZHQEA5ODk5NTk5OTc3Q0JHTU5PSlBNT1BXWFZTUFNVWFlYUE1MR0dE
RDk1NTU3PD1FQkNAQUFAPj46NTE1ODk1NTU0NTU3NTc1OTk5OTc4ODU4ODg1NTs5NTg1NDU4NTg4
NTs6ODg+ODcyMzU1NTg3NTg5PDw5NTkzNzg1ODc3NzU5ODk0MzU1MjMyMDE0NDAsLzAvLy4wMC8s
Ly8uKi4sLjAwLCwsKzAuKy4uLCwsLCwsLzAxMTQ1NTU1NTUxMjM3ODQ0MzQ0NTg7PDs4ODc1NTg8
Ojg4Nzk6OTc1NTU1NTU3OTk4Ozk1ODk5ODU7PDg4Ozw8OT06OTg6ODg4Nzk6PD4+Ozo8PDk5Ozo9
OTw5Ozs9Ojo9Ojk5OTo6OUBAWF5bWV9gXFlZVldUWVZTSTw6Oz01OTs8OTw5Pjw+PT4+Ozw8Oz0+
Pj0+PD0+PD0+PT48Q0FAPDk4PDw7Ozs5Ozw5PDg7Pjs7PDk7OD5CPjs5OTs+Oz0+Oz4+PD48OT48
OTk6Ojo7OTo6Ozk+Pjw6OTo8PTc5Ojo8PTo+Pjk+QTs8Pjo9PUE+Pj08PD48OTo7Pj46Ozo8Pj09
Pj08PT49PTw6OjtAOzpBPj48PTw9QDw7Pjo6PkA+Oj4+PDc7PD4+PTs7PkE+Ozo7Pj49PD4yMzU3
Mzc0MzU0NDQ1NTIwNDUyMjU1MzMxMTUzMC8wMjQ0NTU1NDM0LywvNDIzMjQyMTMvMzU1MzIwMTMz
MDUzMTIyMjQxNTUzMTMxMTE1MzM0NDIxLzM0MDIyLiwwMjAxNDMzMzU0MTI0MjQ1MDU0MzM1NTAw
MjU0MC8yMjMyMjI0MjMyLzAzMjIzNDU3MzM1NTIxLzAxNDIwMDM0MTA0NzMzMi8vMjMzNzI0MzUy
NDExMDAyMjI0NDIyNDUzNDM3NTc1MjMyMzAwMTQ1NTcvMzMwMzA0NDIxNDUyMDIyLzIyMTAuNDMz
MTM0NTQ0MjQ1NTQwMzgzNDIxNTkzMDIxMDc1MjQ1NC8zNDM0NTU1NTMzMzMyLzA0NTIzMjI0MTA1
NDQzMjQ1NTQyNTMzNTQxNDczNTU1NTc5NTg4NTEzNDQ1ODQ0MzU4NTQ1MzE1NDU3PTo4NTM1OTQy
MjU3NTU3NDIxMTI0NDUxMjU1ODU1NTU1NTU1MzM0MzI0NTc0NDM1ODU0MjExMzM1NTU1MTE0MzMz
MzIzNDczNTQ0ODQ0Mzc1NTM0NzU5MTEyNTUzMzg0MTQ1NTQyNTgzMzc1NTU1NDMzNTg0MDM1NTQ0
NTMyNTU1Mi4yNTMxNTQzNTQ1ODU1NTQzMS4yMjczMDMyNTUzMTQ5NTc5OTg6NzI1NTIxMTIwNDIy
MjUzMjI1NTc0NTM1NTM1NzI3MjEyMDM1MzUzNTc0MTMwNDc5NDI0NzQzNDQzMjUyMTI1NTgyMDEw
NDI0NDU1NTM0NTM0MzM0MTA1MjEzNDQ1NTk1MjM1NTU1MjI1NTIxNDU1MDM0NTQ1NTc1NDU1Nzo3
NTU0MzQ4NzQ1NzU0NDU1NzU4NTQ1NTQyMzU1MzM1ODUzMjU1MTMzMzczMjQ3NzM3NzQ0MzU0Nzk1
NDU3NzU0MzI0NTU4ODg1NzU1NTU3ODg3NTQ0NTQ3NTU3NTk4NTU3NTg1MjU3NzU1MjQ1NTU0MjA1
Nzc1OTc0NDU4ODc0MTIyMzc0Nzg0NDQ4MzQ5NTQ1NDU3NTU0NDU1NTU1Nzc1OTc3NTU5OTk1NTg4
ODU1NTc3NDQyNTU5Nzo1NDg3ODc6OTc5MzU1NTU4NzM3OzU3NDM3NzU0NDI1NTg6ODQ4NTUyNTMz
NTc1MTAyNDM3NTM1ODUyNDEwMTAwMjAvLCwuLjA0LCwwLDQ5NDU1Nzg+Q0A+Pj46OjU6Ojw6Ozo8
ODU4PDk8Qj0+QD45Nzo4ODo7OTU6Oj5AQUpJQ0FDQD5DPkA+Pj09QEA8Oz48ODs8OT1FRT5CPj5D
Qz5CRD49Pj5HT0xHQUA+RVhiVFBNREE+QUlKSkdGQ0REQD5ET2VvaE9DQEFEQEE8QEREQUNBQD48
OTU4NzEzNTc4NTQ1NDUzNDU3NTM1NzU0Mjc1NDU1NDIyMjQ1NTgzNTI1NTM1NTk5OTo7NTU6OTQ1
Nzc4Ojc1NTo5NDk5NTc3PkFBRkdMS0lHS0xLS0tKUFBLR0pNVVhYVlZgYVlSVFdXVlhZV1ZWT09Y
XFlORUpQT1ZkW1ZYYW9zbWtqa29wcXJwb3OCb3RtZFJLSk9PT0VAQ0RDOjxHRUNHRkdHT1lwc25r
dHdra3FwcHR3fHx6cHJ4f21qamRpbmpgX2JkalVHREVKTll2cmtnZGppampoaWVmXl9eX1Q+Nz5M
V2FnbWprbm9ubWtra2llZGhnZGlmZmdfX1tWVlZZU1NeZmJZWV1hZmRQSVBQWG1QRU9QR0pJSUpJ
R0pGSkZLTUA7OkRZUElCQkNHUF1bVldZU15bUlBZXWZ4dGtmYF1cWVlVVFRQT09JTFNSTkpLTlto
X15kX2BdYmJeVVlXT1NWUEJAQzo1O0BBS1VbXFNPV1ZZX15VUFRWUllXU1VZU0ZBQUU7OkBCSkdM
R0xXV0dBRUZDQ0RCQ0U7NTU4NTRBTExNSkpPUlVUUk5QVVVSUE5MS0xJT0Y8OTU1Ojc4NTU5OTk7
OTU3PEdHR0pNSUpLS0tHR0ZMSURHSk1OTElFRkZFR0dLQT5AR0pQTUdJR0dLS0dJR0lLSUQ9PDk0
O0VOUlJUVFdYU1RQTU9LRERDPjs5Mzg4PkdWUFBdYVlXWVleYF1eX19dW1lfWVlbVlVVUlBYSTg0
NTxKSlZQTUpGQT5BQUA6OTg1NTU0Nzg1NTg0MzQ1MzQ3NDM1NzQ1OjM1Nzc1Ojs1NTU1OTk1NTU4
NzQ1NTk3ODI0OTs+REdUVEtJRz41NTEzMzQ0Nzg1Nzg1NTIyMjEyNTg1ODUzMy4sLy8sLzEzLy4x
Ly4sLiwuLCwwLy8sLCwrKiwwLC8sMTMzMTU4Ozc1ODU1MzU1NTg4ODU1NDQ4Ozc1NTU1NTU5Ozs3
NTc0Ozs6OTc1Nzg4Nzg4ODk4NTg9PDg5Ojg7NTk4NTc7Nzc4Nzg6ODg5OTo9PD07PDs5Ojo5Oz0+
PT08Pj43Nzs8Pj07QUpgcGtkX1xfbWJeWVdcXVtSR0E+Ojs6Ozw7OT05PDg6OTo7Nz49ODg9Ozw4
Oz08OTk6Ozs8ODs7OTo6Pjs8Ozs7OT08OTg4Oj0+Pjw8Oz4+PDw9Pj4+PkBCPkBEPj4+OT4+PEE+
QD06OD07PD07Oz09QEA8Oj4+PDs+PTo+Qj09Pj48Pj49PTw+Pjw5Nzg5PDs5PT0+PDw9O0A+Pj4+
Qj45PUI+QkRAPj4+Pjs+QEBAQjw8PTs8OjtBQD46PT49PDw+Pj4+PTw9PTw+OT0+PjQxMzQ0MTM0
MzM0MzQzMjM1MTI3NTI0NTU5NTMxMTUyNTU1NTU1NS80NDQzNDAuMzUzMzI0MzQyNDc1NTU0MjIw
NDMzNTM1NDQ0NTUyMjU0MDI0NTUxLzQzMi4xNDUyMTQzMjI3NDU1MDI0NTIvMjEuNDMxNTQxMTEz
MzMwMDQ1NC8zNC8vNDM4NTE0OTg1ODUzMjU1MzUzMzQ3Nzc1NDIyNTcyMTIwMzU0MjUzMjQyNDM4
MzAxNDUzMjAzMzE1NDQzMzU1NTUzMzM0NDAwMzU1MTMzMzExMzU1MDMyMzU1ODg0MzAyMzExMzU1
NDUxNTM1NTUzMjU1NTUzNDQ0MzQ0MDI4MjIyMzM1NTM3ODM0NTI0MDU1MzMyMi4zMzIyMTQxLzUz
MTU0MzMyMzU1OTU0NTU1NDg1MDAyMjU1NTU1NTg0Mjg1NDE0NTUyODk5OTc1NTc0NDQ1NTU1NzQz
NTQ1MzI1NTg0MzQ5NzQ0NDUyNDc1NTU1OTk3NzMzMzQ1Mjc1MDI1MjQ1NTM3MDI0NTgyMzQyLi8x
LzQzMzM1NTQ0NTU1MzI0NDcyMzU3NTE4MzQzMjU1Ojo3NzU1NTMzNTQyMDMyMjU3OTc3NTQ1NDUy
NDUyNTE1MzE0Nzg5Ozk0MTM0MzQ1NTM0NTU1NS80NTEyNDMyNTQ0NDM1NTU3NTIyMjU1MzEyMzU1
MzIyNTIzNTI3NS8wMzczMy8wMTU1NDM1NTU0NTg1NDI5NzIwMzk0MzM1NzU0NDM1NTI0NTQwMjM4
NzU1NTMyMTI1NTUvMTAyLzEwMjQxMS8zNTUyNDM3NDEyMC8zMjQyMjAyMjUyNDI1NTMzMTMzNDI1
MzQ1MzI0NzQxNDgyMzc3NTUxMTQyNTg1MzUzNTU3NTk5NzMwNTk4NTQ5OzU0NDQ0NTMzMTI3NTcy
MzUyNDg1NTU0Nzk4Mjc1NTMxMjQ0NTgxNTk4Nzc1OTc1NTQ1NTc1OTo3NzQzNTU0NTU0NTU3NTU4
NzU1ODM4NTM1NTk3NTQ1MjMzMDU3ODk1ODUzNTUzNDE1NTc4NTM5PDIxNDU1NTUyNTU1NzQ1ODMz
MzU1MjQ0NTk1NTk1Mjk6NDQ0NTc3Ojk0Mzc6Nzk1NDc3ODc5ODk1NTU1NDQ4OTg6OjU1NTg3NDU3
Nzo0NDQ3NTg1NDI1Mi8wMi8vMzExKissLDEyMzQ1MjMyMjU0NUJJPDs7OT08PTg6PT5AOTk6Pj46
PT1BQEA8PDo3NDg6NTQ0Ojo8PkBFSUxHREpKQUJBQEA+PTw7Pjw7Pjo5PD5BQkJFRURDQ0FBRURD
QjxAQUE+QURCR0dPVVVQTUlJRkZER0dMTVJSVmJZTEpHXWZdVVNTV09HQUNCRENETEpEQ0VAPDk3
MjM1PT48MzQ1MjEyMzU3PEc8NzM3NDU1NTUzODs7NTM1NTQ1NzU3Nzg4Oz01NTk5NTo1ODw9OTU3
MzI0NTU3OTg1N1NcUEdDSUpMTU1PUlNNTEpSZFNKSkxMT05VWVlYVFJTU1ZXWVlbW1RWV1RVWVNH
Q0NHUGJfXGeEdHJxb3Fxa3BydHh0c3d3bWpoZllUU1lUSkRESVJHR0ZAQkVHR0lQYHNzZ2hzdG1t
bW10eHp3d3tybm1wamtpaHFrZmJlYF9ZT0ZCQUdSXWdnZmZnaWdqa2tqZmdmZmJgWEY9VV9hb290
cm5udHBwcnRucm1tb25wbWtqaGVnX19hYWFeYmVmZ2JeXWZpZWFYXlVZc2BTU0xNTk1PT0tPUklG
RUdKUE1TVVBOSkJCQkdPWE9QU1NVWFtUYHN4cGtoZGdgYGJgX15fZWViYltUYWFYUk5ZZWVkYmJh
X2BkYWVZVlJVUlRhS0VBPj4+QUxTWF1dYVhUWVtZXFlbV1VWWFxdXWJiUEZFRVBMR0ZGR0dHRUlH
RUZFQEZQSkZBR0ZEPTo3PURKT1BTVltXWVldW1tZWFdTVE5QUEtJS0U+Pj07Ojo+PDs8NDU5NzlE
VWBQSkdGSU1KRENLTUtOS05MR0VFRUdHR0FGSUlFQURFTE5HQ0dMSURFRkVJSk1KR0FDPjtEUFhZ
WVhfYF1dXVZXVlBPTUdKRz41NThAW413YFxdXmRiYmJnZmdnZGFlZGdgXFxZWFVbWFxHNTU8UFhZ
U0tHQUQ+Q0dDR0RBODs5PT1FR0NGQjg0NTU4Mzc5Nzc4NTU3Oj46NTU1ODg1NTg0MjM1NTc5Ozc5
ODw7Ozc3R2JlWVlZW1ZSTz41NTUzNzU1ODc1NDc1NTs5QEdVUk9MSj41MCwuMCwsKywwLi4yMTEx
Li4sMTMwKywqKywqLC8uLzEvNTg0NDU6NTE3NDUyNTQ1Nzk7NzEzNDo4OTU5Ozg5NzUyNTU4OjU1
NDU7ODc5ODc1PDs8OTk8Pjs3OTc3OTs4Nzk6ODU3NTU7OTU8Pjs6ODk8OTs8Pjk6Ozk8OTw9Qj1B
SUZBPj08QE1ZYWZ6dGdfYmJiX2JiYF5fX1ZPR0lCOj0+Ozw7Oj4+QT48Pj49Pjw5Ojo6ODs+Pjo6
Pjw4PDc9OT48PD4+Ozw7Nz1BQj4+PDc4Oz0+PDs8PD09PENAQ0dERExJS1JJRz08Ojs6Oj0+Oj08
Pjw9Pjk5Ozs6PTs5OTw+PT49Ojs+Q0RDRktNVFdGQ01MQj44Ozk6Ozo7PTw8PTo6PTs5PT04Oz4+
Pjs8Ojs6PEI9Ozw7PT0+QDw8PEA+Oz08PDw7PTw6Ojo+PUE+PTw6Ojg6Ojk3MzM0MjQwMDEyNDAv
MDEyLzAxMTQwMzIwMjIwMjU1MzExMzUzMjIvLjI0MjIxMzQ0MzcyNTU0MjIyMTA0MjIxNDU1NTU0
NTg1NTQzMTM0ODEzNTQ3NTQwNTM1NTMyMzU1NDU0LzUyMTMyMTE1NTU3NTMvMTQ1MjI3NTQzMzIw
MjIyMjM5NDMwMTM1MDE0NTc3MzQ0My8yMzUzNTU1OTQyNDMzNDM0MjI0NDU1NTM1MjIvMjQ1NDQz
NTQzNDMyMTQ0NTQ0MzIzNzIxMjM0NDA1NTU1OTg1LzA0MzM1MjQyNDMxMzIzNDMzNTEyMjIzMjU1
MTU1NTUzNTs3NDUzMzM0MjM1NTU1NDU0ODQ0NTU0ODo1NDM1NTMxNDU1NDAzNzgyNTU5NDIzMjMz
MzQ1NTU3NTU1NzIwNDc4NTMyMDM0NDM0NTM1NDEzNDIzMzU1NTgzMzc3NTQ1NTU0MzM1Mzc3NTg1
NzU0MzU3ODUwNTc1NTg4MzU3MTI1MjMzNTg4ODo5NzczNTUyNzU3NDU1NTUyMzU1NTc1NzU1NTM1
NzM0NTI0NDUxNDQ1NTQ1ODUyNTczNDU1NTM0NDU0MzQ1NTIzMjU1MDIxMzU0MzQ1ODU3NzQxMjEy
MzEvNzc0MzEyMzU1NDU0NDU3Ojg1NzIvMTQ0NTQyNTMzMjA0NDU0NTQyMzUyMTMxMTI1MzIyNTU0
NTI1NTUzNTMxMjM0NTEzNDU1NzQ1ODc1NzU1NTQzLzI0MjExMjEyNTQzNTU1ODQvMDU1NzQyMzMx
NDQ1NTQvNTc0NTQyMTM0MzIyNDU0MjQvNDg1NTU4NTE0NTQyNDU1NDAzNTUyNTc0MjEzMzM1NTM0
MzU1NTMzMTU6NDM1NTk1NTQ1Ozk1Nzo7ODU3NTU0NTczNTU1NTc1Mzk3MzI1NTQ4NTQyNzs4NTQy
NTU1NTQyMzU3OTUyMDIyMTQzNTQ1NTQ3NzUzNTUzNTc1NTU1NTc3NzU0NDIzMzIzNzU0NTU0NzU1
NTc1NTU1NTcyMzc1NTg1NDQ0ODU1NTU5Ojk4NzU0NTc3ODU1NTU1NTU0OTc4ODc4Ozc0ODk3NTUy
NTM5NTc6NTM1ODU3NzU1Nzg4OTU1Mjk1Mzg1NTg3NDM1MjE0Nzk1NTo1NTU1NTc1ODg5NTo5NTg1
MjM4NTQ1LywvLjAuLzEzMjMuLjAwNDQxMDM0NDIxMjc7QUE7OTU3NTc5ODo6Ozo7Ojo+PD5APD5F
QTc5ODs6NTU1OTk6OT5BQT5DSkdLRD08PDc5QD47Qkc+Oz07NTU5O0xHPTo7QEFERUlJR0ZFQEM+
Ozk+Q0dJR0pHSUdER0pGRkdKSUtNU1ZZYmJZXFtiVk9SU1tpal9YS0RBPD5MREBEQUFDQz0zODo9
PDs1ODc6NzU0LzhAYFI9MzM1NzQ0ODs3Mzc3MzM4Ojg3NDg4OTg1NTM1Nzg1NTQ+TFBLSUY+Ojg3
NTQ1NTpWn4tSPkRJTFBPT09TaFlQTk1QUEpKTlBLUlBVWVZbVlRZXmJeV1lYXFdZXF1ZWVZHPkRN
WFZeZnR5cHByd3N3eHd2dndzd3yBgHlzaWBXUlBHPkRKT05HR0dESUZJUFBbYWlxcXB4c3B0cnFy
enqAjXNtanFra2tpaWhmZmJkZVZGQ0NAR1hlZWBgZmttbm1qaGttamRpaGBeT1JiX2tzcHJ5enl3
dnB0d3lzcXJ0c3Nycnd0a2tqYmViWVlne2hhZmZkaWVmamliW1NPWV5UUlBQUExQTVJcTkVGS1JU
VlNQTk5QUFBTT1RPUFJSUFJWWWZyc3FuaGlmcGVgYnF7dGttb2RiX2JiW1lZW2FlaGtoZmdrZmdq
cG5cWFZSWFBCQEpBPT1HXWFVWGBgW11ZV1dkZV5WXGJiYmlmaWViXFZORktOTkdGQEFEQ0BMS0pD
Q0dBRUJFRU1DOzU6U1JHUFtiYFlWWVxdXVZSWVlYWVhPTEdMT0lHQzs8Nzg6O0E8PkI8QVJfWUxb
UEtHQ0ZHR0lKR0dHTUlJRkdHQkJBQURCQD4+Q0ZHSUdLTklJRkdKSkZHT01KQEJGSlBZYGFgYWRi
ZGlpYVxbVlBTVV9PSkc8Q01eem1iYmdqbW5qamtvb2pucm9raGReX2FhXVxeaFRDRU5cUlBHREdH
RERFR0pJT1ZSUFJUUFZcYlxZQjw8Pj48OTc5Ozk3OTk1QUA6Ojs6OTc0ODo7OTo8PTo+PT5BQ0I+
Pk9fZmthWVlYW1dXUkc4OjU4NTc4ODU1NTU8VVBXXWBeYVlTVUEyLCwqLzEsKysvMjQyLi8vMjQy
MS8sMDAxKywsLjQ5OkRSRTs4OTg1NDU3NTU1OTc1MjQ3OT06ODkzNTQ6OTk6Nzk3NTU3NTU3NTc3
NTc4NTU1NTk5ODU3PDc3NTU5ODo6OTk6Ozk5Ojw9Ozw6PDo6Ojk5Oj08PD4+QEBDQ0VOVVlfXFJQ
UEdPWWJza2RiZWVpZF9iZGRkYWVhWVtYTUQ+PTk1OTw8Oj1CR0xMUFNOQTk6Oj4+PDo6PDs9Oz4+
PDw+QDs9Pj0+QEFBS1lOSVJSVUI5Ojk7OEFCSklNU1lQUE9QUE9OVFBST0dAOj0+Pj4+Pj5BOzo6
PDw+Pjw+PDs5Ozw9QT0+R05YVFBKUmVkZk5QX2hdUExCPjxBQTo5Pj49Pjo9Ozw7PTs7PTw7Ojg7
Pj48PDw7PDw9ODg8QD47QEI+Pj0+Pjw7Pjw4Ojw9PT08QT06PDw+PjwxMzc1NTU1NTU3MzQzNTQy
NTc4MzAyMzI0NDU0Mzg1MjMyNTUwLzQ5MjIzNzU1NzEyMzUyMjIvNDU1NTU1NTUzLDE1MzMyLjAy
MjQyMDU0NDUzNTM1NTQ0MzQ5NTIyMjIyMTI0MjUzNTUzMDMyNTM0NDc3NzUyMjE1NDMzMTM1NTU1
MjMxNTQ1NDI1NTU3My8yMC8wMjM1NTU3NTg1MjU0MjMwNTQ1MzI1NTMwMTQ3NTM0OTU0NzIyMTMy
NDIvMzU0NTExMzQzMzU4NDIzMjQzLzUyMzIzNTU1NDg3NTUzMTI0NTU4MjE1NTU0NTU1NTc1MTIy
NTQ1Mzg1MzMzMjI3NTMxNDUzMzU0NTUxMjI1NDc1NzQzMzUxNTUyMTU0NTg3NTU1MzU0NzU0NTUz
NDc1MjU3ODc1NTU3NzQ3Nzc3NTUyMzQ5PDUyNTo5NTU1NTU1NTU3NDUyNTIzMzQ3NTQ1NDIyNTc3
NTczMjM0NTU1NzM3Nzc1MjQ1NTU3NzU1NTUzNzg1MzU1NTg3NTQ0Mzc1NTU4Nzc1NTUzMzg1NTU0
MzU0NTMyNzkzMjQ1NDMzMjExMzc1NTM3NzUyNDM1MjU1NzQxNDMyMzUwMTMxMjMuMTU6NDIxMjQ3
ODUvMDQyMzU1NTU3NTc1NTc1MjM0ODU1MzU4NTI0OjU1NzQ0NDMyNDM1MTEyNDMwMzQ1NDQxNzQ1
NDM0MjQzNTUyMjM0MzQ1ODUyMTMzNTQ0MzQwNDQ0NTUzNDg1MTI0NTU0MjA1MzI0NTU0MjUxNTc1
MTUzMDQzNTU3MjIyMDU3OTUzMTU5NTc4NDU1NTMzNDU3NTIzMzE0NTg1MzU1MTEyNDU0Nzg1MzI0
NTo1OTQzODU1MDI0NTM1NDU1OTczMzQzNDU1Nzc1NDc5NTU1NDU1Mzo4NTUyNzg3ODc5NTk4NzU3
ODc1MzU1Nzk1MTI1NTczNTIyMjc1NTMzODU0NTg0OTc1NDQ0Nzc7NTUzNzo5NTU4NDI0Mzc1NTI1
NDQ3PDc4NTE0NTc0OTU3NTMzMzQ1OTU1NTU1OjIyNTU3MjMzNDQ3NTU1NDU4NTc0MzU3Ojg1NTU1
NDU1ODo7MzM1NTU1NzU0NDc1MzQ1NTU1NTU3ODk3NDc3MzE0NDU0MTM0NTQ4ODUzMzI3OjU0NzMz
MzIyLy4yLzIzMjIxMzIyMjMxMDQzMTQ1NTc1ODg5OTw+PDw5NDQ4ODs8PUE9PUA8PTw9QkREPj05
PTs5OTg4OTc+Ozs+RUdKRkVCQD4+PTw+PDk9QT46OTs+OT08PTs6PDk+RD5EQTs5Pj0+PT47PT5H
R0xEQkE+Oz4+PEBCQ0NCQ0JCR0pPUFNXWFVQS0pOTlllXlNQUEo9O0REQENHR0RHQThHTlBNS0ZA
Q0NCOzU0Mz5qaz4zLzA1NDc1NzU3Nzk7OTQ0PENCVks1MzQyNTU3Nz08Qk1nZFNQVE5XSTw4OjU1
Pm6Va0NCR0xPT1BSTVNiVk9NTEtQUExOUlBXUlVXU1BTU1ZeaWJhX1hcYGBdWVZZYlhJRklSVltm
dHZ0dnx6eIKAe3h4e3yAenyIjnZtcmppUkZEQUdQTklEREpHTEpOWF5iaGttcnd3dnl0dHd2en19
d3F4f3NuaWhnZWBgYWViV0pDQEJUYWRiZ2pubXFybXJ2c2toa2dlamVeXVticXR4f4F9fXp4d3t8
e3l4c3d2d3Z3dHRrcGtramleYF6AfWdiZ2Vma21rbmpZWFBSUE5TVFBSVFNTTk9PTElHT0pOU1VU
VlNSTlBdV1RUVVNWWWZqdHJra2tpa21qZmZpdHp0dHN0bWdma2toaWRmaWtnZ2ptcHJva3B2cmJW
UlVcTUZCPj5DQFJlXlZXXVldX19eWV5gXl5iXmBkamVmYmVmZHBkR0FKU0lERUJDRkdBQUJAPj5H
RUFAQENAPT5MRklNV2RiYF9gX1lbYVtZWFlbWVNUUFJQVF1JQDs4NTg6PD1DQUpZW1dXU1tST0xL
S0dDREdHQ0dGR1NLRUVFQkNGRz5DRURGREdJSkdKSkdGR0lJR0dKUFBPUlNZW1tdZmZkaWloaGhi
XFhXWVRTW1tVUElLUlhiZWVrbW5udnRxbnNwdHZ4dHFwZmZmZGJgYmZhWVBQWVlSR0VKUEpHR0pO
UFNUV2BeX1xYV15dWVhQTEZBQUI8PD47NTs4OT1QVE5UTDw6ODo6ODg6PUFAPUFBODg+PkVQXWhg
Xl5bXWJiYmJlVjkxMzg3MzQ1ODU4PlBfXl5fYGJlYV1iVTsyLC4vLi80MDEvLjAsLi8uLC4zOTUz
MzAvLzM+R09SV11TSUQ7NTQyNTk1NTU3NTI1NzU1OzkzNTU3NTk4ODU5Ojk1NTk5ODc1ODc5NTU3
ODo4OTg1Mzc4NTc0Nzc3ODw5Nzg8OTg7PUJGTFJDOzo3OD07QERLT1BXWFJZYWJnYGBlYl9kZGJk
dG1hXmFfYmZraWhmZGJiYlxeXllTSUM+Pjk+QkBDS1VkZ2traIFePjg9Oz49PDo7PTo4Oz48Pj4+
PT4+O0BHT05PWVVlWVVUTkU8Ojo5QVNgXlhcVlZXW1dUT1NYVFBUTkM5Oj5BOjs6O0A+RTo4ODk4
PkA+Ozc5Ozs4PUZlZ1xZXVxbYl5ZVVRbWVtdU0dAPTk7ODk+PDk7PD49Pj48Pj4+ODs9Oz0+Ozo9
QT5AOjo5PT4+Ojw+Ojo3PDtAPjs5PTs8PD48Ozo7OjxAQTs9PjM1MzEwMjQ1MjMyMjExNzIxNDMu
MTI1NTIxNDQ1MjAyMzM0MjUyMDAyMzAxMzEvMDEyMTExNDU1MjAvMTAwMzQ1NTIwNTMxMjU1NS8z
NzQzMzEzMjU1NDEyMjA0NTMzNTQ0NDI0LzEzMjUzNDE1NTE1LzEzMjMyMzc0NTI0NDU0MjMyNDEw
MjI1MjU3NDAwNTU1MzQyMTM0MzAxMzAwNTQ5NTU0Nzc1OTU0NTU0MC8yNzc0NTU1NTMyMzM0NTky
MjIzMjU3NzUxMTQzMzIvMjQzMTAxMTMyNDUyNDc0MzU1NTU0NDMzNTUxMjMyNDU3NDUzMDI0MzM1
NTU4NTMzMTM1NTU3NDM1NTUzMDAyNDc1NTU4MzU1NDQ6OTc3ODc1MzQ3NTk1ODg3OTU0NDIwMTQ0
MzU3NTQ1ODg1MjQ0NDc5NzE1NTQzMzc3NzU0NTU1NzUzMjc3ODU0ODU1ODg1Nzo1MzQ1NTc1MzE1
MTQ3NTQxMzU4ODc1NTg1ODg3Ojc1NTg5OTU1NTU1MzMzMTU1MzU1NTU1NDQ0MzU3OTUxNzUwMTU3
NTc3NDU3MzU3NTQ3Ojc1NTUxNTc1NTU3MzM1Nzc0NTU1NTU0MzI1ODQ1NTQyMDQ1NTg0ODcyMjU1
NDc1MzI4NTQ0NDU1NzQ1MzU4Ozc3MTA0NTU1MzQ1OTU3NTc3NTMzNTUzMzMzMTUzMzc1MzQ1NTI5
NTM1NTM0NzUyMzU3MjQ1NDUyMC8xNDM0NTU0MzM0NDU1NzQ1NTU0MjMzODU0MzQ0MzU3NzU1NTUy
NTc1NTQzMzQ1MzQzNDM0MzM1MTA0OjgzNTUvMjMzNTIzNTU1NDI3NDU0NTU1NDUyMzI5MzMxMzIy
NTU1NzI1NTU1NzM1NTk1NDQ1ODc0MzM1NTUzNzU1NDU4NTU1NDk4NTUzNzg5NTk3NTQ1NTU1Nzc4
OjU3NDQzMzk5Nzc1NzU3NDk1NzU1NzM1NTUzNDMyNTU4NTQ0NTU4NzU4NTU1ODU4OTM1NTo5ODg1
MjU1MzQ3Nzg6NTI3OTQ1ODU0ODk0NDU1NTU5NTQwNDU3NTQ1Mzc1NDMzNTU5NzU1MjQ1NTU4ODU3
ODgzNTo7OTU3Ojg0NTc4MzQ3PDU1MzM5OTg3NTU1MTQzNTI1MzQ5NzU1MzI0NTUyMTM1MjAyMzQw
MjAzLCwsLzQ1NDIwMTEzMjA0MTMxMTg9ODc4ODU0NDU4NzQ1Ojs3OTw+Pjs+PkBBPj5APjs9Ojc4
OTk5PDg9Pj5AQkVBQ0I+PD49Nzo7PD07Nzg8Oj47Ozc3OTo6REM+Pjw7Oz47OTs+PD49RkdLT0lE
RkI9PD0+QURBQz4+QEJFRElNUlRWUE5OT1BLT1ZZSkxSTktGSlhbYWpmT0Q9RV5pXltbWVxiZllM
TEVBQld8Zj41NTU0NTU1ODxCUlBHREVPeI+YgEE1Ojk4PT1ASVBYWV5bVVBPUl1TTkI+Qz5CWFlM
RktKTU5STE5TUFRVUFBQVVJWVVRSUlNQVVlXXF5fYl1hYl1rZl1ZW2JgXmBiaVlLTVBXW2l5eHh6
eoCBg4CBf39/gYN9fX19end3c2JSSUJDTVJPR0ZHR0lMTVRYX2Vpa3xycXR4gH17fHl3eHl3dnR8
bWlraWZnYmFkYlZWT0BBRltkaWhpa2trcXR2i3ZramtrZWVobXFiX2Z2eH99fHyAfX19eHt8eHt5
eXRzeHR3eH10cHFyb2BXXGdxaGlpam1ra25qa1xfWU5PU1BQVFBPUFBOR0xgTUJKS05SWFBQUE9M
TlBQUE9TUlZdZW50cW5rbmtramtzbm92dHR0eHRxcXRvbnRubm9qbnFram1xbWtvdHhrYmBeX11X
X31ZPjhCYmVgV1xfWV9fYWJcX2FfXGZraWhlYmViZGJkZWRHPkNFSk9GRkVGSURBQ0M+PkFGQD07
PUI9OERKSU5iaWJfYV1fX15gXVldXFtZVlNPU1ZYV0dDQT43ODc0NzlBUFVKS09UWVZNSUdHQ0JE
SU9HQ0dgUEJDREQ9QENBPkBDPj5ERkdKRERHR0ZGREZGQ0dSWF5cV1lZYGZra2pubWpqamdfW1ZW
V1VWVlNQUFZfZWVrcHF5eXl4c3Z0fXx3dnd3b21qZ2diZmZncmlfVV5iYmJVRklNSkpPVmFZVVth
YGBcW1hcYVxYVFRSUkFAPkA9QD47QEJMWVdTUFhZWUU5NTc8PEI+Qz44ODo5Ozs+S1tqZmtiYGJi
aGVkYWBcQjU1Nzs1NTI1Oj1ZaWZnZGhlaGpmZGhiSjgvMC4sLi4sKi4qLDAvNTU4PkJERDw8Pj1B
UmBnaGVlYmFhWE9ANTU4NTg3OTU1NTU6Ojg5NzU1ODg4NTc1NTo3ODs4MzU5ODk4ODg7OT0+REE8
NTU1Nzs7Ojg1NTc4ODg5Nzo9Q09TW1tZZVZHSjs5O0VQXl5dYmViYmVlZ2tmZWZgYmloZmtnZmRi
YmZramdnZWlnZWJkW1xkYVtWUEpGQkVKT1dma2pibm9reHBZRz5ERUVCQj44ODo9QT45Ojs4OUJJ
UlBHTEpQUllSUE1TTD47OT5NYHSGgIBlVVZcVVRSV1RWTU5LTEQ6PDo5QD48Pj5BPDw7Pj07Ojo5
ODk7OTw9VWRiXl9eV1diWFdYV1hUWWJiUk1GREM9ODw4PD0+QD5APD06OTo+Pj1APjs5Oz07PTw6
Pjo5PUM7Oz1APDw+PTk7Ojw8QkQ+PTs7OTk8Ozg4PD46MjMzNTc1NTQ1MzU1MzM0MjQ1NTQzMzU0
NTI1NTAyNDU0NTEwMTMxNTI0NDQ0MzI1MzEzMzQyMzI0NTM0OTExMjQyNTQ1NDMxMzEzMjA0NDAy
NDQyMzMxNTIzNTUxLzQ5NTQ1NzIzMi40MDE0NTIyNTc1MDMyMzMxMzU1NDQ1NTQ0NzU3MzU1NDIy
MjIxNTQzMTAyNTAwMTc1NDIyMzQ0MDIwMjQyMjU0NTAxNzUxMjMzNTMzNDQzNDQxNTQvNDcyMjMz
NDcxMzU1Nzk1MzM1MzQ0NTMzNTU0NDUzNDUzMzE1MzEyMTI0NTg1NTQ1MjEzNTUzNTMuNDIxLzk0
MjM1NzU0NTQ1MzU1NTI1NTc0NDMxNDQ0NTQ1NTU1NTM0MDAyMTM0MzU0MzU1NTQ0NDU1NTQ5Nzg1
NDEwNTg1ODUzMzM3NTIxMzc3NTM1NS8vNDUzMTMzMDM1ODQzNTIxNTM0NTAwNDUyNTM0MzM1NzMz
NDQzNC8xMjQwMzg1NDMzMzEwMjUyMzEwMjU0NTc0NTM1NTQ3MzE0NTg1MjQ1NDU4NDM0NTExMjQ1
NDIzNDA1NTI1MTExNDU0NzQ0MjU4NTU1OTUzNzUxMDUzNTUzNTIwMTMxMTc0MTE0NTMyODg1MS8y
MzUzNTQyNDQyNDU7NTQxMjMyMzM1ODg5NTI0NTUzNDc0MTM1MzQyLzM0MzUzMzUzMjIyMjQ1MzIx
NDQxNDQ0MjU0MzMwNDIyMzM0MjIzNTUyNDc1MjUzMjQ0NDU1NTQzNTQ0NTUzNDc1NTg3NTU1MTI0
NDM0NzU1MzMyNDU1NTEwLDE0NDQ0MjAzMzk7OjQ3NzU4ODU3ODAzNDc1ODM1MzM1NzU3ODUyMTU0
NTU3NTQ1MTQ1NTQ4MzE1PDs1NDQ4MzQ1NTM4NTMzNTM1NC4wMTQ1ODg4NDU1NTQyNTQyNTc1MjQx
NC8yMzU1NDQ0OTk3NDU1NDI0NDc0NTUzNTU3NDUzMzczMDEzNTc1Nzc1NTQ0MzU1ODc1NTQ1ODo4
Nzg4MzM4ODg0NDg4OTg5Nzc3NDU5NzczNTg4ODk5OjI1Ojg5Nzc3NTQ1NTc3ODc1MzM1Nzg1NDMz
NTU4MzU0Nzo4NzU5OTs3NDU7ODQyMzU1MjU5OTUzNzQ1MjQ1MjIxMzIzMjU3NTUxMTAvLy8vMjQw
LjAxNTg3MzAzLzM1MjE1MzQ1MzQ3Nzg1Nzc3NDU4OTs3OTo6Ojs7OTs9Q0I+Pj49Pj46ODo4Ojg8
PD0+QkNGRUZJRTs8RT01NTk8Qj47Ojg8Pj4+OzU1ODc8RUA+QEA6Ojw6Pj4+QUlEQEVGQkNCQjw+
QDw+Q0BBRENAQkREQ0dNTk1QXFhKR01SW1NVUFVVYllXX19mZmhrXV5bXVlMR0pQWF9iWFVYUlJW
YIF9VDUxNDc3NTc6SWJbW1lQT1dviINyVWJkVUpDQkBFcG9bVlNSUk1OV1dXUkdJRE9PR0dDQ0pP
UFBOT01SU1RcblNKUFRQUE5QUFJQU1lpaVldYWVpZmRiZGJhYGJgeIqDYk9GR1dgcHt6b3Z6fYKB
f4GBg32BhIaCg3+DfXRuZFxLQUxWV0pKTExMTk1QVlxlYmdui4FtZ299eoF9dnl5hX93cXFwa2Vp
YmBfYmVXUEtDQUNOYGBkaGZqam1uc3Z7cG1xbW1vdmtrZl9kcnp9g4B9f4CAg3+Ae317eX18ent8
eXh6e315c3Z5aFlYX3N3cm5vam50c3NwZFlVUE5QV1VPUlJOT1JKTmFSSk1TUFRWVlJQUlJXWFVS
UFNXWWlvgXtwa2drcnBwa2ZqeHR3eXh6eHl0cnR0dHJvcHB2dHRwcXZ6eXJ0dmlhZF9fXF6c5b5h
MTVZa3BiW1xfYmJiYmFlYmlocnd6cW1qZ2lmamlocmJGPj1ER0dGR0lMR0RHQ0FGRDw+Pj1BQjw1
PEFOWVxmZmZiYV9iYV5XWV9eXV1ZWVtVU11US0U9Nz06ODk7RUtHR0lHTFBUT0pQTklHQUVGTkdG
R1BGPkJAQEFDPkNAQD4+REdGRUVHSUtKR0lLSUVHUltfW1xZYV9hYmptcW1ycm5rbm1hWV1cV1ZY
WVJYX2ZkZnF6fX98d31/fX97fXt7eXl0cm9wb21qa3BqYGdhXmFhX1RSVVZJSlldXllcZmVdWV9e
W11eX1ROUlVURUNCPkBJRFBeXWJhXVlXVVtnXEk7O0JJQjw9Ojg1Oj5AOEJcXWJlaWVnampzbWVt
a2RONzU7PTo4ODo9S2RobnFvcXJva21tbWVcST41MS8uMzAuMDMuLzA1QURHUExMVE9WWF1ra2lq
ZmtqaWdeVUw9Nzc6OTc1NTU4Ojs+PTs8NzU3NDQ4NTg3OTo3ODU1Ojg4ODs3O05fUkxUWVNHQjk3
NTk3NTo6PDk6PEBFVV9hZGdnZGVkYWZwV05LVWZlbW5mZGpqa2htcW9rcW5oaWtra2pra2tqamln
aWhpYmdraWJfX2BlYltcXExQU1lnbm1pa3N8b25wgX1uUFBQUFBSSUM9PDg4Pjo+PkZJUlBYVU9W
T1BQU09QTlBSRz1BTWJ0dnt5hnhpYl5WV1VZVllYWE9MT0Q7Ojs8Pj5JQT07Pj4+Ojk6Oj4+Ozo9
Ql5xYlthbXBgXGZeWVlXWVtXXmFXUFJQRjw5PD47Ozo9PkA9Oj07PD5APj05O0M9O0FBPT4+PT06
ODg8Pjs9OT5DRERKTk1NSkdKR01DPj07PEA9Ozw3MDQzMzM1NTc1NTU4NTUzNzU1MzIwNC8vMTU3
NzU3NzQ0MjQ1NDI1MzMxMjIwLzQ0NDQxMDUzMzQxMjMwMjIyNDI1MzEyMzM1NDU0NTUyNDEvMzIy
NDQyNDUyMTU0MjM1NDU0NTUyNTU4NDM0MzQ0NDQ3NTUzMjQzNTQxMzExMTMyNTU4NTQ0NTU1My4y
MDQ1NDI0NDU3NTM1MTE0NTQxMzI0NTk3NDU0MzQ1NDU1NTU1NTUxMjM0NTU1NTUzNDQ1Mzg3MzU1
NDc1MjM1MzMyNDUyNDQ1NTU1NTExMTU0Nzc1MDI1NDQ3NTU1NTU0LzI3NTM1MzM4NTMvNTc1MzU1
MzI1MzU1MzU4NzQwMzM0MzMzODU3NzU4MjQ1OTk1MzIzMjU1MzUyNTM3MzMzNTUyMi80MDUzNzs5
NTM0ODU0NDQ1NTU1NDU1NTU1NDc3NzU0NzQ0NTU5NTQ0NzkzNDU4NDI0NTU0MzU0NTU1NDU1NTc1
NTU1NTQxMzM3MzMyNDc1NTQ0NTEzNTU1MzU1NTU0MTUyMTc4ODU1NDQ1NTczNTQ3NTIyNTczMTU1
NTU0MTU1NDU3NDU4ODEuMTM3NTU4MzI1NTU0MzQ4MzI1NzUzNTU3NTQzNTM1NDU0MTM4MjEyMzAz
MzQ1NDMzNTQ0NTUyNTk6NTQwNTU0MjM3NzU1NTIxNTg1NDc1OjUzMjM1MTIyMzU1NDI1MzI1NTQz
NzM1OTQyLzU1NDUxMjc3NDAyNTM0MzMzMjIyNTU1ODQ0MzU3MzQ1NDAzNDc0MjI1MjExMjEyMzIz
MzQzMzU4NTQxMzU3Ojg3OTc1NzEyNTMzMjIwMzQyMjI1NDI1NTIzNTcxMjc4MzIzNTEzNTU1MjUz
NTc4Nzc1NTc0NTU1NTc6ODc4ODczNzU1NTU4NTU1MzU1NDU3NTk4Nzk5OTk5NDUzNTc7ODc0OTc1
MjU4OTg3NDU1NTM4ODk1NzU6NTUzMjU1NTg5Ozk0NzU1NDc0NTg3NzU1NDc3NTM1OjU3NzU1NTg4
MjU0MzU3ODU3NTk4Ozc1MzQzMzU1NTc3NDI1Nzg6NTIyNTg6ODc1Nzc3NzUzNTU5Ojg4Nzc1NTc3
MjM1OTo3OTU1NzQ0NzUzMTEwLy8sMjc1LzU1OTc1MjIwNDEuMjQwNDMzNS4rLDMxLzAzNTMzNzQ1
MzQzNTM1NDU1NTQ5Nzc4OzgzNTQ4NTU4NTU1NTc6Oj1APD06PUA+QEFHPj5BQDg4OTo9PDw6OzlB
R0lPS0ZAOz08ODs6OT5DR0E6OjtBRUM+Ojg6Oj0+Ojg6PUA+PD08O0JEPDc8R0JDQj49PD1AQUE9
PkBBRkRERURERktLS1BmWU5LQkNOXmVnYV5maFdUUFBTVFllb2dgT0ZKUF9hYGhkWVZWX11oaHBn
RjM0MjU8PUZSZWBPR1BQVFtbV1RZcG5YXVdOU1ZdV1dTT1VTSklQU01QV0pGVktDRUVGS09QVlZV
VlRPU1lYVFBPUE9QU1BJVVJVXmBcWV5gYmFiZGJmYltZWV+AuHhVUEpQWWZzeXZ3e32Bf3yBg4SB
hIWKg3+Dg4J7eX1pX0dAT3JhUEdJS1BSVFdcZGJpaWlqampwcHp7eoF3d3SLnIxya2RmaWRiXWBp
YlBFQ0ZGTFRlaWl4cWtvcHJxbm5yc3Fra3F4bmpeXmJwfH2ChYWGg4OCgoKBgYN9f4SAf4N9g3x9
fHt5eXdzYml3dHZ0b210g4FxdG1mXFtZVltcWU9TUlBPTklJQUZXWVZXU01PVVJSTk1OUFNTVVtg
ZGuEeGttbW9ydHFyc3x9fH2AgHl7enl7fXp0dHh3cW1zdnR3dHh6dnNwamZhYGJhYovI0nw+Qllf
Z2ZkZ2JoZmBrZWlvcXR7dHFvdHRraGZpZmh7ik4+QEFDRklHR0VFR0dKREI+PTs7Q0RCPjUyQk1Q
U21tZGVoZWFkYmBiX2BdXlxZXWBeWVBPST41NTI3OUdKQkFESktKT01KTlBNR0dHQj5DQT5BRkBA
Pj49Pj4+PkJCQjxCRUVHSkdHR0tLSUpJSVZfW2BkYGBdXWFianFxdHNvb25wb2JcXVxXW19iZGVm
cHZ4eXyAgX+AhYKDhYWFhoGAgXl0eHNtcG1taGhmZl1ZWFlZUlVUUE5cXF5iYVlZW1lcYWFhYWZv
VU9OUFNUST49QU5haGZcYGBgYWJeXWBhWFBMTVBYV1JKRT47RUA9UmJpcnZwdGdiZ29wcGtrbV5D
ODg5Nzg9PUZcb21zdHZ0dHh0dG9wdHRiVU1GOC4vMjEwLC4zPEdGREZPVGF5a11haGttbmtudGto
aGJZVUc7ODUzNTc0Nzk9QEA9QENDPjo6ODU5PDw5NTo9OzMxNTQ5Nzg9V1xQTVRoYllZRzg4OTU4
ODs4Pk5XX252dHduYmhuamtqZWdkZWJla2pzbWZlcnZ0cHB0cnR2b2tnaWlta2tqa2hqbmtrcHBr
aWZoaWlgYmFZWVhZV1VXZGlnaGZvbmdqdHZ8hHxvWVZWVVBKRDw3Ojo9OjxBSVZZXGtlWVlXVFNO
Tk1QS1JVR05vfHt0c3l9eHJweGtcV1dZWFtXU1JMQzw9Ozo+QUVBOz5AOzo4OTk8R0I8PEFMbnlo
YmJxg2dZXl1cYFlXXnRgUk9TWVZJRUY+PTs7Pjw7Pj08OkBBOjg8Ozg5OTo8PDo7OTw9PTw6QD47
QVBPR01SUE9TU1JUSktNUk5GPjo6PT0+PTQxNDk0MzEzMjIxMjU5OTUxNDM1MzIzNTEwNTQyMjU0
Nzc4NTU0MzQ1NTU0NTQxNDUyNDUzMzU1MzQ1NzU0NDM0NTcyNDQzNTQyMjM1NTM0MjUzLzA1NDQz
NDM0MTM0NTQ1OTU0NTU1MzQ0NDM1NDQzMTQwLDIzNTc0MjUwLjI0NzUxMDAzNTI1NDMxNDU1NTUx
MDAzNTU1NDQ0NDQ0NDMsMTMxNTIzNzIxMTM1MjM0NTM4NTM0NTI1NTQ1NDg4NTc1NTc1NzQzMDE1
NDU3NTU0MzMzODU0NDUzLjAyMzMzMjM1NDQuMDIzNTMxMzIxMjIuMzQ1NzM1NTAyNzU0OTk0NTQz
MDM3NTM1ODk1NTU1NDU1NTU1Nzg5NzM0NDU1MTM0NDc0NTU1ODk1NTQ0MzU3Ozk3NDM1NTU7NTUy
MjUyNDUzMjc5ODcyMDA1NTc1MzIzNTQ1NTc1NTI1NTM1MTM1MjMzMDIxMS4zNDQwNTM3NDU6ODQ1
Nzg0NTUyMzQ6ODgyNDUzNTc0NTU3NTU1Nzc1NDU3NTU0MjI0MTU3NDU1NTU3NTIzNTc3Nzc0MzMy
NDQxNDMzMjIyMzU3NDUzNzQ1NDg1NDIyNDU1NzQ1NDM1NDQ1NTU0NTU1MjEzMjEzNDU1LzA1Mjg1
MTE1NTQ0MjQ0NTQzMzczMjMwLzIzNTAzMTM0NTM1NzU0NDc0MC8wMS81NzUyMTM0NTQ0NTQyMzU1
ODgwMjc1NDczNTg1NDQzMTM1NTQ1MTAxNTUyMjE4NDIzNTgyMjU4MjUzNDM1NDIxNTUyNDUzNDQ0
NTUzMzI1NTM1NzQyNTQzNDU0MjM1ODU0MzEzMDI5MzMxNDUyMzMyNTg0NTUxMTQ0NDI3ODUyMzQz
NTM0NzQ1NTQyMzU0NDUzNzU0MzU1NTAyNTc5Nzk1NTUzNzQ0ODc3MjM3NTU4NDU1NTU1OTg0NDIy
NzgzNzU1NTc1NDc3NTU0MzU3Ojg1Nzo3NTQ3NTg0MjI1MTQ0NzI3ODU3MjU4OTczNTU3NzU1MzU1
NDc4NTU3NTU5Nzg3NTM3ODc5NTU1Ozs3ODU4NzU1OTU1NTM1NzczNTU5NzU3Ojg1ODU1NTMyMjU4
NTM1MzM4MTQyNTAsLykpMDMyMjU0MzU0MTIsLCwxMDI0NDU1NDUxLCowMjIvLDAzNDMvMC8xMi8s
NTQwNTk1NzU1ODQ1ODQvNTUxMjc3NTU1OTk6Ozk6PkJBPD5AQT4+PkBCQj06Pj03OkBDQ0BFSUpG
ST46OTw3OD09QDxARD4+PkFCQUNAQUJCPjw9OTk7Okc8Ojs7QkBCRD5AR0REQj4+QD5FREM+PkJB
RURES0dMT0pMS1RQTkZBPlBma29zcGJYUFBQUE1QWWRfXmZYVmVtb3NvaFtndn2JjWtZWFdUSj47
O0JKWF5TT1hYVlNYXFdZWVhWUFVqYFthX1hVUlBTTUZHSkdJTVVbUFBSSUdFREZHTlJUU1JSVl1p
YVVQUFBQUE9PUFBQWGJhWWViXmBiYmRlaGRbX2BiYWZ5ZldJQ0ZPYGtvcXZ8fX2AhoaIioaEg4mE
goWChIV3b2VZRkFSZFVOTU5QVFhZXWJgW2lnZGRmaWtveoF0dnNxeHh5eH1xZWJgYWFgZmJVR0VF
Q0dKUGVqaW5xbWtqbW1wa29tcHBram1oZl1iZnSCgYiGhoaGhYKDgIOGhoGDgX16eH2CfX17gHdy
cGppeX93dnN4dHGCinh5b2huZmRocnFyZ1ZMUlVPR0tHTHBgT0pLT1JSUFJPUE1OUFVXWWdwcXR0
b3Fubm5tcnR2eXqAgoOCf314e3+Ce3l2dHRzdHZ3dHx9eHyCeGhrZmJiZWZodJGOZl9tdG1ueXt4
ZGJiZGRocnh9hn14cnFvdHFub21ta3RtTUZDPkRHS0pFR0lJR0BFSkY+PkJGTEA9MDI7TU5UdG5l
ZGhmYmZlYWFiYmJgYV1fYGBZU05LRUA9NzlCR0RHR0VHSklKSkxNUE5LTEpOR0Q+PEI9PkJCPjs+
PDw6Ojw8Q0JHQkNHR0VHR0dGR0lYbWZgYWFhYWJiWWBtb3R5gHNycHFxbXBkYmRpbXBzdHR6e3x/
gYWEg4SEhomMiISGiIODf3h4fIJ9dmtnZWBeWVtfWFhfWVZQV2RhYWFhX2VkYmRlZWJmZWFVT09Q
T1tPRFBdXGBiYmBhYF1fXV1fXGFiXmhnYm1qYmRZU0dCPUdgbmpudm9qaGdua250cW5zaEo1MTU3
Oj5ATmt2b29vcHJvcnZ2cXRxdGphWGJQNywuMDA5PT1CR0dDR1NiZ3BuZmlwb2lucHBrbWtqamRe
UkQ+PTs3MzU7PT5APT08QEFBRENKSU1TT1lZR0tDOjU3Nzc7OUdTVlJTVWlvYl9URDg3OztBR1Bi
dHN2gnl8fXRua3Nxcm9qamtqaWhoZW5nZW1ze3l6c3Bvd3JvcHNrc3Bpa2tqb3FxcGtvb3BrZGVl
YGJiYFxZW1dbZGJqbmZmaHBta3B7fXN/j4liV1VPUFNUTEA+Ozo8Pk1gaHR5e3FycGhXUk9UUlRQ
VFlQYnt8e3l6fXx6e3t9cmhiYllYXldUU1NWR0FAQDs6PT48ODg8Ozk8PkxQVkdHR1Jrc3diYmRt
dGJeW19pYVtga2JZUldZWFNOSz48Oz5APjw9PDc7Pj09PEE8ODk8OjtAPTo9Oz08Oj4+Q0JiZl9U
VFRWVFdUU1BQU1tYU0tSRzs6PEA+NDU1MjQwMTUzMjI3NTQwMTAxMjU1NDg1NTUyMjAwLzMzNTc1
NDU1NTU3NzIwNDEvNDQ1NzQyMzU3MjI0MTMzNTIzNDIxMjIxNDM0MjM0MzIxNTU3NTI1NDMzMzAz
Mi8wNTQ4MzIzMjEzMzM3NzM0NzU1NzczMzU1NzQvMDEzMzIxNTU1MTI1MzUzMDM1NTg1MTI1Nzk4
MTE0NTEyNTUzMzI0NTQzMzI0NTU1NzU1Nzw1NTU1MjM5NTMyNTU1NzU1NTUzMjM1MjM0NDAwNTI3
OTQyMjMzNTUxNTUyNDM1MzQ4NzA0NTM1MDI0NDU1NDUzNTMyNDMzNDQyNDM0NTE0NDIzNDIyNTk1
NzU1NDQ1NTU3NzIxMjMzNTk3Nzk3NTI4NTM1OTU4NzM1NTQ3ODMyNDUzNTQ3NTMyMTAzNTc1NTg5
NzQ1NTU1MzM4ODQ1NzMyODc3ODQyNTQxMjc1MzIvNTU5NzU1NTU0Nzk4Nzg1NDIsMDU1NTgzNzUy
NTU1NTU0MzExNDIxNDU0NDc1NTc1NDg1NDMyMjU1NTU3OTU0Nzg1MjI3MzQ1NzU0NTU5Ojg1NTc3
NTU1NTQzNzQyNTc1MzU1Nzk0MzUzNDQyMzQwMTMyMjU1NTQzMzM3ODc1Nzc1Mzg6NzczNDQ4NzUz
MjM0MTIwMjI1NTQ1NTUzMzQzNzc3NDQ1MjQ3NDU0MjU0NzMyMzU1MjQxMjc3NzMzMDM4ODQwMzIz
MjU5NzQyMjIxNTMuMTQ3NTU3NTo0MzEwNTkzNTc1MjIyMTIzMjI3NDU1NTAvMjM0NDU1NzI1NTQy
MjQ3MzI0MTI1MjE0MzQ1NDQ0MTMxNTQ3NTQ1NzU1MjQ0NTQ1NTc1MzgzODc0NDc3NzU1NTMzNTc0
NTU7OTU3ODQzMTU0LzU5NTIzOjg6OjUyMTU0MzU0Nzw3NTc1Nzw3NTU1MjQzNDc1NzQ1ODg4NTQ0
OTk3NDc0NTI3NTE1NTU0NDUzMjU3NTgzMjU1NTUzNTU3NzQ1NTU1MjU1MzM1NTM1MTE4NDU1NDg3
Nzg1Mjc1NzUzMzIyMzU0MTQ0MzU1NTQxNTQ1ODQyMDU4NTg7ODU0MjQzNTQ1MzU1Nzc4NDQ1NTg1
NDAyMjEwLC4pKSwoKSwsLi4wLzEzLywsLCwvLCsuMzUzMC8vMDE1NTIwMDIxMDI1Ly8vMjAxMTk7
ODk1Nzc3Ojo4NTk5OTc5OjU3NTMzODk4Pj08REQ5Pjw5PD5APjw8Ozk+Pjo8PkFCQkVHR0dHRkZE
Q0NCQ0JBPT5LRD0+Pj48PUNAQD4+Q0NHQj5BPj0+RUBBRkpMR0dGREdERkRDQkVGQ0VFRkRCQkdN
Sk9QR01QS0pcYlBTZnZ0b21tZ1hSU1BQTkxXYGdZW2RtbXJ3emdYUobH1tO+fVBNYG5vZlhXVU1c
a2JWXmV0aFlXXmJeXFtTVFVVWVlnZFhQU1BUSUpJQ0NET09QX1VEPkFDRUZJUFNVV1lWVlVZVk9Q
Uk9OU0dKT05WYl5fa3JgX2RmYGJiZmViYV1fXGFdWVBERlJYZm50d3uDgoKEhYKBhY6KiIOBhoF/
fXprZF9JQlBZVFBTVVRZX11gYmViZGV0bmZpa2pvcHqJcm90bm50dG1lYmJiYmduXkM6PkBBR0dV
b2tpbW1qbXFva21ra3BxbW9oamJdYF1icH2EjpGMhIaIhoaGgYOIf3yAe4GDfXl9gH19fXl4cHiE
gH1/hH19enZ4fXtrZYKMc2txa2lyYlZVU0tEQ0pQVFNUVFRVUlZTUFBPWFBQV1lXZWtxenl0cnR4
cm92eIKAhYKIg4GBhYSDgHx9hH15d3R4eHx9fH2Ek554aW1vb21tb3F2f31xamtua4N/a2ZlaWpl
aXF9goaGfHh9eHR5g3Zwbm9tcmtVSkdNTkxLSUZGRUdFRURAQD49QUdDQDgwMDRETlZlcWhnaGtq
aGZqaGRiYmRiZGluYFdUV1BBPkFDREVHRUpKSUlQVFBLT1JMS0dHR0RDQUE+PjtARj47PDo5PT48
Ozw7QEE+QkVER0ZFR0dJT19iYGViYmFiYl9daG9xdHp/dHJzeGtnZGJoa3Jyc3R5fYKJiIGEgYmN
i4yLjo2Nj4yJiIaAg4B7g3RubmVkZFhZZl5eV1tbVVNmZl5fYGJoamVkZ2lkZWZkZFdPU1NSW1lV
YGJfXmBlYmJhXl5dX2BeZHd9d29ta2lnZmlhXExHW2tpa3FyeXpyc21tc3ZycXuBXkpNQUBERUle
eXZxdHNyd3x3dnl2cHRza2ZgXlxKNS80OD4+QkdCR0dPV2JmYmJlbXJwa3FycW9yc3BuZ15XUktM
Pjg6QD5DRUVDTU9OUlRST1VVXV1ZXWJUVlA+NzI5Oj1BTVRVVVZWYl9fYmdTRUBGT11rcYqEeHp2
dHp4eXl6d3ZycnB2b25raGZwb3FudH17eXl5dnhzdHJweW9vcW9ucGttbnN0c3JweH1rYWVlZGhk
XGFgYGZra21ua29ra2p0dHN2c3R2eGtiaWdiZFdXSTw5PkZPYXx5eHR0d3p9iXdbVVldX2JiZWRx
f4F6fXyDgnh0en14em9iWVleXFdZW1ZLPj49PD1HQzw5Oj1HQUZQVE1XUlJWam1qenRoYmdtZl9k
YWJdXVxdYWBZWVteal1NQD06PkBBPTs8Ozw+PD1CSkNEQUA+Ojo6OTw+PjxAPkJGT2ZfVVJZVVRT
VFJTVFRWYVVZU1VJRUE7PTw1MDUwNDU0MTQzMzMxMzk1NTc0NTUyNTMzMTMyLzQ1NTIxMzM0NDQz
MzUyMzUzNTUyMzUzNTU0NDU3NDA1NTUyNTUyMTQ0MjUyMDQxLzI0NDQ0NTc0MzI0NTQzMzUyMDEy
LiwyMzQ3NTU1MTQzNDEuMzQzNDQ1MCwzNDIzMzQzMTM1NTc4NTM1NDIxNDQ1NTIyNTQ0MjQ1ODUw
MzMzMjIzMzU0NTUxMzM5ODc1MjIzMzQ1NDMyNTU1NDQ1NS4yMDAuNDQvMTEwMzU1NzU1MzQxMzEx
MDAzNDU0MjM0NDExNzI0MjEzMTMzNDU0MjI1NTM0NDQzNDQwNTU0NzMyMzQ1NTIzNDQ1NTU0ODcy
MzIxNDU1NDE0NTQ1Mjg1MzM1NTU3NTk4NTM0NTcxMTQ1ODo1NTI4NTU1NDU1MTg3NTc4NTU1NTU4
NDU1NDU0NDU1MzMyNTUzNTM4NTc3NDM4NTM0NDU3ODU1NzUzNTM0MzI1NTQ1NDU3MjUxNDg1Mjc3
OzU1Mzc3NTQ1Nzg0NTIyMDU0MjQ1NTIvMjU1NTIxMzU4NTIxMTQ1NTU5OTUzNTQ0NTc5NTI1NDIx
MjUzLzE0NTc0NTU3ODc1MjI1NDEzNTQyNDc5NDQ1MzQ0MjU1NTIyMjI0NDU3OTUwNDE1NTQ0MjM1
ODQ0NDU1NTIyNTUyMzMxMzM0MjAwMjU1MzQzMzQ1NDU0ODUzMzc1MjQ1Ojc1Nzg0NDM0Nzc0MjM0
NTU1MTIwNDMyNTQ0NTU0NTU3Ojc0MjQyMjM3NTo1MTM1MzI0MTU1Nzc0NDI1NzU4NTM1NTUzMS8z
NTU1NTU1NTM1NzIvMzEyNDQxNDM3NTIzNTUyMjU1ODczMzU1NTU1LzM1NDM0ODk1Mzg1MTU1MjMz
NzU0NzU1NTU1MzQ0MzI0OTI1My40NDQ1NTMxNDc1NzU0MzUzMzUxNTQyNDU1NTU1NzMwNTU1NTU0
MzE1NTU3NzU0NTQyLzI0NTI1ODo1Nzk1NTU5MjI0Nzg3NTU3OTU1ODc1NTg3NDc1PTk1NzU3NzU3
NzM4NzQ1NTM1MjM3OTk3ODU3NDM3NTU0NTc1NDc1NDU3NzU4ODcyMjc6NzU3NDM1NTc1NTU5My8u
MisrKioqKyYqLissLDMvLywsKissLywsLDM1MTExLDAsMDAuMTIyLzAwMTQ0Mi8sMDAzMzk6PDg3
ODk9Pjg1NTs7OTo3Nzg1OTUxNzc7Ojc+Q0E+PT0+PkFBQD0+PDg8PD48OT09PDs9PkA9PUFAQDw7
Oz5BRE1MQj49Ojo7Oz08OzxBQ0dJRD46PkE+PkZSSklEQ0JFTGpQPkZBREdDRENCQkNCQkFLVU5N
UFdfYmtqX2JucnBlYGFibW5STk5TZGtib29ocnZ8b2dXU01QfLLazppTQ05ceoR5dGlYVmFweVtW
XmZvYmdraGJeX1tbVVNXV1hZWVdQSUpLSUdFQkVFR0VTST5EREdHS0xQUlNSUE5SVFVSUFBUUFNQ
TktSTF5pamtiYmFiZWJeYWViXWZrYmBfXV5VS0NDSk9YZHB9hIiJfYCDhoKGhouJhoiCgH99d2tm
XkdGWVlXXVxYW19haGJiYmRhZXh3aWJlZWlrdHZrbW1ta3FrZWBiYWJlYVZGPj4+Q0ZMUFVwhG5q
a29ua21vc3RvcW1raGpiWWBhYmdrhJGPho2PjomMiomJiYiGhYSGgn19gYKCgX99e390iX18fYCD
gH19fHp8jn1viYZtZWplaGdmXlJQTEpHS01QVVRTUFBSVVlVTk9YUFBQUFhodnh6eHNyeXhza3J9
hIWLiIaJiImGfYKCgoSFgX2Bf3t3dnyGg4aKgHRucHh7eHd5eXh7gHt0cnBwfXRraWtkZmp4hoWD
gIKGhIJ9en+LfHNvcnR2ZVhWXl5lYFxtYllLQ0E+Q0ZEQUBDQTw7PTAsNDtSVltlaWJkaWpraGlq
Z2dqbnN2hnBeVVh8aEM+QkJAPkNGRUpMR01NSkxMSUpKSkdKSkpNTUI8PD0+QD07PUJFPDw7Pj47
QkVHR0ZLR0pERFJqZWRkX2FlYmJiYWJmZ2pyfHx7eHl4ZmVnb3Z2eXx7goWDhoiGiI+LjIyMj4+N
kY+OiomIiIaDgn13cm5paW1lV1VgWVlZUk9QVGhnYmBhZWZkYWZmYmZra3RtXVVPUFdfXHBkYl9m
ZGFiXWFiYmJgYF9peH16cG90dG9ubWtqbmZna2tuc32ReWtrcXBzeHBzeoyUcFhSU1NTVnR9dHl2
fHx9eXt7fHl7fHRqcm9lYl5LPTo8PUBMWVdMTVdXWV9lYmd2e3h0dHRzfH13cWtqZFlNR0lGQkBC
R1RYWVliWVVbXFdSVVldXV1WXVhUWE0+PEFHRUdTWVlZV1lZWVdcZWBfXGFtd3yCiIB4cHR5dnR/
eX16e3p3c3Z5emtpamhubnZ3eXRzdHd8eneDeHFyb3J4dnFvcnR0cXB0d3d4c2tvamprYmJfYmFk
b2toaWhrbm9vdnZwc3l7d3h6dF9fYmZZWWBfT0VFVl5ve3h0eHl2dHt/eG5naWJiXmJebX2AfH99
g4aCg3+CkYZ5c2BdXllZZ2JmU01BPjo7Oj1BPjtAV1lPTUtQTlBQV11ya259f2tiYmhqYmVhYmJf
XVlXVVtXV15uWUxNQz0+PDo+Pj5BPD4+Pj5JR0pMTkxHQUE+Oz5HUFBSVllhYllUVVVSVFZSTk9Q
WVVSVVBNU01NSUQ7PjAxNDQ1MTMzMi8wNTExNTQ0NTMyNTUzMzEzNTQyMDIzMi8vMDM1NTAwNTUx
MjU3ODgzNDUvMTUzMzUxLzAyMDExMTMyNTIxLy4xNDI0MjQzNTc0MjU1MzQxMTMzMzE0NTUyMzI1
NDEwMzIyNTEvLzE0MjEwMTQyNTU0MjQzMzUzNDUyNDIyMjQ1NTUzMzU1NDM0NDMzMjAwMDIyNDEv
MzUzNDEvMDU0NDU1MjIzNTU1MjM0NTM3MzIzMzU1NDUyNTM1ODUzMjQ1MTEyNDEyMzIwMzU1NDQz
NTU0NTI1MzM3NDU1NDUyMzI1MTczMjIzNTc0MjczMTQ1MjIxLjE1MTExMjE0NTUzNTc1MjIzMzg1
NTIxNTc1MzU6NDAxNDUwMTM1NTQyMjc3NTUzNDU0NDU0MzQ1OTU1NDQ0NTk4NTU0NTI1NTU1MjU4
NTU4OTU3NTM0NTU3NTMzMzMzNTU0NDQ1NTc0NTIzMTIvMTU3MzM5NTQ0NTQxMzQ0ODU3NTU1NTk4
NDU0ODQ1NTIzMzU4NTU1NTIyMzQ0NDU3NTU0NDc3NDMyMjMyNTEzMTQxNTQ1OTc1MDQ1MzQzMjU0
Nzc3ODc1NTc4NDMzNzU0NTE1NTc0NzM1NTc3NTU0NTg1NTQzMzM0NTMzNTM1OTgyMjU5NzU1MTM6
NTg1NDAyNDc1MjMzNDQzMTc4NTQ1MzU3NDg1NDMyMTE0NDQ3MzM0MzM3ODM3NzU1NDI1NTQ0Mjc1
NTU1NzM3NTM1NTQyMzIyNTQ1NTU1MjU1MjM1ODU1MzU1NTUzMjE1MzUwMDIxMzM4NDg3NTozMjUy
NTU0MTE1NDIxNTUyNDQxNTc1NTU1NDU5ODgyMjM0MzU1NTMyMTQ3NTQyNTQ0NTU1NTg3Nzk4Nzcy
Mzc0MzU1NTU1NTE0NTQzNTM0MzM1NzUxMzU3ODg4NTczMzIzNTgzMTg7NDQyMTQ0ODc0NTMyMzM1
ODk1MTM3OzkyNTU0ODc1Nzc7Ojg3ODo0MzU4NDI4Ozk3NTg1NDIyMzQ3NzM0NDQ1NDUzNDMxMjU1
Nzc5ODU0NDQzNzs3NTU1NzU1NTM1Ojc1NTo6NDM1OTg1NTc0NDU1ODUzNTU0NTUzMjc1LywvLCsp
LC4pKSooKykrLCorLCssLCwuNDUzMjQ0NC8vNDAsLCwxMjAxLCwvMTA0MjIwNDI0ODk1NTU0PUBB
OTc1PTo4Nzg1NTk5OjU4ODw7PjxAQ0M+QEA9PkE9OT09Ojs5Oz4+QTo5Pj06PDw9Pj4+QD4+Pj1F
S0lAOjw6ODk5Ozw9QT5BPkdQQDtATUdFR0pLTUdERUJGTUdDQkZAQURGQ0FBQ0ZEQ0dVWWJkaXFu
a2dqXl9la2dwZmmCdFxPU1l4d2VpgXh8i4BnUExQT1BZfbWvbUdFSVlwfXZwbmp4f2FYU15iXWVr
YmVnamhuYmVZUlJbWVlgYldQSkdgVEI+QkU+PkRCREBEQkdLTlBQUlRVUlZYVVlYVVNTVFZPUExV
anZzbW9rZWJmZ2Zub2JhYmJfYWFgX1JFPUFHT1Zicnp/g3t9iIGDiI6PiYiNiIOJhoB2bWVcTV1l
YV1dX2VpZ2hpZWJkYGRmZmdeZGpqamptbWpoamZnaGZnYltdYmBUREA9QkdMS0pMUGFua2lobnBv
aGlvamp0cmhnYVRVam5kam9/i5GPj5GLhY2MiYqIhIaChYR/hIaGhYaAiY17cnSKgYCBgYZ/gYB5
fYaOfXFrcW9pam5mZ2liVU5JSUZJTU5TVldTUE9TWFVSTkxTU1NkeHmJhnp2d3RtcHNxcoKLiYWF
hoiOi4aIiYSFgH2BfXp9gX94eHRwcndwcHN9f4GGgnt3eYiEf3p0cnB3cWtua21pa3yUj4iDhYSD
gIB/e4CCiHtzdp18X2iEa2JgXGRlXFZXTklJSj48QD5AQTw+O0NNSlRUYVlZXGJqbnFub29rb3F0
gI+jcVhukp5bOTc6PT5HR0RFR01KS05OT01LR0pPTEpJSkxMQTk6Nzg8PDs5QkJCPTU1NzU6PkVE
UEpGSklOa3JmZGJiZW1uaWJlYmJlcXR9e3d9d3Ntb3R0eoGCgX2ChYWKjY+Ij46TlJGSlJSRkpGP
jYaIjYaDfXl0cHBvcFxQVFhXV1ZWVFdea2JdYmtuaWlpaGpubmtrcnZmU1BTVllcYmFfXWZlYmBg
YF9iYWJlYmt2dHJ2dHRzd4F4b3OBdIFzZm5wdHRxdHR0dHt4d3F2hJiOallbW1VbfYN0dHx9fXx4
fYF7eXd4dHBqcW9oZmBJPTw+VGZpZVhWWVhZZ2RlaHF0eHx4fHp0dnR3cm5iWU9NTktKSk1ZXFhZ
ZF5ZXW5dVFhYVlZVVlRbWFRZW0RAR0ZDR1VVWFhTWVlZX2RrcHd9enh8eXp5eXd7e392eIN9gH15
e3l7enhza2twcW1xcnt9d3Z3enp/f3txb3Fyc3R6cnd2dnd4fX19dnRzb3FvbWhpZl9fZGJqbW5u
bWprcXNzcHR0dHd0dG9nZF9fZGRhaHZkX19cZ3d6enR3dnR4d3l7e2tmXmFkYWR3gn19fYGCgX18
fYCBgHt6bV9kZWJlX1lVU0k6NTgzNUFDQEdbU0tJTFNPS01QW3Fvb3t2a2Fmf3NkXF1lYmFeWVJV
WVVWWVdQS1NEODU4NzxBPj4+PD5CR1lbTklLTlBPSUlFTlZhYmFiYmdoZ2JcUlVcVVlUUFtbWVtS
TlBOUE5TTEE4LzEzNTEyNDEyMTM1NTU0ODI0NTU0MzQxMS8vMzU0NTQxNDAxNTExMjQ0NzUzNTIz
MzIyLy8yNTMzNDIxNTUwMTI0NTQyMjAzMjI1MjM1NTU1NDQ0NTMwMzUzNDc1MzEsNDQvMDM1ODQx
NTkyMjQ0NTQ0NDk1NTMyMjI0MDI1NTM0NDAyMTQ1Mjc0MDAwMSwsMjQyMTIxMjAyMTE0MTA1MTAy
MTIyLzIxMjIxMS4xMi80MTIzMDA3ODAvMjMyNDIyMjMyOTU0MTAyNTAxNDIzNzMzMjU0MTEzNDk1
MjQ1MTUyMzcyMzQ0NTU1MDE0NTU0MjIvLzU1NTMzMjMzMzMyMzc3NDU1NDQyNTUyNDEzMiwzNTU1
NDc0ODQ0MjQyMjg3NTc1NTQ1NDc1NTEwNDE1NzczMzc1Nzk0Mjg1NTkzNzUyMzMzNTM0MzU4NTUu
Mzg1NTUyMjUzMzMzMzE3NDg1NTU1NTg1MTExMzU0MjQ0ODU0NTU5NS8uLzg3NTQ1MzU1ODUyNTIy
NDQ0NTU0NTI1NDU0NTQ1OTUzNTQ0Nzc0Mi8xLzM4Nzc1MjUzNDU1NTU0NTQyMzc1MzU0NTc4OTU1
NTQ3NTc1NDU3NTo5OTU0NTU1MjQ1ODQyNTo1MzMzOzU5ODg0Mzk3NDE1ODU0NTg5NDk3NDU5NTM0
NTQzNDU0NDQzNDU1NTc4ODU3NTU3NTU1MjI1NDUyNTU3OTQ0MzU1MzU3NTQ1NTMyNTUxNTQ1NTMv
NTc0NzUzNTQ0MjQ1MzQzMzQ1NTU1NC8vMi8wNDUzNDE1MzU1MjAxMjQyNDQzLzM0MzUxNDU0NTUy
MzM0NDEyNDc1NDQzMjM0ODUzNTM1Nzc3OTI0NTQyODQ1NTU1NzUzNTgyNTIzMzI1NDQyMzU1OTU1
NzUzNTU0NDQ1MzAxMjU1NTQ1NTUzNzQ1NDMyMjQ1MDIzMjM1MjQzNDM1NTMzNDc1NTc1MzQzMDQ1
Nzg4OzU1NTg1NDI1NTU1NTMyMzk1NTQ1Nzc0NTg5NzU5Nzk1NDQ0Mzk5NTI0MTQ3NzoyLzAzNDUy
MjM0MzU1ODc1MjM1NTczMTQ1MjU7Nzc3Nzc1NTU1NTc5NTM1ODU4NTg0NTQvLy4sLCwpKicoKCkq
KionKScrKCcoKS4sKzI1MzE0MjEyMzcxLioqLDAsLDAwNDMyLzA3NTU4OTk3Nzg1NTw9Pjw3Nzs5
NTU1Nzk6ODc5Ojk3Ozo9PT4+QT48Pj4+Ojw9Ozs6Ojw6Oz4+PDw8QEA9QkM+Pjw8Pj5DRElMR0I9
ODU3Oz49PDo5PkE+RElBQUZPR0NAREdPUEtJR0lFREBJSUpLTEZHSUdHR0RGTllZWVtVV15pbXN4
aGViYGFeaG9zdmJbWXGVfGmJmIp/alhMSUxLT1tpcXNiUktOVV1qcoaRn5yMWUxQZGlfXGFgYF1c
X2BdXl5VUFBYWWlfU1NNS1BKQUdDQz46Q0lCPkNFS09OTkxUVFVUU1xiW1RUVVdWWFBOTF9rb3Bu
bnRyZ4JtYGBeYmVnZmFfYWFfWEk8NUJKSldqd32GfXt9hIOChoqDhoGJioabhHNqZ25ZYWVnZ2Rr
eHhxa2RkZWhmaGZnZmdiZGJkZWdpZmZmZWBgYVxXV05MS0E9PkBHTE1HSkxQVWBoa2tqcXNwbm1z
a3OEbmJcUFtpcm1rcnuKlZOTlJGPj4+MjYqGiYiGhYaBf4OAgYGCgHx5eYKIj46EjIuFioaJko95
cHJucG9ra2tra2hZTE1NSk5QVFJSWVNQVVhdUE1OU1VQVJLNyLyPd3Zzb3Nzc3F0g5OPiIaGjo+N
jImLhIWJhoaFf4B/goF9c3Nva3F3fIOChI+KfX97hoJ9gXx9fHp0dIl4dHJzhI+OioaKiYaDfYSC
gHl5dneAjGlhcnBva2doam5kXVlUUk9JQz4+QEM8PUNHTUpQUk1WV1BYaW9vcHJzcHaBhntuc312
i8S7hlA5Nzo7QUtFRklHR0dHS09QT01PTEtMTk9OTVlQQTMzNTk8Ojk6PDk3NTg9PDk7QkdLQ0dP
Slt0a2JlaGZkbo55YmBhZGBlb319enpwdm9ygIKEg4SEhIaJi4uSko6OjY+RlJWPk5SPjo6PkYqd
j3p4enhydGhbVlJUV1ZXWVxZVFlkYmBmfHBoeXFoaGtvb3JxeHpkT1NbXF5hZmViYmVhYGFhYmRi
YWJham1zdHRzcXN8f3l0d317dnJ7enR0e3h0enp5eXd4doh9eXRmYmVmaHaRinlyfYaCgIOGgYKF
eHJxbW10b2hrc2JOX2JwmItrU1ZZWVliZ2dpcn2Dg39/f4B5fXt3bmdbUE5QUFVgXVdWVllfXFdZ
ZVxdaGJWW1hcWF1dVVheS0dERklNX11bXV1ia29rc3l2e3x7dHd4en1/e316fH9/gn+AgH9/fXx4
eXhxcHFwdHN0gX17eXx6e3p3dnt4dIB2dn+CgIF9f4ODiHt5dnBycXRxa2poZ2FhZWp8cWtwdnJx
dHZxcHJzeHR9fWpramVpcW1rcGhoZGV3gHx5fXl7fHx0eYKGg3JhYGFlboWAen18gYODgoiCg319
fYaBZ2RiYlhYW1tZT0w1MjEyOz1CTExMTE1QUFJSWVlTb3FoZWViZmlvaGFiZWVfX1xZV1dZWFRX
WFBVVVJAOj48PD4+PT09PkJOUlBHTVBPTFJQSVhkYV1gYmJiZmtmZGdXUlJVWFJUYGdiV1dTVFNQ
UFRZSkQyNDQ1NDU1NTM0NzU0NTQ1NTI1Nzo1MjAzNzUzMjIwMzQ0MzMzNTM0Nzc1NDU0NTMwNTIz
MzM0NTU0MjU1NTI1NDIyMDM0MzUzLzMxMjA0NTEuMTIvLzEyMTIzLzAzNTQyMDI0NTMyNDExMjQz
NTMxNDEyNDU3NTIyMDU0NDIzMzU1ODIzMTMyMjE1MTM3OTU3MzM1MjEyMzM0NDM0NTAxMTE1NTIx
MzQ1NTUxNzUyMzMyMjEyNDU1NTU1ODQzMzU3NzU0NDMvMTI1NTMyMzQ0OTU0MzQ1NTU1NTQyNTU3
NDQ1NzMzOTo1NDQ1NTUzLzAxMjQ1NDE0NTk3ODQyMTIyMzQ0NzUzMjM1ODU3ODc1NTQ4NzE3ODU0
NDQ1MzI0NTU0OTU1NTU1NDQyMjMyNDM3ODU1NTU0MzU0NTU1NDU3NTc4NTI1NzU1NzU1NzQzODU1
NTQ0NzU3ODgzMjM3OTg0NDQ1MzIwMzEyMzQ0NDU0NDQ1NDUxMzE1MzMwMTE3MzE0MzU4NTQ1NTUz
MzM3NTI1Nzg4NTM1NzIyNzQ1NTM0NDM1Nzc3MjQyNTk1NDU1NTQ1NzEzLzQ1NTQ5NTQzMjM0MjU4
MzMxMTM0NTczMzUzMDI0NDUzMzM1NTQyNzMzODIzNDU1NDU1NTczMjM3MzMzNDQxNTUxMzQ1MjM1
NTgxMDM0MTExMjIyNDU1NDc1NzgyMTU3NDQ1MzUyMzQ4ODEwMzU3MzQ1NDQ0MzU1MzMwNDU0NTQ1
NTUzMjU5NDQ4Ojg0NTIzNTMzMzUzMjU1MzUzNDQ0NTMyNDUyMDQzMzQzMzg3NTM3NTMwODc3NTI1
NzUvMDEzODIxNTMxNTUzNTc1NDQzNDQ1NTc0MzUzODg3NTM0NDU0NTU4NzQ0MjA5Ozc0NDQ0NDU0
MTQyNDQyMDAsMTQ3NTI3NTg3NTU1NTU5NTU1NDU0MzM4NzI1OTgzNTk3NTk1MzU1NTQ4ODQzNzk1
NTI0NTUzNDg1NTg4ODc7NTc1NTg1MzQxNDU0OTk1MzQ1NTQzLjM0NDQ1NTU4NTUyMTQ3Nzg1NTc3
NzUxMjM1OTU4NTU1NTU1ODUzNTc1NzQ1NDg5NTU0NTg1NTQ0NTc5NTQyLCsqLCwsLCknKiolJysr
KyspKyssKS4yMjExLzIzMzE0MjAuLy4qKzAwMi8wMC8yMDE1MzEyNTU4Nzs1Nzw8OTU1Ojo5OTo9
Oz03NTo9OTo7OTw9PkBAQUZKS1BOQDk6PTw8Pjo8QEA8PkJAQENDRURAQ0dDRUJFSUpJQDo5Ojw5
Oz1BPDw9PkJHT01WVEdBPkdHTFNiVktHR0dHRkZHTExLTElLTElHTVBSUlBQVlRQVFlbYn1wX1xZ
YmRVWV5neGhWXICEdnqNe2RZU01MTVRcUFBWV09PU1NPT1BSYpeypnxUSl1iXl1bWFlZV1dbWVxg
aFlQT1ZfaGZbUlNOR0VGPkE+QkJAPkBBQ0tOUFhTUFdWU1ZUU1lgXFthfGJUSk9UZ3RvbnJwdHZm
ZmtxaWZpZ2VmYWFiXV1UQzo1PEJKU2FyfIN9e3Z9gYCFhYqOhoOFg41/cnBreGppYmVlZGpzdHNr
ZmBkZmZnZGJkZmRiYmJiZmViYmZhZF1WVVhQRUZAOzlAQ1JPTUlPUFRTW25zf3hxeXR0cW5xdG5o
ZHBuaWpoaWpudImKjZWUl5aMjIuSj4iKjIWChIJ9hX+Ako6Af3p9goWnp4aBg4mXi4OKjnxvb3Jw
bmtpcHFrZVNLS05OTE1LU1ZVVlNTU1RPVVVUaVRSle/96byLdG9wcXJvcHJ/lY+Oi42Nj5GMioOG
iIuNhIN8gYCAhXhtbXOBfXmJi4yPhn2Ag4KEgoWAfHh7iH16fXh0c3ySlI2KhoOGiIaGhIF/f3qD
hJt2Ym5yd3RoZmtxdG9pYmJhV1BHR0dQQT5ER0dGS1JPTl1eW1hZYG15fX17dnR9bl5qjLLErXFJ
PTo9OT5CRkBAREZJTEtPUlBOT1BPUE9LTE1OTlBSPjU1LzQ1NTU7MzU7PTo+Ozs9OT4+QURQXmht
aWllZmttiHtlZGJpZWhveHl4cm9zb3+IhYOGhYaTkomNj46VlI+Sj5WSmJiXlZiWkY+Pj42CfX2E
hHtqXVhUVFldVkxTW1JTVmtrYmV/c2t0bnFvcG90dHSCnHxmYFlbX11maWJhZGtpZmZfXmBiZGFq
dHR0cnd9f3x5fXt/jqiOeX13gI2Fgnp5enZ5dHF6iXppZ2pxaWpqdIiDgYWCgX2GjIB9enN3dH1y
bWprbXB5dGCAd3GBa15ZWVxcXGJna210iI+GhIaChYB7gXxwaVlQS0xOU1xVVVdWWVdYWFlZXFte
W1ZZXGpgWVlWVVdNUFlHQUNbXmFia4SPhHBue3aJhXp3dnl8fHt8gICDhYiDhYN/fIB7end8eG5y
dHZ5c3eLhnd2eXx8enp4eXp0c3p3fYF5d32Bi4aBenJwcXFwcW9uaWh0YmJla4N8dHFucnJ2d3x4
d3Z0g4+Fb2toZmtudG1qa3l2doKGgX19fXt9fYN/gIZ/cGdlZWd4jYF9e4CChYaGhoaDk5N/hopv
YGBpYmdeZVlQYkIzMTg3O0RPUFRTTldXWVtbWFtma2dpa2dnamVtamZiZ2JbVllXVVZXV1lYU05U
Zl1AOTk+QD47OztHSkdLR0dNT1VPVVJVanB0aWViYmlpYmRdZGFSUE5QVE9SW1lVWVhZUFBQVFdW
UDU0NTQ1NTQ1MjEyMjgzMjE0LzMzNDAvMzUwMDU1NTg1NTc1NTQxMzg3OjQ1NTM3NTU0NDU3NTIz
MzQwMDQ1NzczNDMzNTAuMzQ1MzMwLzIzMy8zNTQzODM0MjM4NTMyMTAwNTQzMzU0NDUzLzEzMjM4
NTAsMTI0NTU1NTUyMzQ1NTI1NTU0NzU1NTU3NDE1NTI1MTU1NTU1NDI0NDQyMjMxMjIyNDU1NDQz
NDI1NTI0NTM1NTUzMjU0NDc5NTg4NTQ1NTUzMjU0MC80NDU0NDM1MzM1Nzc3MzM1Nzc3MzMzNDU1
NDMzNTEzNTk0MjMyNTU0MzMzMDM5NTMxNTUyNTMyNTU0MDEwNDQ1NTU0NTU1ODUyMjQ1NTMwMzQ1
NTQ1OTU1NTg4NTEzNDU0NDI3NzEwNTk1PDo4NzgyMjU1NDQ0MzU1MzI1NTU3ODUzOTU1NDc3NTU1
MjM1NTc5ODU4ODc0OTk0MzU0NDk1MjI1NTU0MzU1MzM0NTUzODc1NTM0MTU4NTA1MjI1NTc4Ny8w
MDU0MjIxMTU0NDU1MzQ3NzMyMjU3OzU0NTQ1NTU3NTMyNTU3NTEzNDg3ODU1NzU1NzUzNTU1NTMz
NzU1NDMzNDM0NDQyMzQ1NTUzMzc1NTU3NDU3ODQzNDM0NTQ1NTEzMzI1MTE1ODU1MDA0MjE0NTMy
NDI1NTUyMzUzMDM1MzIyMDUzNDUyMzQ1NDM4MzQyMzg1NTQ3MzI3NDMzNDM3NDQyMzAxMzQzMzU1
MzU1MzIzMDc4NDM3NzUzMjMzMzI1NDQyMzM0NTEyNDc1NDExNTA1NTU0NTMxMzEyLzI1NTQ1NTUz
NTQzNTU3NTU1MjEzNTQzMzg1NTc3NzM1NTQ1NzM1Nzc1NDE1NDQ1NzQ3MzIzMjMzMzUyMTM3MzIz
MzExMDIzMzQ1NTU1NDQ1NTUzNTg4ODMzNTU1NzU0NDc1NTc7NTc4NTI1Ojo4NDU4Nzk3NDQyNDQz
MzUyMzU1OTk1NTczMzU3OTQyMzg4ODo4NTg4Nzg1NTU1NTM1NDU0NTU3OzU1MjI1OTU3NzQ1Nzg3
NTIzMzQ0NDM3NDIzNDU3OTc5NTU3NTI0MzQxNTQ3NTU1NTIzMTArKSwsKikrKisoKyspJSwvLi8w
Li4xMzM4NDIyMTQ1MS4sMS4rLC4sLzAsMDQyMzM1NTc1NTU3OTU1OTk5Ozc3OTc6OT07Pj48PDs8
QkVBPjs9QD5DQ0RERkpTan1QOjc7Pj4+Pj48PkU+PkJAQEVHRkJBRkRFR0ZDREtJPDo4Ojk8PkBA
PTtAQEZLT1thWUdFR0VKVGJZSUZMSk1HRklKRkdMTUlJS0tQUExQVVVXXV5lXVtfZWFfWVhYYGRq
amVcVVNUXG52eIV4XVBKR0lLTVJSTlhdUlBTUk5NUFJnho6XakdUbWJbXV5eWVtfWV5ZXF5cXVhW
Z2hqal1bXFhQS0Q9QEVGTEBAQ0BHVmFTWV5VUldeXlldYmZXVVthU0xLUFhnc3ZwcnBzdGJpc3Rv
ZWRnYmViYV5YWVhHOzg+OD1HWXuIiIKGdHSGhoCGioyRhY6FfXdua2hzaGdnZWZma29tZmhqZ2tm
Zm1vamZlYl5gYWJiXl9iYllSTUlMUExAQkY9NThBV1BQW1BTVVNZb32EfXh4fYGKfHRrbXFzeG5q
aGlra3F9hoaIiouWkZiVkoiIhoGIhIOEgoGCf3+KiIGNf3iCiIyPlI6IjI2IjomWm3Rwd3xxa2tx
dH1iU1JQVFNXVFJSVlZUVFxpXFVrXExTUE1z1v363qZ0cnNvbWtteIaYlI+UkY+Oi4uGhYaEhIKD
gnh9g4WOfGtpa3SDipKRjYmGiIWAg4OFgX2BfX13d3N0dHl6gY+Tj6ORhoyLi4uFhYSLiJOWjHp/
g4yOhHRvcHNycHFoamVeVk1GQ0M7RU5HQkZLTUxTV1lrYVRZZHFqaGpkYF5bWWiFn5hiQDg4Ojg7
Oj4+R05WUlBVVlhfX1xUU01PTk1OTlBQWVBGPjQyLzQ1ODM1PDc1Nzo3Ojo5Oj1DS11kZmpqa21r
cWqEb2JkaWtoaHh9dn15dnp6iY+Ki4uTkpKPk5OYmJWSk5WSk5GVmJuYmJiVl5OWlYaDfYGAZV1e
WVhTVWJXVlZVVlBfanBpcG9ta21xcG9tc3Jzd4GKf3h4XllhYV1kZWhrZmtlZWJlam9iYXNuc3t6
eXuAf399fX2RmIl/fX+Kk4Z8e316eX93cXKDhXlvaGlramprdnqAhH1/hYaIhn19fXp0dHNvcXlx
anGAc3lvYllVUlVVWWBiZWdxdniKjIiGg4qGgoOAgX1vVkxLSklSU1ZVVlhVV1ZZWFtfYldXWV5Z
Xl1cWVxYX1NNU0pFR1JfYnF9hYOUhXN2eoR8fYKBgYN/gX1/g4OGi4iBgYWFfXx7fH+FfXh2fXl9
gpSEfHt8dHZ6dHB3dnd9fYN3eHp8hYF9fX15dnlycG9vbm1raWpiZGFla3N0cnN4dHl6d3h8fHiG
g3FpbXNramtuam9xeX+GrZd9fIOEgYCDgoOCfXtxZWtoaH+EfXyAgoKAf4ODiISNl4h9goFoYWJi
Yl1bVVVTPjk4QT5CT1VUW1hXWVlZXltfXF99hnNtcXBqZm1tb2phYF1ZVlZZWVdSV1hdaF5vd1NG
Pj4+OjxSVFNQUEdHSkZNVE9QUFdqgYxtX2JnZmFkZWBcYldOTlJQUlZTV1VYWWddVFBQUFdbMzQy
ODMzNTEzNDUzNTMzNTg3NzIyNDUxMDc4MzMyLzM0MjI1NzUzMzMzMjc0MzIyMjU1NDM0MjAxNDMv
MjQvMTQxMTMyLzM1NTU1MTEwMDE0NzU0NDU1NDIzNTU0MzIwMzQyNTMzNDM0MzUyNDM1OTUwMDI1
NTIzNTQzMjA1NDQxMjU4NTc1MjU0MzQ3NzQzMDE1NTU0NTU1NTU1NDQzMzIzMi8yMjQyMzU1NDUz
MjQ0NTo1MTI1NzU3NDU3ODQyMzMyMjU0MzUzNTc1NDU1NzU0NDU0NTIzMjIzNTcyMjQ1NzQ1MzU0
NTQyNDQ0NDUzMzQ3NTg1MjMyNDQzMjAxMTExNTU0NDMyMy4xNDEzMzMzMzQzMjU1MzU1NDg0MDQz
MjQyNzczMzI6ODQxNTU1NTg1NTUyNDI1NTU5MzMzNDQ0NTU0NTM1Nzk1MDA3ODUwLzc3NTMzMTIy
NTQ0MzQ1NTg1ODo0MzQ1NTQ0NDE1OTUxNTUzMzU0MjQyNDc6NTQ3NDU6OTU0NDg3NTc3Nzg1NTQ1
ODc0NDc1MzI1OTg3NTAyMzQzNzI0NTk1NTIyODo1NDg3NTQ0NTUzMzU3NTMyNzU1ODMyNzM1NTU0
MzU3MzM0NDQ0NTU3MzM1NTQwNDQxMjU3MjI1MzQyNDU4NTQ4OTU0MzMzNTUzMjMzMjM0NTU5NTM1
NDQ1MzU3NTU0MjM4ODM0NTcyNDM0MTQyNTU1MjIyMTE1NDEyNzUvMTQ0NTQ1MzQzMzU1NTUyNDA0
MjIzMDQ4NzU1OTU1MzQzNTU1NDQyNTQzODQzNDMzNDU0NDMyNDIzNDA0NTU3MjAyNDUyNDQ0MzQ1
MjI1NTEuMzU0MzMyNzQ0NTczNTM0MzU1MjQzNDIxNTEzMzI1NTQzMjIzMjMvLy8wMzMxMTUvMDMu
MTQxMzUzMjU0MDIzMTExMjQxNTc1MjQ1OTc3NTU4OTo3NTI1NTM0NTU4NTU1NTU1NTUzNTIyNzU1
NDUzNTU0NTU0LzMzNDU1NTM1MzU1NTQ1NDU0NDU1NTQ4NzU1NDg5NDc1NTU1NDQ3NzU0NzgzMDQ1
Nzo1NTc3NTU3Nzg1Ojk1MjQ1NTUzNDg3NTMzMzUzLC8zMC8oKykoKSYnJiwrLywqKS8vMjUwLDU1
LzM0MSwuLjEzNTIzNDQzMzIxNTQ3NzQ1ODg5ODAxNDg1ODg6PTU6Ojs4Oz09OTo7PEJBQEFJSUxF
PUNFRUVHSUVESUtVa2RMSUNHSkRCPkZHRERGRURHTElNTUpFR0dGQ0RFRU1DPTo9Ozw8Oz1BQT5B
Sk5NTUtLR0lQSUdOXVZQUE1MTUxQT0xHR0xLTEtMUE5PUFNYWFheYmlyZVlcXV9bWFVZYm9hWVJS
UldbXmRzfYBeWU5HTEdNTVNUUlhXU1RNTE1OU1RYYnJWS2JrYF1fXV5XVVxZWVtcW1xghHNobWdi
YGRlYFxXUkU+Q0ZGRERGSUdQVlJPVFlbW11eXGV8dF1caGBZVU1QW257d3R0cHZ5aHF6dHNtZWtp
ZWlnYl1XUEE+NzxBQkpWb5iUg3hpdH19gn+AhIiFhoJ6dnNucXFqZWl7c2preXJuaG1rbmpnaGpm
ZGJfYmFcZWViZWRXT05KR0ZFPTU1PjkyNDxLUE9UU1JTVV13hHx4fX98gZKCdnhyd3NzcnZraW5u
d4iPiIWNj46OoaGekYmGhoOFgYCEgoOEiIN9enuAe3yFj5+TiIOBg4SGfYOEf395kn90b217fWFX
VllZVFJSUlNQVlJQU2JdT1RQUE1OUnCh0dfDnHpwf4VzcG1whJyYk66ai4uOj46LlZGDg4WEhIaE
j5SKe21oc5icjI2MjZ6qjIGEioWJhX2DgoN9dnZ2en+AgI2Nj5GTj46RjYqOj42Jj4+PjYiEgoKD
fYB9enRzcnJyc2dbU0M8PENUWVNMTlVSTlBPT09TTFBUWFVbXllbVlVbTkdER0M9Nzk6OkU+PUdU
W2ZmZmlramtrbmhxYldQUlNWUFJiWE5JPDEvMDU1MjU9ODU5Ozk4ODdDRUFHXmZiaGdqbnNwcGtl
Zm9pYmJkeH90d3h5e4KPk4+SkpWVkZOYmJibmpqYlZOYmpqYmJGYmpeWkpGSk4x4b2VhWVNWW2Fg
W1NXWVlbVlRZb3uVem1ub29ucXR2d4GGhYOBgIJlXWtmYF5gYl9mam1nZ2hqamdnb2prbnl7f3yC
g314gX2GhHt9f4CAjYuCf4GBenl3cIB6cnt3bW1ram9teIGChIWDeH2EfHx8enR0eXRzdIFycH94
ZVlWVFJQVltcYF9iZW5wd4CJjImAgouGhIGGjG5WSkdOTFRcVlhXVFlYVlxbV2JlXmFdXl5iXGFh
XFtcTURDQkRGTl9ne3+Di56GeYmUiHt3fYB5fX2IhoWLjIiLio2MiImChIF/hYp5dnp6eHR9fXp8
eXNwb290cHN0dHh6eXZ5fHp9e3h7enh0dnRxcG1va2tnZ2hkYFxhbnl4dHp5e3t/f4B7cndvaG6G
eXlxa29rZ29ueXqOl4+GgYOKhYF/g4aEfXJudGlpfICFgYKCf4KDhYaGhpaenZKDgmlcXmhfV1NQ
Rzk3OkNAPklUUltpamBcWVtfZG5gYI+Dc29xcHJtb3Fra2RfWFdYVVdWV1lZU1VhYXqGcmpDPTw6
Pmt9WUtHSU9MTk5QVU9QVmh7dGtoaWhoamhlYVxYVVJQUlVVVlJYVVZcYldQVVJNUFgvMDI1NTM0
NzIzMi4vMzIzMzAwMzM1NDMzNTU0MjIxMDIyLy4xMjIyMjIxMTMxMzM3NTU4NTQyNTMvMTAxMzMz
NTQxNTU1MjUvMDQyMTMzMzM0MjM1NTUwMTM1MzMyNDU4NDIxMjIxMTc3ODQ0NTU1MTM1NDQ1MTEx
Mzc1NzI1MjQyMzQ1NDAyMzQ1MzMzNDE0NTU3NTIzNTU5OTUzNTc0Nzc1MTEzNTQ0NTcyMjE1NDM0
NTE3ODU1NTUzNDQyMTA1NTc1MTI1NDEyMzM1NTM1NTIzNTMzNTg4NDg0NTU0NTU1NzU1NTQ1NzIy
NDMyNTg0MzUyMTI1NDU0NTU1MzExMjUxNTc3Mzc0NTQ6OTMyNzU5ODU0NTQ0ODU1NDU5NTczMzc3
NTQ1NDI0MzIwMjc1Nzo7ODo1MjAuMDc1NDU0NDU3NzMxNDQ0Mjc0NDc3NTU0NTQ1OTg1NDEyNTQz
ODc3NDU4MjI0NTU0Nzk3NDU1MzM1ODs8NzU1NDU1NDQ4Ozg1NDUzNDMyMzU3ODI1NTU0NDU1NzU4
NTU1PDc1NzU1NTc1OjUyMzk3NTQ6NTQ1NTU1NzMyMzMxMzU1NTM3ODU4OTg4NTU1NDU1MzQ1NTUy
NDUyNTQ5OzU1OzkzMjg1NTM1NDc4NTUyNDM1ODU1NDIxNTM1NDM3NTUzMjU1MDE1NzczMzQ3NTAv
MDQvMjMyNDI1OTg5NTM1NDM5NTMwMTc4NDMzMjE1NDU1NTAyNDMwMTAzMjU3ODc1NTUyNTU1MzQv
MDM1NTMzMzQxMjU3Nzc1MzU0NzU0NDQ1ODQ0ODM3NzQ0NTUzMzU1NDc1NTc1MTA1NTIzNDQyNDEv
NDUxMS8xMjIuMDIyNTU1NzMzMjQ3NDI0NzQ1MjUzNTM0MzIzNDEzMjQyMzIyMjUyLjMxMzMzMzU1
NTIzOTUyNDc3MjIzMDQzNDg1NTcyMDM1MzU3ODc0NDAzNTMzMDQ3NTQ1NzI1NDMzMTc1NzU1NTU3
ODU1MjU1NTEyMjU1NTc0NDM1NzUzNTQzNTU1NzQ5NzM0NTU1ODc4NTU3ODIxNTU0MzU5NTU3NTQ4
NzU1NDU1NTc1OTc3OTg4Nzo1NDU0NTQzMywqLCorLCsnKSooKCgpJywsLi8vMjIyMjMyNDIxMCwy
MjIwNDg+Ozw+PTkzNDg5ODs3Ozo1NTU4Ojk1OTk5ODw7ODk8PDo9Oj4+QD4+Pj5BQ0NCU089PkNC
RERDR0VFSVJYVlBQTE1NSUdLS0tMS09QT1BQUFBSU1BPS0tHRkVESkY+Ojs7PkNFRUNHSklFRUpO
UlNXVU9VUlNhYFVWU1BTVVJUU1VQTVBOTVNTV1hXWV1gYFtXYWtramJkYF5gXFliZmhZUlBSVFZc
ZGpvYUtLUk1LR0pPTE1QXF5bXGBZUlNialRLT1BicmJZWVxcWV5iX1tXWVdcXmVtaGVvZWJre3lm
WVdVTEtLTlJOUFdYV1VUVFBVXV5iYmVhYWZhYWRfXmJxWFNed319d3l7fXxre4GOemplZ2RhZmpl
YV1YSjo5QUZHVGBrfYaIjXRwc3x9gH+Bf4SCfYR9eXJ4c2RlanBzb2t/fGdpbmtud3luaGZmX2pu
X15ZW15ZWFdKT0pFRkdGPDk1NTQ1RklNV1ZcYVdSZn+BgIR9hn19fHyGfH18e3Rva21va3F0ho6K
iIiGiYqYlIWGho2flIaBhomSlYWBgIh/fYqFfHyEoI2OiYSDfYF9e3uGd3J2eJSBcXt4YllYV1lX
WVRPUFZiVVRkYFZSUFNVV1hSVFdkjJqNhXl3eHR0cnJ9i5KYmpSPjI6Pi4SKmo+EgYCChomPlpqG
cm1/mpiPjIuLi4+OiYaMi4mEgYKDhYB8eHd9gIODho+Yp52Pj4+Rj5KPipKPi46Pj4+Mg4aEgYZ9
e3h3b2lpamJfUERDS2dpYmFhX2pcWFZNTlJQUElERUZLTF5WRD47Ozo7Ojw9Qj09QUNHVWFtbmtq
amtoam1xdnRraF9XVllbWVVWTklAODIwOTQ0Nzw3Oj0+Ozk7PEVKQExfYmh9bm90dHF0dnRra2tu
a2ZpdHl9jYaDjYuIjZGSj5aWmJ6amJufm5uWlpKXnZyYm5qbmJWSko+NgndrYV9rZlNTZmFZVlth
XmBZT1h0fYV8fXdtc3R2enp5fIKIhYiGiHxybWhgZWdkZGZqamtrbmtmZWFpeHh0d3h9hICGhX16
fH+Gf3l9hYOIhYWDhIB9fHtwcGhpb3lwaXFubmt0e4GJhYWFfHh4eXp7eXx3enZ0d3R6iHlZT1NV
VFhbWWBiYmhna25zfYOGiomIhoiGhoaCa1RHRUtQVF9cVVhVVVVZXFtfXWBfX2BeX2FgYmVgW1ZH
Qj4+RE1SXmVygpKCeX2CmpR/f4GFhoSEi4iJjI+NjouPj4mIhYKChoWFd3J3fIyafG9wdHNwbm5w
b3JwcHp4fX16eHx9f4B8end0dHZ2cnFvb3BvbWtnYWFfX2Jod315dHR2en16d3l0f3x0aoyTdHFr
aGdrbXBvcXiVk4iChYKKhoOChH9/eZvRnWdrd4aCgIGFhoWGiIiLuNCceYGKa2BhYl5ZWE9FOTIz
Pj0+XVZQWVxiYF9oZV5hZl5me4J5cnN0c3R0dnhvYFhWWVVZWFloWVBQVlVbZ3NoX1NWQzlNcXRc
UkxHSk1TT05UV1RUaX1waWpqZ2pubWtqX1ZSUFZTVFJUV1hZYmJbW2FcWVhhbzU1NTQ1NDIyNTUw
NTUxMzU0NDI1NDU3MzMzNTIzNTMzNTc1Nzk1MDIxMzQyNTU0NzU1ODc1MzI1OTUuMjMzMTM1NTgz
MzUyNTU1OjUzNTUyMDIxMzUyNTUzNzc0NDQzNDE0NTM0NTQyNDI0LzQ0NC81NTg1NTQzMjQyMjMw
MDMzNDQzNTEwNTQ1NDU0MDQzMzU1MTIyNDIxMDQ1ODc1NTU0NTUxNDM0NTQ3NDMwMjE0NTg0MTM3
NzIwMjIzMzQ0MzE1NzEzNDQ1NDMzMTIwNDcyMjIzNDEwMjIyMjM1MjQwNTUxMTQ0NTM0NTUzNTEz
NTMxNDM0NDQ0NTUzMjc1NTQzNDQzMzU0NDMzNDQ0NzEzNTQ1ODUzMzIzNTQ0NTUyNDc1NTM3NzU0
NTQyNTQyNTU3NTc1ODc3NTc6NTI1NDI1ODc1NDIyMjIyMzQxMzU3MzIzMzU1NTU3NTM1MzU0NDU0
MzM3NTc0MTQ0MjMyODQ0MTM1NTU1NTQ1NTk4MjQzNTIxNzUzNTUxNDM1NTI1ODQyNDc1NTUxMzE1
NDU0NzEzMzIyMjQyNDIzODU0NTc0MzQ0NDI0NTIzMzQzNTM1ODU4NzQ0NDQ0NDUzMzM4NTU3NzIw
ODAyNDQ0MjI0OTQ0MjM1NTQ0MjQzLzEzMjQ0MDI0NTo1NTc1NTExMzEyNDM1NTc3NDQ1Mzg0MzI0
NTM1NTQ1NTI1NDM3NTU0NTU1MjQ0NTUyMDI3NDU1NDQ1MzMzMjU3MzQ3NzQxMTI0NDEwMTM1NTU0
MzU3NTE1MTA3NzUyNDU1LzE0NDQ1NTIyOTc0NTUzNTk1MDQyODU1MjM0NDM4OTc1NDMyMzgzNTMz
NTg0NTU1Mzc1NTc5NTI1NTU5NTU5ODU1NTc1MTU1MjIxMTMzNC8wNTAxLzAvMTIxNTEvMTIzMS8x
NTIzNTU1NTU1MzU1NDczMDA1NTU1MzQwLzU3Nzw1MzU1NDU5Ojk1MjIyLzQ0NDU0MTI1NzM0NTQ1
NTU3ODU0NDU1NTU3NTUzNTU3ODgzMzU1NTMzNTQ1NTU3OTg4NzI1NTIzNTU1NTQ1NTU1NTEyNDU3
NTc5ODM1NTg7OTQ1OTc1ODc1Mi8uLCopKiwqKywpLDIuKyssMDAwMzUxMDExNTM1MSwwLy8uLzU3
Pjw9Pj5CQkM8PDk9OzQ0NTg4NTU5Ojg4Ozs5PTw7PTs6Ozo4O0BEPj1BQD1AQ0FCRUJDREZKTEdJ
S05WWVlVVFRMTExWVlRQV1NUUlBQUFJTVFRWT09SVU5FQkFDRj01PT0+Q0RKSUlKR0VHR05UWVRX
WF9YVVVZVVNQUFJUUlNSUFBOT1NTVFlYWVtdXWBdXGJkZGlrbWZkZ295cWtpZFRQUFZXV1dgZmZZ
RUNLTU1HSkZMTFRbWFlcZltgX2BtWUpFTnR4WVtZVlhdW1hWXVtgXVldXl9kemhbXmJta2hoYmVb
XWBlcWpZZWlfWVhYWF1fXmBcYGJiYGBmYmRkZmJgaWJlb3N3endwZGVpdnRqZmRfYGRiYWBfXFRG
QDtBSlhkboZ8fYCJhHBudnd3gIV9e3l7gYFzc21oZ2Rna3J8c3NxcXFxbnB0bmttamlpaWhiXVdV
UlJSTUdCQD5BRz41NTU1My88R0xQVVdWWWJ6gYOFhoaBgYaLhoJ7fHp6eXd2cnRzcHeGjYyIho2P
i4mKhoKCiIOGe21rdICMhoOCj4OAmI57goqPi46Oj4aDiZJ8d4F7c3J6eXd4d3Rqcl1UV1lZWVBN
Tk5QU1RQUFRWUldZWV9eVGF/eX19d3Fxdnl/kZGSlIyLiY+PjIaKi4aPjY6LhISKi5GRj5WJeo6h
lY2Ljo+OiomLjomPjI6UhoJ9gYOBf4F9hIaIjpehn5iVj5eVj5OXl5WUk5aTjZKPjIWIhoV/fHp5
eHJ0b2ZlYoSVdGlnamtugHJUUE1OTk1MTExHRT5AQj47Ozc1NTU4ODtAPTc+SlZbanFuaGhraWtx
bnFzcXRwbmpgWVhXVFRTS0U7MjM0MjI3OjU4OTg1OTU4Oz5BVWJrbnBwfYmEgoF9ent5fXt0dHN0
d3l9j6GOio6Rj5OXk5KUmJudpaGanZKRlpeYlpqdl5qUj5OVlY+FcGRhYWJhXWJeYFxdXFxedG5W
VGaDi6OkhH14enl5fH+FhoOGi4uPiH97eHRzcmlqamJoaWtoYmJkYnF4d3l7goaIhIaGhIOAgX19
gISGgYWajIiFf3t9c2tnZ25wb2prcXBra3R0epGNgXh9e3N0d3d5d3hyb3R4fX2OhlxMUFBSWWRf
ZGRkYmlob3yDhoaLhoiKj4+IiYZ2WUpMTVNfXV1YWVxgXlldXV9iYmBZYmFhYV5iYFhXWEc+PUVN
WGBiZW95fHyEnI+Lg4OBhIaLjYyJj4yNjoaIjY2Si4SFhIGCg4Z7eHR9hYl/dnRva2tqa2pubWZv
c3J0c3t8fYGBfXp5eHdzdHN0cGppa2tuamVqYl1bXF1nhIGAe32AeHR0b210eHRrhIZrZmttamtr
dHJ0fJahk4mGhoaEioaGgIGIyvjCaWV3gYJ/gYqIi4qIlZysso19mI1raGVgW1hVV0cxMDU7O0NX
UFRhcGJfYXRrYl5iZWt5fXd3cnZ0enhycGphWFhbV1VbX1lTUFVSVFNUUl10XVVQUldhaXFfVVNT
UFJQWVhbU1hpd3FrbW1wbWttcGhiX1tSTk9TVVdeXmBvcHBpe3d6fXmAMTQ0MjMzNTQzMzIzMjM1
MTAwMTE0NTMxMTExMTMzNDQzNTQ0MDEyMTI3NzkyMTM1NTMxMTM0NDQ1NTc1NTQ1MDEyMzMzMiwx
NTU0MzI0MzQwLDMyMDExNTc1MTI0MzUvLzIzMzIyMzU3NTQzNDMxNTQ4MjEwMjQxMjU1MTU1NTUz
MjIxMDU3MDAxNTc1NTU1NTU0NDU1NTIwNDQ1NDIyNTc5NTUzNTgzMTU0MzU1MzQxMzM1Nzk1OTU1
NTQ1NTIzMTU1MzEwMDQyLzM4NzUxMDE1NTQ0MjAyMjEzNTU0NDc1NDIyMzQvMTM1MzE1NDQ1NDc1
NDUzNTMzNzQzMjM1NDM3NTM1MjI1MjQzNzU3NTI0ODg1NDQ3NzUyNTU1NzcxNTQ1MTA1ODg1NTc4
OTU1NDI4NzQ1NTU1NDg3MzMxNDc1Mi41NTIyMTU8NzU0NTQyNTc1ODQ1NzkzNTUwMzU1MjU3NDc1
MjEzODU6Nzg1NTk5NzU3NTQ0NDc1NTQ1Ojg1ODg6NzUzNTUyNDg7ODU3OTc4NTI0NTQ1NTQ1NDU1
NDM1MzM1NDM1Mzo4OTg3NzU1NTMzMzU3ODIxMjM3NzU4NTc3NzU0Mzc1NTU1NDQ1NTUzMjU1Nzg0
NDU1NTM1NTM3NDQ1NTExNDMxMTMxNDEzNTMzMTMzMTQzNDMzNDQ0MDQ1NTc1NDU0MjU0NTk1NDIy
MTMzMzE0NDQ1MzMzNDg1NTUyMTU1MjMzMzc3NTQ0NDMzNzc1MjQ1NDQ1MjIzMzI1NTc1NTc3MzM0
NDAvMjU0MjM4NzQwMzMwMTEwMTIzMjM4NTUzMTM4OTQyNTU1NDEyNTMxMjMzMjE1NTU0NTUzMzM1
MzUwNDIzNTg0Mzc1MjE0NDQxMjQ1MzIyMSwuLzMzNDEwNC8sLzI0MTIvMzQ1MTM1Mi8xMTE0MjEx
NDM3MjQ0NTMyNTM1NTQxMDI4NDIyLjA1NzQ3OTUzNDU1NTQ1NDIxMzU1NTQ1My8xNDQ0NzUzNTc3
OzU4OTc5NTU0NTc3ODU1NzU1MzMzNTU0MjU5OTM3ODU1NTc1NTo7OTc1MDI3NzM1NTI0NDU1ODk1
OTk3NDU5NT05Nzk4Nzk1NDAxMzAuLC4sMjMyMjEvMS80MzQyNTg0MC4yMzQ3Ojc0NDIzNz0+QEJD
Pj5CQkE7Nzk9NTQ3OTUzMjI+PTU1NDpBPT47Pjw8Oj49Pj4+PUJBQj5AQkFARENCQUdJTE5UT1RZ
XFxYVk1OTlBXVFRXUFBSVFRTVFJTT1BSV1tXUk5FQkFJQz4+PkZNU1NVV1dUUFBSV1lXW2Joa19Y
WVxYWFlYXGFdWVtbVVhXXl5cXmFiYl5kYmRlYmZlZmVqc29yf4h6fXxfTk5SV1lYU1ZpaVxHPD1J
Uk5LT09QVFNVVllcW2FmZ2tfRkVPZ3peW1lbXlxeW15cYF9fX2JibXd9YmBfZWZpa3d0d3Fna32A
cl9laGFnYlxZW1ldXV1fYWRiYmRlaGliYmdrYllhcnZ4cmhiZGVmZmZoZ2VlYF9fYmBcVlBGR1Bf
aHR8enyCfYGIf3Bpb3R8gXR8gHdydnR0dmhiaGJncHl9d3t7d3R3dHF5d3BrbWhiXmJZVlZUUktF
R0Q+OTs7Ojw4ODUzNT5HU1hXVlBVan+JhYOEk4+EoMuzhm93fYOChn17e3t0e52kioWNjI6MhYiG
hoF7fHxrYWRncniEjIOBgYCEf32BipaPjoySiY+Ghn97hYF0a3N0enNwbWt6ZVVVV1RQUE9OTE1P
UFZTYVlVWF9la2ZeX397eHZyeYCPmpidj4mPjY6UkoWIhouOhoSGiouDhomGioyMkpaLm52YlZSR
lZGJkZKRj5qmjoaGhYaJhIWDfX1/i5ianpyalpaXmJWYnZqbmpSSmJSPmJqNjJGSj4uEg4WEf3Nu
aWJqdnZranBxdHebk1VNUlNSTlVQTEtMR0JAQjo1PDg5ODk4ODg1OkpXX2hzc25vcm9ucXNvcXN0
dnBrbWtiWVlYVVZOR0I8NTIwMzQ1NTk6OTk7OTk4PkdWanJ0dnqChYWIjYqGg4R/gX99fH19iqCO
iYiUl5aXk5WbnJaWn56dnaOhl5KXm5uYmJialpGPkY6GfHRmYmBcXFlfYl1iX15fX2BrcVlQX4aY
kot/gXqDgXiAhYaCiIuNiYyGgn2FhH94b2hpamZmYmJiYmRueHt/gH2DhouIiYaIhIOEhn2ChIWJ
hpOGhIaRhHZzcnBrbnR4c29zbmlebXJweoF5dHl6d3dydHdzd3R0dHt/hY97UExMUldYYGlnam5z
bWlpdoCDhomEhoSGhoSDgX1hUE9PT1RYYFlXWFZYV1dYXWJhZF9iZGJfXV9eXGBcSkVLXV9cX19i
dHh5fIqMgoSGiIiGhIWGj4+IjJKMk4+PjYqNioiAfICEj3x5e3l7enpxcXBqZmlpb3FoZ2t3dHB4
iICAiYN9eHp3dnRvcHJuaWtnaG5pZWVhXllZVl2LiH14f3t0e3NtbWlpa258fG1ra25wbnNwbXd6
hqmekY+RjouPjYuDgrDk64xiZHiBfX19goaGiIiYloiDgYafjWprZ19bXVBQOywwND4+SVVSU150
aGZoa2hnZWhrbXZ9e3d0eHZ5dnBydm9cXFlYV1RQUFBQU1NPUFJVXHJhWVRiZWJhZ19XVFRUUlNb
XVNUWWV/e3BtcG5zcWtramRhX09NUlJbYGZoa3BweIOloZN0a2g0NDQyNTI0NzQ3NzkxMjI0NDU1
ODU1My4yNTQyMTEwMzA1NTMyMjExMzMyMzM1NzEwMTQyMC8xNDczMjMxMjM1NDAwMTM1NDEuMTEy
MzI0NTg1Nzc1NDMzNTIzNDc5MjM0NDMwNTU1NzM1MDIyMjE0NTQyMDU5NDU5NDU0NTQ0MjM4ODQx
LjEzMjMyNTUwNDc3NDU1MzM1NzU4NzQ1NTU1NTUyMDEzMzE1NzQ1NzQ4NTQ4NTU1NTM4NTQ1MzU1
MzQ0MzUzMzUyMzU1MDI1NzU0NDU1NzU3MjM5NTU0NTc1MzIyMzEyNTMzMzE0NTQxMzQ1NTc0NTQz
NDM1NTcyMjU1NTU1NDU3MTQ1NDQzNDQ0NDQ0MjU1Nzg1MzU4OTcyNTU1MTAyMDQ1NzU1NTU3MTM1
Nzc3NTU1NTU4NTM0MzM1NTQ0NDQ0ODU0MTU5NTE1NTQ1NDc5NTU1NTI1OTc1NTc0OTk4NTUzNTU3
NDU1NTU4NzUzNDo3MzQvMTIzNTU1NTg1MzEyMDI5NTU5MjM0NTU1NTU0NDQ1NDc1ODUzMTMzNTU3
OTQ1NDEyNzE0NTMzNzc4ODU1Nzc0NTUzNDIzMzU1MjIzNDU0MzQ1NzM3NTU3NDU0Nzg1NTEyNTU4
OTg1NDI1NTIxMjM0Nzg0MzQ1NDM1MzQzNTk3NTU1MzU7OTc0MDMxMjU0NDQzNTc1NTU5NzU1ODU1
NTMzMzM0NzQ1NzUxMjU1NTQ0NTU4NzU1Nzc0MzU0NDc1MzIyNzU1NTIzMjM1NTM4MzQ0NTMzNTQ1
NTEzOTc1MzQ1NTU1MjI1NTI1NDIzNDM1NDc1NTk3NTQ0NDQzMjU3NzU3NTcyNDo6Mjg1Mzc1Mjg4
NTc6Nzc4NzUzNTQ3ODU0Mzg1MjMzMTIxMjAwLi4wMzM1NDAyMzQ1NTQvLjE0MjAyMTIvLzI1ODQz
NTMzMjUzNDQ0MjQ1NDU1MjU1NTM0NDQzNTU1NzI1MjEvLjAwMjQ1NTc0NTQ0Mzc1NDU1ODU1NTcw
LDI0NDc1NTU4NTk4NTU4NzU1NzI1Nzk1NTg4Ojk1ODM1Nzk1MzQ1NTUzOTczMjQ0NzU4NDQ1Ozs5
PD49QEBAQUFAQT46NS8uLy4uMDEyLCwvMzMzOTg4NzQ3PTgwNDpAR0dEQ0A8Nzg8QENFRUZBQkE+
Q0I+OzU4Pj05OTs5OkZBNTM1PT49OTo+PkA+Pj5APj5AQUNFRkVDQEJCQklQWFZYWFVYXVldW1ld
V1BTU1lVU1VWVFZXVlVZWFhXVlhZVVhVVU5KR0ZCQURHTlNZWFxdXFdcWVhbV1tZZXlyX11fXF1f
XF1iYWBgW1leYV1dZGJlaWlnZmdoZmdlYmJkZmhvcW19YlNYWVJQUFJQVVRYZ21rWUU8Oj1EUlRV
V1hSTlZYWVhZW2BxeXBQT19rdmFZXlxZXF5iX1xfXF5lZ2RocXhkZGJgZm1xdHSFd2Jzgm1gZX2P
Z2tvaWJfYmRmd2liampraWpub21maGVgVVlia2tlYGJmYWVoaGdmYmJiYWJma3RtYVNTYW16i4mI
iYaAiIWCfW5rb3F7eHR2c3FxjJ5yXF5gZ2htdHt6gomBc3l0cXFwcG9oaGtpZ1xYUFJMRkVCPD48
OTs5OTg7OjU0QUtQUlZYW2KDiYCBg4CLhYOYvpqAen+GnKeGcnR0cnp6hIqIhIaKi6Oei4SGg4F8
c1dZYGlxdIOEgXt8f4mDfX+GkZyPi5WOi4mAf3+KlH+DdG90gXRxb2ZfWVNQQjxERkxMT05QTV5V
U1lYXGRlaGRqdoB8d3OBjpSXkpaTlZOPi4+Rg4mAi4R/fYSPj46Ji4uMi4+XlJOekZKWmJ6Xk5eX
lY+YnY+PhoiGiIN9f4F9f4CPnaCjpKGcmKOfnJ6Yl5eYm5qbmJaSlZqTl5iSjo2IhoN9dnR6ampt
cm1wdHRzeHppVFBSUk9QUFJLSUxNSUVDQTo1MzU3OTg1NThEVF1pcHJzdnRvb21xcnN3dHRya2tp
a2BeYFlVV1ZPR0A8NTIxMDM1NUBHPTk8QklMVGJ9gnd9goWFiIaJjouChYWCf3yAhomKjI2PkZWW
mp2Xm5ien5iXnJ+ooJ2UlJeYlZSam5qVk5qPgoJxYlthYWBgXF1eYGZhYGFiZmlwWU5igoaAgYKE
fH19fX+BhIWGjZqhi4iIgoKGgHyIdHaOcmpoaWFhYmV0eYOEg4R/goqIhoWDgoaIhoyGgoSGio6K
hIaAd21qa2tzdnFzend0cF9kanKFhHNxd3l4dHZ0dHlzdnd2doCGiWlTWFZZYGZud3p/f3+DdnSE
hoOGjYyJjIqJi4iEf2pVUFVTV1xcW1lZWV5cXFxiZWVlYl9iZGJfXl1daGRQUFllZGJiZ2VyeoGG
gnqDioaDhYWKho+mk4iPj4yPkY+UjIOBfHt7eICJhYaAe319enRyb2ttaWJocWFhYmtucHN3e4SA
fHx7e3p3dnFwb25ra2dma2ViXVZbWFJPVmR0d3l/f3+OdmlnaWttcnNwbWtubm9ubnNzcW55nKGg
mJOTkYWKi4R/faGvdGVrfIKBhISBhYmKhoN9fYaJhox5a2hhYFtWRTErKjA8Oz1QVFZcYm9vZ2tu
bmtpamtud4J7eHl5dnZ0dHNwbmJeX1xQUE1MTFJTUE5PU1VXWFtcWGtrXFtZWV1ZV1JYWGtiZWVh
YoF7dnZ2dHJydHBuamJfV1JQWWFeZGpycXR9hZKSgXZxdDk1NTk1NTU1NTU3NzUyMi80NTEyNTQz
NzIyNDUxMjMxNDUzMzExNDQxNDQ0MjUzNDQ1MjMwMjQwMzMzMjg3NDI1NTEzMzUxMzQ1MzE0NTU3
NzUyMjU1NTQxNTkyMTE0MzA0NTIyNDU1MzEwMTAyNDUyMTIyMjU0MTE0MjEwNTUyMDIuMTQxMzU1
MzU4NTU1ODcxMjE1NzU3NTUxNTkzMzI1NTUyMjQxMDA1NTIwMzQ0MjQwMDQzMzUwNTQyMDQxMjM1
NDU3NTQ1MjI0MS8xMDQxMzMzMjEwMzU0NDU0NTAyMDQ0NDU0MzMzNTQzNTU1MjIzNzg1LzEzNTI0
MDIyNTUzMzIzNTUyODg4MTExMzU1MjUzNTU1NTAwNDQ1NTIyNTc5NzU1NDM1NDc1MjM1NDM1ODIx
NTUyMzU1Mzc1MzMwNTMyMTg5Nzg3NTU3NzQ4NTU1Mzc1MzMwNTU0NDEyNzc1NTQzODQzNTU1NTU1
NDQyMDQ6NTc1Mzc0NTU1NDU5NDM0NTU1ODM1NTQ0NTU0MTc1NTU0NzU0NTQ3NTQ1NDU1NDQ1NDQ3
NTU0NTMzMzU1MzM1NzU3NzU3NTQ3NTUyMzMxMzUyNDU0NTU3MzU1NTs1NTU0NzU0NDQzNzMyNTc1
NTExNTc1NTc1MzUyMjc4NDU5NTgzMDQ0NTIxMzQvMjU0NTg3NTIvMzUzNTg3NTMyNTk1MzM4NTc3
OTU0NTk3NDIzNTQzMjc1MzQzMjUzNDUzMTUxNTQzNTM1NDI3NDEvMzMzMjU4NTQ1NTQyMzU0NDIx
MDg6NTg3NDU1NS4vMTQ0NDQ1NDUzNzo4Mzc1MzAvMDQzMzQ0ODcyNDQ0NzM0NTg5NTE1NTI3NTU0
NTg4ODc1NDU3NDQ3NzU0NTU1NDUzMTU0MDIxMS80MTIwMTMyMDMwMCwvMC80NDUzMjMxLzA1NTI1
NDIyLzI1NDAwMzc0MjI4NTU1NDQ3ODMzMjIzMjEsLy4xMjQyMjU1NTU3NTU1MTQ1Nzg4NTU1MjM1
Ojk4NTc4NzU1NDQ1NTg4NzU4Ojk3NTw4NTQ3MzQ0ODQ1NTo7ODU3NzU1ODg1NTg4OT0+PkFGREVG
RkRGR0lHRUA5NTUwMTEwNDU1NTU5Ojg7Pjs4N0BKQTs+S1NUU0xMTUtFRUFAQkJDQ0pFQ0BCREFB
PDo6Nzg6OTQ1Ozs0NThDQD5CQj4+PkA+Pj5JREVHSlJUUE5GQ0RHTlVWVVlhXVlfXVteXF1cW11Y
WFhVVlddZXFhVVRYWVhnZFhQUlVWUEpFR0pUUFJZW1xeYGJhYmJeXV1hWV1iZ25kYGFiZGJlaWVg
YV9kX2JlYmJtdG5raW5tamtpa21pamRiYmVpZHFiU05OTU9QUlNWVlliZ19PPj09OD1LWFlfXFNP
UFZXUlZXXF9mYlhNWHh4ZFZUVVtcYF1hYGJhYmJhZGRycmlkYGdrcn+DgH1mYml5amRmaW56i5el
raOVa1toaWhqa2pqZ25rZmpwb2RbWVlfYmVhZWlmYGtmYmhiX2FiZ2l4gWtlX2Jxe3+EipKYjX2B
hIqFcmZvbm1vc3FrZnO8xHFSVWBia3N3e4CNi32EgXhzbnFuaWtwcGVkXVRQUEpCPkFBOzw1ODs1
Mjk8OjVDT1JPVllZYoGKhoOEiJGJf4aKhomGiZanwo1zcnN2e32AgoaCj5WMj4qBgIKDeXhYSVxk
dHJze4B8f3l5eH2LiIaPlo6Pj46PjIJ/fIKzpnpxdHR6cnN6cGpiW00+ODc9S1BUUE9SWVVQVl9f
Ymhtb4CAf31/gYmPlZWTmJaUoJWXj4mKj4mGhYKCjIuSk4+Oj46Lj5aPkqCamJyel5+coZqUjZeY
npKGiIqIhIJ9f32FhpSyqZicm5uYoaGeoZudn6Chn52Yn52YmJaWlpeNjo+NiYZ9dHRycnR7eXR4
c3R6f3liVVNWUlJQW1lUVVBPUkpHPjUyMzUxMjU6O0tYYmtzdHNzdnRvbnR4c3R9dnRwb2hnXlhc
XVlVU1BNS0kzNTU0MzM0QEY9QUtPTlNgdImCfHyFhImPioWEiYWGhn99f4GFhoGBiI6Wm56dmKCh
n5qgoZyhoaCpp5yYl5WTl5eXnZOUqp+CfWtiYWVgXFldXWJnamJnZ2Zrd3ptWGp9iIaIhoKGgoZ8
gYaDhoiGkZSKg4SCgYCBhYmGnduPYmdnX19mcnR6f4OFhoiJio6NiYiFhouNkY6PiouKi4+JgX9w
ampxeHx9fHduam53YVlgbZKOc3BxdHR2eHRwdHR0eHp/gYt3XWmPdltlc3uAfYCAgICCeoiIhoSK
jYqEiYyJhoF4alhSTlBZXWJdXFxfYV9hZmVnZWJlZWJkZWFfYWBkZ19mZGZmZWJoa3l6f4iSkZOL
j4iFjIyMjY+PjpKTnJOWpJeLjYZ5bmVidomAenl3d3d0cnJwb2llYGRYTmJraWdoa293e3h8hH15
e3d3cHRvZ2lqamloZFxcWFtZU1RWYXKFgoSIhIx9amptb3R4dm5naW9tbmtvdHRqanCSo6mpnpaJ
hYGAgHp0d3ZzdH+RjoR/gIaKiouKhISGhoSBfHBva2hncFc8LCkoKjM4RFJYWVlia21qa25pcXN0
dHR5d3l6fIyBfXhzbmtrbWBiYE5VV1BMTE9QVFRQWFdPUFBSYl9ZVllYW1xXV1dWZl9lZV1eeXt4
eXdydnh0c3JpYmFWTFJiaWVqa3B0d3qCfXd5eXRzMjM0NTM4OjU1MzgzMzUzMzIyMjI0MjMyMjE1
OjkzMzQ1ODUwLC40NzUzNTIxNDU1MzMxMTEyNTMzNDQ1MzAuMzQyMzQwMjI3NzQvMDI3NDI0NDIw
MzU0MzIwMzIwMi8wMzIzNS8vMjQ1MzQwMzEyOTM0NDUzMzMzNTIzMi8xNTczMS4wMDQ1NDU4NTU1
NDM0NDU1Nzc1MjczNTQwMjQ4MzM0MjEyNDIwNTUzNTEvNDU1NTUwMDQyMjQ0MjIzMzQzMzcyMjIy
MzU0NTQ1MjM3NDMzNTc1MzQ1NTU1NTU0MzQ1NTMzMzM0MjU1NDA1NDU1NDQ1NTIzNTAzNzIzMzQz
MzM0NTAwMjU0Mjc1NTQ0Mzc3NDU1NTUzNzU0MzU1NTUzNDU0MzU3OTU0MzU1NTQ0NTUyNTg1NTU1
NTQ0NTU1NTU1NTI1MzI1Mi4sMzM1NTkzMzQ0NDg0NDU1MzQ1NTUzNTU1NTU1NDQ1NzU1NTU1NTU5
NTM1MjQ0NDU3NTQwNDo3NTc4NTQ0NTU1NTU4NTc3NzcxNzU0MzQ4NTI1NTc1Nzc3NTQ1Ozs6OTQx
NTQyMzc1MzIyNzQ1NTQyMzU1OzU1NDc1MjUzNTI1NTU1MjM0MzM4NDI1ODk1MzU4NDEzMjEyNzM1
ODc1NTc4ODU0NzU1NDc3NTQ4NDQ1NDM1NDIzODU3MzUzNTc0NTI0MjMzMjc1MjIxNTU1MzMzODU1
NzU0NDMxLzEvMjQyNDAwLzEzMjU1MTExNDM0ODUzMTEyODc1ODc1NTU1NDg4OTMvMjU3NTMyNzcx
MjI1MzIyNDU1NTU1NDc3NTUwMjE1NDI3NTMyMjQ1MzU1NDU0MjM1ODUyNTQ1OTU1NTQ3NTU1Nzc5
MjI1NTQ1NTU0NTc1MjAwMDQxMzM1MTQwMjI0MDIwMC8sMTIyNTIwMTQzMTU6NzU0NDQ5OTUzMzEv
MS8zMzE0MS4yNDMzMTM1MjMyNTUzMTAxMC4uMTE0NDQ1NTU1NTU0NTQ4Nzk0NDU0MzQ1MzM1NTQ1
OTg3ODU1Mzo5NTg3NTc1MzMyNTM0NDU1OTU0ODU0NzUyMTc0MDA3ODU9REVBRUVHS01JTE1PSkdJ
R0VAPjw1NTU3NTUzMzk7Oj0+PD48OTs8QkpTWVNVVldQUE9QT01LSkdFREJDS0NEQj5BQz46OTo7
ODU0MTc3My8yNT5APjs8PEBBQEJBRENKTFlfZ15UVFBKTU1YWVNZYVxfYGFeYmRhYmBgXl5dWWFk
YmJogHZbWVliXl5iWVZUWGRXVE5QV2FTWWJcXmFnZWhqZGJkYmBbXmVraGZwdGtnZ2traWZmYmZt
bWtraYajlX13cW5ua3N0bWlhX2BgXl1eWU5PUFBQUFBPT1dcaHNkST46PTo7QEpTW1dWUFNXWFhU
V1dZXVVQVFVyf4VnVVldXV9iX2BiYmJiZmJqb2ttamVmanF9jIyBcGVqZm1paGVoZWtra7fgqoVh
WGFoa3F4cm1oaWtrcHxvaGJdV1xgYmFoYnNpZGZfXWJiYmdmbW9obnRwb3qFiIaNiYaKj4yChIJz
YWZnZ2hqc21iZomccFhZX2Zrb3B2fHt8fYGKhYFzbnJua3N2bWtZUk1ORUNFPjs6Ojo4Ojw5Ojw8
O0NTU1BZW2B4gYSChYaJiIqEhoqFhYaGhaHXnnFweIKPf3Z5g4WKk4qEgn19g318hFhHWGJvcnaL
eoGAgnl3fIN9jpekl4uGiY+Kg4SEj5agnYWDe3ZzcW5ua2JWRzMwNT1NUkpMUk5QUFNZW1tgYWV0
houGfYKMjpeYlJaYmJubk5KXlY+FhYaGgH+Kj5GTkpaUj4yTkZGTlqmlm5iYnZ2WmJiYmJOUkY+O
i4+FhoaJpYWGqLekmJiYl5+gmqGcnZ6em5yhoJ2fn56alpeamJOSi4qIi3x2eXZ0dHl9fXp4dnh6
fYZiV1dbU1NhXlZSUFhtUk1LOTMsLC4zOEBMVWFtcnRydHl7e3Nzd3l6e3Z0c3l3bWpfW1dZV1BQ
UE5NWzwuLDI0MzM6PkNHVVJVYmt2fIN/hYmIjY2PjomIjomBgH+DhYOEg4KLk5eYmJ2enZidm5ug
oaGhn56gnpibm5iYnZiXmpaPhIV7aGZlZF5hZGVnZ2tpcnRza2uJindna3yBgoiKg4J/ioV/gYaI
ioyLhoWJgYWFhIGFjo/O6YRkcGFfaHZ9enqBhYWJi4mKjYyOjIyOjIybmJKRjIuNk5iMdG1ta3Jw
dnh0c3Frb3RhV1lheYt9c3R4dHZ4dnR0dHN0dnyDhmVdlLqBZHB/gYmGgn2EgYCDlI6GhouJiImL
iomNhHxwX1tUVlxfX1ldXF1fYmJkZ2Vra2hiZWRmam1tbXJ6dHNyb2llZ2dreIGKjY2LiYmLiYaI
io+NjI2PkpGVkZOjlYuJfHFhV1Ric3p9fX19eXhxaWdiX2FiXExFWW1mYmtta29vdHR6hntzdHNv
cHBvamhmYmpiW1xZW2pYVVltdHl7hIN9jIZvbXNucHhzcnBramtta29xa2Vea32XtrKak4WGg4CD
f3t7doR/hJSShICDhIqJkYuFhYaEgHhydHRva29vYk0uKSwsLjpDXm9iXmBma2ttdHFwcW93gH13
dHh3hnh4fXJpZHRbQElJPUxTT0ZHTExPUlRVUFBVVFBSU1hZWVtTUFNTWFZgamVfWVVnd3x0dnd5
fXh0cW1rbm1XZWdlaGtxdH15eoCCfXZ4eHI1NDc0NDcyMjI0NDc4MzIyMzM0MzIyMjI1NTMyMi8z
NTU1NTcxLDEzNDM0NzUyMzQ0MzU0MjQ1NTUyNDEzNDU0MTQxMjUyNDQ1NDQ0NDQzMjMyNDMyNDI1
MjIzMDAyODMzNTc1NDU1MzErNDU1NzczNTg1MjEyMzc4NTU1NTI0MTQ3My8zMjQ1NTg4Nzc5Nzg7
OTU1Nzs7NzU3Ozc3ODk1Ojc3ODM0NTQ1NTQ1NDQ0NTU1NDI1NTUzNzk7ODM1NDI1MzIzNTc3ODUw
Mzg0NDU1NTM1NTU1MzQ0NTU1NTc1NTM4NDU4NTU4MzQ4NDIyMjgyMzI0NDQ4NC8vNDI0MzA0NTUy
NTU0MzQ0NDM0NTU1NTIzNTk1NDM5OTU1NTUzMjU0NTM1MjMyNTU5NzcyNDUzMTIyMjQ1NDI0NTM0
MzU1Nzc0NzczMjQ0MjM0NTU1NzU0NDM0ODg0NTQ1NTU1ODU1NTU1NDc5MzU6Nzg3NDUwMzQ1NTc1
MjQ3OTU3Ojc1MjU1MDE0Mzc1NDMxNTQ1NTg1NTc3NTk1MzAyNTMyNTUzNDg6MzM1NDo4ODU3Nzk1
NDI1NTU3NTg5MzM1ODc3NDU1NzQ1NDEyNDMyNDU0NDM1NzIxMjQzNTExNzU3NTIxMTQ0MzM1NTM1
NDM1NDU1NDo3ODM4OjUzMzMwMzg3NzE1MzU0NDUyNTU0NDU4ODc1NDU1NDc1MjE1NDU1MjAzNTcy
MzQ0MzQ1NTU1NDUzNTAxMzc4NDk7NTU4NDM1NTM1OTg1NTI1NTU1NTU1MzQzMi4wMzQ1NTU0NDU4
NDU1NDMzNTEwNzk1NDM0NTIxMTQ1NTU1NTU1NzQ3NzU3NDUzMzAzNTU0MzMzMzQ0Mjg3NTUzMzU1
NTU1NTU3NTUzLDExLiowLjMzMjEsMDIwMTAvMC8yMTIyMTg1MzU0ND44MjEsMzU0NzIyMjAuMjIw
MC8zMTAwMDEzMjMzMzQvMjQxMS8xLCwwMTM0NTU1NTIyNDg5NzU3NTU0NTc0NTg4MzQ1ODU3NDQ1
NDQ1NTczNTc1NTU5ODc4ODU1NTM1MzU3ODU0MzQ1NTg1OD5CQEFJTE5LS05TUlBQVVxZVVNQSkZF
RkFBQDw6PTo7PT48PD1AQEA7PT5Ga412XFleXmBgXF1XXWBeWE5QTENDREdDPj5APj08PTw5QDw3
MzUxMS4wNT1DRD5DQkE+QERGR09TVFZdYFlngnlhWVtcX2FiZWJgYWRlZmZnZGFlYmFmZGZmaGqG
bVlZXWJmXVxhYllVWFlZV09PVFBZXFtgYWhramlnaWRiYlxna3Fyc3R8f3Nra21raWtqaGtycXRy
cn+DgHNwcHFzdG9tampgYV5bWVlUVE9MUldWUk9UV1tbWE9AOT0+Qj5EU1BUT1BTW2ZZWVhXUlJU
WVtXZ4Ccjl1SWFtZXV9gXWRiZGJkaG9uZGpoaWJkcIKPi3draG5qYmJmamplZmdrepiYbVtiaWtt
b29rcnJ0cW5rbm9rZmJdX2ZiX2ZiYWVlZ2ZkX2Jma2tucm9zd4CBhIqRiomGjYyNjIaKhX1oXmBk
YWVwZl5ZZnNrXlhfZ2hvdHZ6e3l4e31/fXh0c3BvanFydFxQVEZDRUlCPD06OTk8Ojo9PTs1OkdZ
WWJucYOAhISCgoaUsZGDg4SFgYSMwdmhe3F0f5iEfIZ2eIiMhoiCfYJ9fG9fSUlYYmtxdnp/f3x7
d3J2g3iGj5KXlI+PlZWJgYOEgYCIgXpzd21ra3B4allHMjhASk1JT2ZVTVBVUFVfYlxcYWuEiYOK
lZOWlZeanpqalpaXlJKPjYWBhHx6goSJj5qSj5Sfl46Ji4+SmKCbmpyXlpKXmJeUk42Pk5OKg4OM
homSho+qrKGYnJ+hn5udnaChpqGhoKChoaGgnZuYnZ+alZKVmI+Phnp6gY19eYKBeISEfHt7gW1h
WFRTV1lbWVRUVFRNTUk6LywsLzRBSU5XZW55cnZ5fXpycnN2e316c3Z8kpdqWVRUV1hWVlhOSk9P
OjEsMTU5O0dHSUxQU1l7gHp9fYSGioyLjo+Nj4mMjIaBgYGDiISAgYmVmqOgn6SgoaClpaWho6Wh
nKCenKGgm56gnZqfkoF3fXtuaGZpZGJfZmtrgnR0dG5vbXmKiIR3e4aJhoSLioGBhIR/iYuLjYuJ
hoWGhYmGiYaGj7e2cWBcX3R9fXt7fX+Gj4yJio2gl42IiYuOkZebj5KSjJfb7ZVgYWtvcnJ4e3R0
dnFwbWZZV1hfdHyCfXp6eXJ0dHZ8eHR3eXt9Xll6hXd0fIKEiYCCioaDfYaRkYmIhomKiIyLi4qI
fHRlXFJbXmVlYmJiYWJiZGt4dG9vamJkYm9pZHJ9gXh5em9zbm5reHp7g5OPgoGDi5SMhoyOjpGP
j5KPlZSTmKGkj3luZllSVFxwjYV/houDdG9ra2lnYk9DR0pUYGJkZmlrZ2pvcnt9fHp0dHN0cmtq
aWZkaGdnX11gZGJocH+AfYGAf4SYgG1nbmtxe29ub2dra2ttbW9tYmJiaYa3tZiSiYuLhoF/fYCE
jICSi4GChYuMjYqCgISIj4l/d3Rxd3RzcmhmVzMrKyoyO0JVYGBiaW5wbnRyd3t3dHeBf3h3eHt8
d3h8dGlXXDsxMDEsOU5MSk9QUFRUVVRVU1NQUFRSW3R0YlhTUldZWFhpYlxcXF9tdnt4eXx9enR4
eG9ya2tycnFxcnN2eXR9g4B9e3t3eTQ1MzI0NTUyMzM0NDMxNDc3NTQzNDU3NDU1MzMyNTc0NDIy
OTg1MzMyMTMuMTEwLjIxNTQ0MTI1Mi8vNDIzNzUzMTE4NTI0MzQyMzg0MzEzMjQzNzQzMjIzNDUx
Mzk1NTQ0MTUyMDIzMjIzNDIxMDU3NTUzLjAzNTU1MzIzMTM1NTQyNTQ1OjU6Pjs5Ojk5ODs+Ozg7
PTs+PDk4Nzs7NTU0ODU1NTQyODUzNDUzMjQ1NzM0NzQzNDM0NzUzNTMxNTI0NDMzNTQ3OTk1MjUz
MzU5Ojc0NTQ0NTQ1NDU0NzgzMzQzODU0NTUzNTUxMjQ1NTQ0MjEwMzg1MzM0NzUzNTU0NTU4NTU4
NTU0MDQ0MjMyNTU1NTI1OTU1NTU3NTU3Nzo3ODg1NTQ1MzgzMzU4Ojg3NTc4NzAyNTU1NTg6NTIz
NDc0NTI0NzU1NTUzNDQ1NTc1MzQ1NDE0ODc1NDI1NTMyMjQ0MzI3ODs5ODU3NTc0MzQxMjU1NTU1
MzU0ODQzMjU1NTc4NzUzMjc4OTc0MjU4NzM1NTg1ODc3NTU0Nzo6NTMzNTg3Mi8xNTQyMzQ1OjU4
NzQyNTQ1Nzg1Mzc1MzUzNTU3NTU1NTU1NDU1NTU4ODU1NTg3NTU0NzMuMTU1MzM4ODU0MzUzNTU1
NDQvMjMzODo0MjI4NzI1NTk1MTE3NTMxNTEvNTU0Mzc3NTQ0MzUxMjI0NDM1NTQ1NDI1OTc1MjMy
MzEzMjE1MTI1MzQ3NTc1NTI1OTc1NTMyNTU1NTU6NTU1MTIzMzUxNDU1NTQ0NTU0MjQ1ODc1MzU3
NTIxNDMxMjIzNTIwNTUzNTU1NzMzNTUyNTM3Ojg1MjU7Ojg5NTU1NTU1MzkzMjE0NTQ0MzMwMjc6
NDMyMTIwMjEuLy4wMi4uMTIyMjAsLi8vMDU0MTU1NTI6NTUzNzo3MS8wMDE1MTIwLjIwLjIvMDEx
MTMyNDQzNzQwMjQ0MjEwLjEwLy8vNTIxMzM1NTQ1NzU1NDQ4Nzg3ODg0NTs5NzU3NTc0LzI1NTo4
NzU1MzE0NTU1NTg5NzU0NTg1Nzk1Mjg1Nzg1ODU5QkpMVFlXVVxnZWFeWVddYV9cW1lXVFVQS0ZB
QUFAQD4+QEBBPkA+Ozk+PU6VsHZeYmhoZGBda3J4cmhkZWFeVUdDQUNDRklGOj4+PT49ODk1MC4u
LC4xOUNHRz1CQENDSVhVUExSVlZYWVhlcmBoYF1iYmRmZWRpaWhoZ21qa2dqaWZpbmtweHZoZWBe
Yl1cX1xbXFldXWlgUFJYWVlZXmFlam1ubmpuZmdpa25rbYKJlHp5eXBtbW9ram1rcHF0d3RycnFw
cnFwcG5vcXBxZ2BdV1hYU1NTTUlPXVBJTU9UUE9HQkE9Oj4+QUFJTE9SUlNZWFRWWWJfYGBiZm50
c3yVblZWV11iYF9eZWFiZWRqb2heZGhoZmJrd4OBcmdoZ2JiZ2dvbmlranltZHJoYGZra2tycXBu
bWtwcnBra2hoYl9bX1xdYWZlYF1la2ViZ2lubW1ydHqAhYyPk4+TmpSPi4yMj42PiHJVVnBdVV5c
VU5WYm1hXmhnb3R0enZ9eXmCe3yCf3pxcW9va2ppXlhOQz4+PDg4ODk6OT08Ojs5ODk7PktohX17
gYKMiIaLjJWpkoWAf4WFhpOnlY+Ie3l8e3t7goF5hYaIiY+Jf31rVUtGRlJkbnZ2eYSDeX17nIt3
cXqMjo+VkYyMhYaEgX+GgoCFhoN5cHNuc3pfTD03QkpNUFBPWVNSVGBcU2h/ZFZYYXmEg42Rj5SY
nJ2cm5iaoKCYmI+KhYOFeH+GiImPqaCcmpWSkY6Wo52am6GdnqSmnpyhmJSXl5SWj4yPnpKTi4OJ
n7mvnpecpaOhnp2jpaGhoaOhoaGfoaCfoJualpqYmJShnIh6fYKDhoKDgXt9jIN4eHZ9hGpWUFBV
UFBWV1VfUE9SSkA0LjAxOkFKUF1rcnh5eoOAfHd0c3d6g4CEdnR7cGpoYl5lcmVYWVJLSU06NTc8
QEZLSktPUFBSZYGAfYKGjYuKjI6UlpSOjoyNjImGg4OAgH2Fj5qfo6ShnaCmpKGkoaSjnp2goaGh
oKGlo6Gbm5iVgXh7fYVvZG5oa2ZoaWZwfHd0a25wcHR9kZiMioiFiImBfYV9g4qPhpSRhoqUjIOL
jIuGhIaImJtnT1Jtg4F7f4GEjI6TjIiNmLWXj5GJipObpJuYkY6PofD0jFNZZW1ycnl5eXZ3bmpr
YVhUWFlfanODhn93d3t8end3eXd5eXdta3eKgHyAi4mEiIWCjIaFhomPjImNjoiDiY6JioaAeGdd
YmJmhXppZmVta3hyc316dHd9dGhkeHJ0fYh9eHp0dHJxc3mnp396hoaDf4OIi4aNjYqIho+Tj4+T
k5Wfmpp/cGtmYltYX3KGgYWGi4B3b2poYl5QQkZHUFRfXWJoYmlva2pyc3Z7gHZzbnBuZGpoaWZw
a2ReX2Rwdn2Eg4OEf4N9g4lwa25pdIF2cnFqb21zbnRrZGRfWVxga5GlkYiNhomLhoGChI+SgYWC
g4uGiJ6TjouDgIOOhHdzdIOGeHBnZmddMycoKzM4PlZeYWZqcnJyc3Z5eX14e3p4eXl8fXx6dHRr
XksuKSoqJyY1TUtHTlBNTVBSVFZVT01PVVRbfXllWVJTVFRWWV1ZWWJYV2Jpenl0dnd7dHR4eHhu
eHd2dHZ0dHZ9e3p6e3p4dHR5MzQyMDMyNDQyMjQwLzEzNTc3NTU0NDEwNDUyLzI0NDc0NTExMTAu
MzMzMy8zNTQzNTEvMzQ1NTE0MjMzNTU3NTc0MTIzMTEyMzc5MjUzMzIzNzQ1NDQzMjM1MjMyMjIz
NDM0NzQyNDE1NTUxMzU1ODU1MzUzMDU1MjQyNDEvMjAyNDc1OTs8PTk8PTs8ODw+QD48Pj5APj49
PT05PDw5ODUzNTU0LDE0OTM0MDA0NDUzLy8zNzI0NDIyMzI0NDQwMjU1MzIzNDU0NDQ1NTU1NTU4
NTQ1NTUwMDU1NTQ0NDI1MjE0MTI3NzU0MjMzNzQ0NTUyNTk1MzM0NDQ1NTU0NzQ1NTU1NDQzNzc3
NTU0NDczNTUyMjM3NDQ1MjU4NTU1NTU1MzU3NDc6NTM3NzU5NTQ1NTU1NTU3NzU3NTc5NTU3OD45
OTg1NTc1ODg3NTU1NTUzMjI1Nzg1NzMzNDU0MzI1Nzc1Nzc3NTU4OjU1NDc1NzU3Nzc1NDU5MzA1
NzU1NTU3NDQ1NDIzNTc1NDQzMTg5NTg6OjU1NDMyNTU6ODUyNTU3ODU0NTU0Mjc3NTU1OTU1Mzc1
MTE0Mzg4NDAzNTQ1NTMzNDIyNTUxNTU3NzU0LzE4ODM3NzA0NTUzMjI0NDMuMjc7NzU1MzIyNTIz
NTU0NzMzNTM1Nzc3NDU3MzUxMTIzNTcyNDQ1NTU1NT04NTU1NTk1MzI0NTM1NTQ3NDQzNDQzNTMw
NTc1NDkyLjI0NTU3MjQzMjEzMjU0MjQxMzU1Nzc1MjEzNDg1MjQ3NTAxMTU1NTU3NTczMzQyNTQ1
NDc3NTMyLzE1NDQ1MzI0NDQ1NTc1MTc5ODc8PkRFPTg3NTQyMzU1Nzs4NDQ0MjEzMTUzNTk1MzMv
LywuKywuMTAxLzAxMTAwLDAyMTM0MjMyNTQ1NDQ3NTQ3ODUzNDAzMC8xLzEvKy8xLy4xMS4xLy8v
MjI1NTUzMjM1NzAzNzI1NTUzMjQ5Nzk1NDExMjU4OTo1Nzk3ODs5OTQzNTUzNTU3OTs6OTk3NTk4
OTU6OzU0NTU0NzU1NTU4NTg0NTc5NTQ6OENOTVVrfWpcXWFkX1lhYWJgYmJfWFZZWVdVUlBLT0ND
REA+QkFDU0s+R1NVVn2LeWlnamhmaGh0hHZzbmpnYl5bVEJBQEBBR0I8RkQ8PD47PTUzNDUyNTQ1
PkE9OUJFR01QUFNQUFlZVFVYXGBiX29oZGRmaGlma2tpamtrbW5rb29rZ2pyb3SCfGdbW2BfYVxZ
WVVZWVhbXVZYWFxlcGZdXmZrbm1xc3Zxa3Nzc3J6kcXAf3Rvb3Bwcm90dHByeXx5dnJudHJvbWtv
bmtram1nYl1WWVVUUlJQVE9HRktQTk5MQ0A+QEJDREFGR0tPTExQUldUUlZUVnCKdGRcZX16a3dp
W1leX2BiYV9naWFkbnSDZU5caWpmYGVrb21iYmVia2pma2tta2toamViZGRoaWlvcnJ5iHlva3h8
cnZ3b2pqYFdYXVxVXV9bYm1raGtqa3F0d317eYqLiYuSlo+TjpOSlpWPlIuIgV1QU01QTkxOTEpP
X2BYX2ducnh0enp0dHx0fX16dHd7dGtnaWpdVEtHQkE9OTk3OTU3Ozs5Ojk6Pjw5RGKGf4CIhYqG
g4aLj5GPlYyDgYCGiIaIg4WDfXt7fXyDeXdzdHp6goZuaF9QR0ZHTl9zd3mKhYOKi4OhlG5ocoKY
l4+Uj4aGg5KIfX2ChpKghXJubW1va08+Qk5MTlJQUlJWV1VVV1NVXXJhUFRdcYKBjZOYm5uho56c
paOXmJiako+NgHt4gYaLj5WSlJeSlY+SkZGUl5uXlpihqaSelJifnJiRjp+Sj5Gcp5eLhoufrayl
m6GmpLCmoaGoqqWhp6qkqaWhn6Ojo6CgmpaXlpydnIaChoOChoiGhIOBg4B6d3x9c2FXV1hVV1dW
VGhbUFBORTU1NTtESlZcZ2hvdHx9fX19fHt7d3p9d3h2gXlvbmpvcW1pbWhiZFZQUEI+RFBYVVlY
V1ZYWFVrgYOCgomOkY6Pk5SPkpKWjYmIioJ7gIaGgYaPkp2hoaCkpKaopJ+ho6GYmqShoaOkpaik
oJ2dmJiDdnqGhnRkZmVkaG5ubnB5dnRyc3Rwd3Z9jpOOhoOKhoSBgIGKg4aDhImJiYiKi42KiIuG
jY+Omm9OZYCLhoSOj4uLlJaTkY+PjZKRj42PmKG5rJSYpaWOqqFvYWdra3d9gHp6dnRubm1nX1dX
V1tdZXqOg318dHZ3dHR5eX13cH17hIKBgYOEhoqLiYWKjouGjY+Pjo+PioqIjo6PjIJ2ZWJpa3mL
f3JpaG10i4R6eHqChIN9dnqDhIaAhH19enZ2eHRvdp6Yf3+DhX99gYWEhqefg4WGiIWEi46WnJGD
enJvbWlmZGJrb3R3f4ODenpza2VYREJBQ0xQV1lWV1xbYmpqaGpvdHR6eHJwcmtqaGlqZ21vbnN2
fIKFko2VgoWGgXp5cmhreW1wfIOCbWhtc3OLgnRpYl9fXWJiaYGGhIiIjI+JgH2Cjo+GhIGLmIh/
mJOEiIN9fXx6f313eXt5dG1td2FEOTU3O0JDV2ZiYnZ0dHR6en14dHl7eHN4dHR6f4N9cmZMMyww
KyYlJjRJTUpKR0lQVE1QVFdTVlVWWV1eYnFxV1RVV1lVWFtZV1dZYWR8f3t8e3t4dHt6eYWAdnp2
e3t9fYF/fXyBgXp3dnk4OTUzNTU1NDE0MzQ0ODEvMzM1NDUyMjAxNDUzMTUyMzQ0MzQ3NDEvNDU3
NTQ1MzMzMjU0NTczMjQzNDU3NzQ5NTU6NTU0NDU0MzM1NTU1MzIyMjEsMjMzNTQ1NTMzNTU1NTk0
MTIxMzU0NTU1NDU1MjQ0NTIxMjM1NDQ1NDU1NTUyMTU4ODs4OTs+PDk7PT4+RD5CQD49PD48PDw7
OTc3Oj44ODc4NTE1NTQ0NTI0MzA1NTg1MzU4MzEwNTg3NDI0MzU0Nzc0NDU0NDQwNDQ0MDEzNDU0
NTU0NDQ3NTg4NDc1MTAyMzU1NTU0Nzc0MjIyNDIzNTQyNTUyODQ0NDQwMjE1NzQzMTQzLjMzODk1
NTU1Ojo1NTU1NTg3NzQyNDU4NTg4NTU1NTc1NDA3NTg1MzQzNDU0LjMyMjc1NTI0NTIyNDU1MzU1
Nzc0MzQ1ODczNzU0NTgzMjU3NTQxNzU1Nzg3NDg4NTAyOTg1NTU3ODU1NTU1ODc5NTU1NTM1NTc5
NTU1NDg5OTk4NDc3NzU1MzU1Nzk4NzUyNTg3NTM1NTo4ODk5NTU1NTEyMTQzNTg1NDM1NTQ1NTM1
MjEzMzU4NTU3NzUzNDU1Nzc3NDU1NTU3NzczNTo3NTQ1NTk1NTk4NDU0NTQxNTU1NTQ3OTk5NzQ1
MzQzMzM1NTUyNDIzMzU3NzEzNTUzMjMzLzMyNzM1My8yMTQ0MjM6NTQxLzE1NDMxMTQ0NTU1NDEy
NDQ1NDc0NDM0MzU1NTc5NTQzMTAyNDIzMTU5NDMwNDIzNTQzMjMyNTUyNDUyMjQ3NTI0MjQ3MTM0
MzUzMzM0NSwuLzEzMzQyLywzNTc3OTw9PkQ9NTc3NDU0Nzg9PTk1NTQ1ODU1OTc0MTE0MjEvLC8y
MjIwMTMxMzIzNDIxMCwxMTIwMjQ0NDI1Nz1DPjg3NzUvNDUyMC4wMzQ1MTEyMDAyNDU3PDAxNDU4
ODk5OTo4OTk5Nzk6Ojg1NzMyMzMzNTg8PDw+PTU1Ozw9PDU3ODo6Ojc1NTw9Pj4+Q0FAPj4+PDs4
Ozc6PD48Oj07NTU1NzU6PkJAQkRCSVZfa2liYV1cXmFiYmJiYmJlZGReXmFdXVlVVVNQT0pLPj5G
T0ZOYmpvfXBueYF5a21ra29ra3+GfXtzaWhnYl1WTERCQUA9PTk7Nz08OzUxMTAzNDQzNDU+PkI+
QkBDUFlVVVJSVFVYWFlVXGFgZGRkZ2Znbm1ta2hrc29oaGlwdmppbnhzb3h2dm5iZWhdXVtbXFdX
W15bW1Vlb3GMf2lqbXBya3R0dHBzeXFucX2XmImAhYR8eHJ0eHd4eHZ3fHl5eXF0cG5ubnJvbm5v
b3FpYl5dXFRSVFJQSkM6PkFHS01HR0ZPYF1WV1tdXFxQTVJQVFVXWVZXa3BuYl5eZWlnYmJgWVtd
XmBgYmVkZmpva2dbYmZnYGRlYl9UYWFgYmhna2hpbmtpbW9nZmdiYmZoaGptdHRzdHZ0dHZ0eHZv
bmplYlZXWVZbXGFtcHhybW50f52hjo+RjYuKiYuPjo+VkZaXmJKPkYyCW0xKS0dHR0VJR0ZVYF1f
YmhtdHl6eHl4eHd8gH1ydnZzb21pa15QRlNJQjw5Ozc7PDs7QEM5NT1DRkJBV3OCgomCf4OCgIaJ
jqSyl3t7goWChICDfYB8f3p3d3l6c25tbmtnYmFdW1NMS01QWW19i4+FhYmbiX2Mf3tzdIGTlpeR
iYmDjIGAhZWGhYl9fXl2dG5rSjlBSk5PYllUT1VUU1NUVVdVVlVSUltleYmVlJeapKijoJ6jo5ya
m5yXk4mCfYOKkY2Oj5KenJONjoyLn5aUmJecn6Cdnp6kp6GVlZSVnqaWoaWamI+EhY6qs6SenaGj
sKWlp6isqaamqKSlp6WlpaWhpaWbmJSWk5GPi4yMhoSGiIqJhoKNhn19e3t9bltVV1dVUlhWUE9P
VlBNOzM6QEVNUl9mbmtye4GFgoZ6d3d9dnl8gHl3c2lobXh9bWpra2p2e2VYSUtQVmBgYVxdVVdY
XXSBg4aKjoyPk5KTkZOXmJWSi4SGiIN/fIGGhYaMlp+lqKanp6eko5uUlJWampifoaGhoaWhn6Gj
not9e4SGfHhqamZqaG10c3J5dHF0dHl4dnqCmJKIho6KfX+JjJaGg4aGjY+Pj4yPjYmPp5eMi42M
all3j4+Lj5GPkpGXp52fm5WXlpSUk46Nn56OlbXAtYx3bmtfYmJtcXJ5eHZ0b21ra2ZcXGFcYV9k
bn1/fXx5e4OBgoF9g4qAf4GEg4WGiYqNjYqJjY6SjoqNkY+Pj4yJi4uGiYmFf3ptaml0eXp7dHh4
c3SAgoaCfYGBio+YtaaIlph/d31/e3mAeHNyeoWShn1/gX99gYiLkpeFf32EhISIhpibg316b29v
b3FxcXR3dn+Yf3BzfXZra2RQREBSWFNVV1dXW2FkZGlqanOIfXl2cm9ubW9wcG5ucXR5eYGEg4aM
ipGJj5GGfXt0bm2Nc2tuhopzaG1vfI2AjGlcWWhylX1kcYKEhoaJioaIiYR9hoiDgZrMnnh7gIKE
gYB7eXp4fXx5enZ6dGpuZl1QRURKVFJMX2hpdHZzdnx8fXt9fHp6dHR3eXd5eHNrXj4vNzMvLDIo
LkpQSUtHSUlQU1JPVVdbWVdXUk1QWGBWWVhZXF1ZWV1ZWWZ6bniDfHl0dnR4dHR4i4qDfX+ChIaG
iYF6eXh6d3l6ezQzMjE1MjU1NDc1NTI3MzU3NTk1MjM0Nzc0Mzc0NDU1NTIxMzM1NTQzNTI1NTM1
NDc3NTU0NDQ3NTg1MzI0NTE1NTMyNDU1MjMzMjM3MzQ1NTM1NDU0NDQyNDE0MzUxMjU4NzU0NTUw
MzQ1NTc1NDU3ODQyNDU3ODE0NDIyMzU1NTU1OTo5PT5BQD1AQkRCQ0JDQ0FCQ0VCREI8PTk8QkJC
R0pGQ0BCPDQzNTEzMTI3Nzg5NDU0NzcyNDc4NTc6NDEyNDU1NDQ1NDU4MzMyMjAzMzE1Mi8yNTg3
MzU5NTU0NTU1NTM3MzIyNDI0NTI0ODIwNzU3OjMxNDQ1NDMzMzc5NzU1MjQzMzQ1MjI1NTU1NTU0
NTc1NzkxMDQ4OTg4NTU3NzU3NzQ0NTg7OTk0NDQ0MDQ1NTc5OTc1MjAzNDIyMzQ0NTM0ODUyNzU1
NTUzMjU1Mjc0NTEyMzUzMjIzNTU1NTIxMDE1NTM0NzI0NTc1NTU1NTU1NDM0NTg3MjU5ODMzMjM1
NzQ1NDIyNDU1NDM0ODMyNDQ1OTc0MjQ1NTU1NDM1MzU1NzQ5NTQ0NTU1NDM0NDU1NDUzNTQ0MzM1
NzQxMzU0ODQzNTU1NTM1OjU1NTQ0NDU0NDI0NTQyMzU4NTMzNTUyMTUzMzI1NDM0MzQ1Nzg3OTc1
MTQzMjQ1NTI1NTU1NDU0MjUzNTM0NTQ1ODg3NTEyMjQ3NTIzMzEwMzQyMjQzNDMxODc1NzU1NTUz
MTU1NzQ1NTQ1MDI1MzQ0NDAxMzE0ODU0NDUxNDUzMzU1NDIvNTU1MDE1NTI1NDIzNTEzNzU1Mi8v
Ly8wLy4sLC4wMDM0MTM1NTc1MzU5NzU1NTIxMzEyNTMyNTIzMjMzMjU1NTU3Mi80Mi8yMjAyMjAx
NTIzNDQzMTE0MzMyMzUyODc1NTU0Mzo9NTUzNDM3NTUyMC8yMDM1NTExMzIzNTk8Ozk8Pjw9Ozk5
Ozs8ODUzNDg4NDQ4NTUxNDg1OTo9Ojk+NTU3OkI5NTU1NTg9QEBBPT5BQUJCREZHREFCPj1ETEs+
PkFDQT45ODg9PkRHUFhYWVVWYHFvamViX2RpZmRpa2tnaWltaGdmZWJiYl9ZVlZZVlZVUkdKTllf
ZGdnZG+EfHRwcm1wcGt0hX15d3RybmdlYVlOQz5BPj49ODs1Oz5JQzEyMjM3PkI7NzhHUkpEQkZU
VFNUVFhUWVlfW1lkfWlkampra21tc2tub3Bpb3N0cXR5eHZ7fX93gIh9cGdkZGVkZF9ZWVlXXWBk
ZGlramtymI+LeoJ8dIOCgniPgWtqd4mOjIWBfX+BfX97eXh5fX2AenZ5eHFycXF2cXBqb3NrZGJh
XVldVVRYWU9JR0ZFR0xfYGFfYHSGb2FiZmZoZF5ZV1NXV1ZWWFVgZWRnZWhlZ2ViZGdfWF9iYmVk
ZGZmbW1gX21zaGFfW1NLR0lSYGJnamhqa3BucW5qb29hZGJhbW9qam1tcnNvcnR2e3h0e3p8dHFr
YVlZWV1hZ3F4dG5yeYucqKShn52gnqeYkY6PlpaUkpWTkY+Sj4RiUEpFRUFAPT48OEZWYGBlaXJ4
cXR2dHd5en1/gXZ3cXFuZmZnWUpDR0VEQDg3PTs6OTk4OEA4OEdWTEZidICEgHd7gIOGiYiGobWU
l4N9f4KCg4WFhYF9enR2dHJvaGhoaGRhYWBYV1BMR09ia3Z7hImGi4yLiY+GhYN8c3iMoaySjIuE
hYqJjYyKioV/e3xzdGlJRkdNT05QUlJbV1hXV1VWVVZWVlJUXGp3j5qdoKCjo6Oen5udm56gm5iU
hoGCio+Li4qhm4+SlYuGi4mKjZSXmJianJ2enJyfnZihrZ2xsKHFtqzDwo99f5a8vJ6boaGjqKmp
qaqsqqquqq+qrKmjo6GdnJuWm5iViomMi4uKiY2PjIuIhZqMgH95j4Z3ZFtZZmJWWF5TUFJMS09B
OTpDS1RWYWtqa3B3e319f319eXl9hpF8dG9ramhrcHRzcG5vbW90cmlZVF9fYGVeYF9dW1hhdn19
goiLj4+UlpqYmpeVlJaUj4uGg4F8fY+SiY+UmpqYoaShoZqdl5GSl56SjJGan6Sop6aprqSxqoaB
hIJ4eWt0aWRpanp0c290dnl9e3p/fYuRkoN9i4mAgIWKjIqKjIuPj4mLjI2NjoqgmIuGgoh8ZoGY
lpGTlpegn5+ooZuVlq2wsKeYj46Wl4+Pl5+WhXhrYltgZWtxeX13eXdva2pqZ2BdamJlZGtweXp/
f3h9goF9goCChoN9g4ODiYqMjIuNj42Li4uOj4+LiIuPkY6JioiEhoR9dm52dHR6eHx/enmGgHyD
hIWEhIOUlJqumIKbnX19fXl7eXh0d3hyfY2FjIZ9dn1/gn2Ag3+CfYCGf32DmI9/dHBxdHJxcWp0
dHJxgI95d3d0cG5wcGZOQlBZWVlbWVhXWWVrZmdrbXd0c3FycnFxcXFrcHF5fHyAg4OGiI6LiouF
homCeXNtbW9oZWpyeHp/ioJ7a4R9ZmRibXiPiIWEgYOEiJaMiImGhomKiomJuNeYfXiCiISAgH9/
e3t7fH1/fIF5bnFra1xOYVxXWV99eGpucXN2fHx8fX2Gf3l3eHp4dHFtaWlhRjhCQjIxNCwwS1BN
SklKTU5QT1BPU1VXWVxQTEZHTVRdX1tdYGJfW1VXfal9ZnR5dnZwdHBydoSLhYCGhoaGhYOGhHt4
eXRzdnl4NTM0NzU1NTU1NDU0MDU1NDUzMjQzMzQzNDc1My8zNTQzMjE0MzIyMDAyNDMzNDAwMjEw
MzM0MDIwMjQ1NTQzMzA0NDQzNDU1NzU0NTM1NDQ3MzU3MjMuLjE1NDQyMzU0NDU1MTU1NzkzNTQ1
Nzc1NTM0NDk5ODk8NTU3NDQ0NTg0ODg6OTtAOz5CQz4+QUFFR0pHRkZGRUdFRkFBRERJS0dHTExM
R0dFRTs0NTUzNTU1NTUxNTc4NTU1ODc0NDQ0NDczNTgyMDI0NzQ1NDg0NDM1NDEyNTk4NzE0NTQw
MzM0NDEzNTQ0NTMzNDQ1NzU3NDEzMTI0MzM1MjMzMjc1NTU0NDQyNTQ1NTU0NTI0NTg1NTU3MzU1
NTM1NDU3ODM1ODc3MzU1NTU3NDU1NTMyMTQ1MTU1NDM0NTc1MzU4MTEyNTM4NzU1NTMzMzQ0NDQ1
NTc4NTc8ODU1NDc3NTQxNTQyMzQ1NDU1NDU5OTs1MjMzNTo1MTg7NTU4OTg4OTg4PT05Nzg1NTU1
NTc4ODUyMzQ6NTI0NTU4ODg3NTU1NTc3NTU3NTk1Nzc1NzI3NTU1MzUzNTc5ODQyNTM0NDU1NTg3
NTMyNTc0NDEzNTU3NTg3NzQzNDI1Nzk0Mzc3NTU3NzU3OTgzODw4NC81Nzc0NTcxMTUzMjQ1NzU0
NDI1NTQyLzI0NDQzNTUyNDMzNTQxMTU4NTQ3MzU1NTM0NDUzNzU0NzU3NTQyNTQzNTU5NzQ3NTQ0
NzQ3NTExNTMzMDQxNTczNDUzMzMxMzMxMjEyNDU1NTUzNDUzMjM0MzQzNTU0NTU1Mjc1Mi8uLDAv
MjEsLC4vMzExMy8zMjEzMzU6ODU1NDQxMTAwMjQ0NTI1Nzk6NTU0OTc0NTIyMjAyMjMvMDA0MDAz
NTI1MjIsMTU1NTQzNTM1NzQ1OjU1NDUxMzMzNTU0NTk0MzU1NDM1NzU1ODc+QEdEQ0A+Pjk8OTk6
PDc0NTgzMjU4Nzk7PEA9PDs+Ojo6Ojo6QEA+PTk5Oz4+Pj5DRUNCQ0NJTU1QTVBSX25lSURAQUJF
RD4+QkRHTldhaW1tZ2hub2hnaWtqaG5qYmtpaGhoaG1taWdna2hnYl5XWVxdW1ddZmBKUmVlX1xY
b4ONfHNyc3FxcHqGgnh0cnNua2hkX1VJRUA7PD49Ozw7Ojg6MTQ0Mj5CQkNBQk1bSkFBTV9hWFZU
WVxZW1tbXFtnbmhrb21qbW1wb3B0cXBzcnR0d3x2e3t7eHp9j390fG5oa2ptdGZhWVtZXWdpaGZk
ZGd0ruCthG5ud3x4dG6AhYGRiIWIiYaAhIqcoYZ7d5OJe3p7eHd7eHFxcGtqbW5rb2tlXWFhWVxi
YlZQUE1MTU9XXlxiYWdia2dka2VlZV9cWFdYV1hXVVhTWWBmZmRoZmRkYV9gYmFbX29rZGRnamtt
YmF0mnhmYltZU0pCQ1ZiYmJmZ2tqamdtbW5rbmlkYWBmZGdrbnB0dHN3e3p6fX99fY+DgYJ8aVlZ
XWJqb3Z9fH2IlJ6eoKSjnp2judGciImTko+VlZiNjpGcl21SSUM+Ozs5NTIzQVBeYWRwbnZ5eHR4
dnFzenuCf3RzcHFqZmJUTUlLST43NDc9OTo6PDU5MzE1QlNSVG99gYN7dHd3enx9goaPjYuqlnl9
hoN/f4N/f317fHdwbmpwb2hlZWprZV5iV1JSXWVxfYKFipaPjo6PjpKIhoSJeXiIiI+Gj4yBhIaI
j6mRgYF9eW95X0RHSk1SVE9SU1JYWVhZWFhVVVBQUllxgH+ToZubnqGko6WnoaChn5uXmp6Oi5WP
nJOPlLPOs5iUg4OAenOEj5iXnZydn6OalJifnZWcrrKymKGxtbekgHp/gJiwnZecqKmlqqqnrKiq
sKqsrbKqpKmqqaChoZ6dm5aRjIyOjIyRj4+ehoWGhoGFf32Ee29rYl9cXF1QVlBcVFBJT0I8RE1Q
VVxoa2tucXl7g31/goaDgoGBjIF2dHZ2dm9xeIB3c29ucH2NeGJQT1JZYmdiXVxkXGaEjIKDipST
k5KUnpqTlJiTjY+TkoqGf4GFgn+Ei5WbmJihnpqdnJ6UjoqKmKGJgoaPoaGhqqqhn5qWi4qWl4R9
eGphaGprbnFzdnp0eICBfYGDipqedGl9gYSKhoaEiYqKk5KMho2PjIyNjoyPj42EfWpwj5ufm52f
o6amo6emsqias8Pg6NCUg4mPj5eTkY6BZ1ROTVBfaHR5e399cmlpYWJlYmBmZWVrbnZ4en1/hYGF
goWGgn+DiYiGho6Pio2TkY+RlI+RlJKTj5GJiomLjIWFhouSj4h2bnJ4d3d7gYh6fYV/gIJ9f4WG
j6CWlZSLhIqOg315e398e3dzdnh8fHyGi4F5fYaFe3p6enh9gIB8eHh5en16d4WBcHJzc3RxcXR5
fHh4dHNvcXJrZ1tZW1lcXFtdW1dbYGBhYmtvbWtvc3Nxcnh0dHZzeXl7f4yPi42JiIyOiYuNiYWB
dnSGcmRmZmhqb3l/cGprcWtzfXJud3h9eH2ChImPnoyGhYaLj4yKjpOns46JgYaCfYKDgIJ7e3h9
e3x9dm5ub3J0a199cGZmbWZoZ2t0dHZ7eXuCiIB8d3d3dG5xa2tpZFhEO0dVOzg1MDNQUFBQS0pH
RktQUFBSTldYU1BQT05SWFtfYWZiW1dZV1x0iHRoaXN0a21qaW10e4aMjYaIhoyIiI+YiHh3c3R3
fHozNzg4MDE0ODQ1MzczNTM1MzI1NDU3MzM4MzIxNTQ1MDc1NTI3NTM0NTMxMjo4MjQ1NTU3Nzk3
MTAzNTUzNTI0NDUxNTUzMDIzODc5NzU1NTczMzM3NzU1NTMzMzc3NTU1Nzc1NzUzNTIzMzQyMjc1
ODk1Mjc4Nzk4NTU4NTU3ODI3Ojw+QD5BQkZFRURHR0tKS0dJT0pMS0tKR0dNTU1LTEtKTE9MTk1L
R0E4MzAxMjIyNDQzNTIxNDU1NDc4OjUyMzUyNTk1NTU3Ojc7OjU4ODU4MTMzNTUyMzc5NzQ3OTg4
NzM0NzU1MDIyNDM1ODg5NTUxMTU1NzMyMzIxMzc3Mzc1NzU0NDU1NDU3NDQ3NTUxNTU1NTk4NDM1
NTU1NTU3NTU4ODMzNTMzNTc3NzU1MjM0NDI3NzU1NTQ1NTg6ODU7NzU3NDU0LzM1NTQ3NDU3MjI0
NDU1NDIxNTQzOTk1NTU4NzU6Ozg1Nzc1MjIyNDQ0MDIxMzg4OTk7PDs+PT5AQkFBOjQ0NTU3Ojs1
NTU1Nzg1NDU1NzQ1ODo5NTU1NTc3NzU0NDU0Nzc3NTc0MTU1NzU4NTUzNDM0ODg1MzQzMzU1MzIy
MzQyNTU5ODU1NTc1NTM0NDg3NzQzMjQ1MzIyMTIzNTg1NTEyMDQ0NTU0NTc3ODU0NDMzMTU0MTMx
LzQzMzQyNTg1NTI0NDU1MzQ0Ly8zNzQ1NTQzMjQ0NDc3NDUyNzU3MjI0NzM0MjM4NTMzMzQ0Nzk1
NTE1NDIyMzU1MzM1ODc1NTU1MzQ1MTM1ODUzNDk3NTU4MzIyNDU1MzQ1ODw3MzQxLi8xMS8vKiwx
MC8vMzM3NTQ1NTQyNTs5NDUzMTIyMTI0MTE1ODU1NTU3NTUxLjQ1MTEuMDE1NTQxMDM4NTEvMzAy
NDU0NTU0NTQ1NTQ3Ojw1NDU3NTA1NTU6PTk4ODc1OjUzODs7OD0+PEJER09HREFAOzs5ODo+Ojk1
MjE1Ojo7PkRDQEdBRkpHRUBDR0JCR05LPkNHTkJCR0VFREJGR0VHS1NXXGSFj1lAQURCQkJFSUpH
TFJcZWtra21wa2ttcG1ra21xb2hta2tvcGtraXFva2tqbWliXl9gX1tfW1liXFBZcndhYmRxfYOA
cnR5cnJ9mqCEdHR3dnFubmViYVdQQT5CQD4+PTs7Ny8wMjU+R0E9PEBCRkpMR0lQXFlWVmJcWVtf
YWBfX15fZXd7b2twcXNycHR6e3d3d3d8f4F9eHmAgo6Wi4+xjnl7ent5dGZdXVleYmZnbnpuaHCV
sYuJraWNhI+PjYaGaHmWlZeUko+OiZahhXqCsZ6CfHxzdHR2c21ubW1rcHJuYmRmZ2ViYnF4X1VV
UFNcXWFpZF5iYWFiZmdrYmJlZWBfYV1cWVZZVFZZXGRiZGVmZmRgaGlkXVdcZ2ppamZrYmJreHBv
dGpiZV9YUERGZHBmZWZiZGdramptamVoYl9eYmdlZnB0eXBrbnN5d32OgIOFhISIjoFyZV1cZGZo
b4WalKWsp6SjpaGhpqemqqSPj5WYmpiUlpucj42MclhMQDs7ODU4MDVCT2BiZ3R0dHNzdHJ0d3d5
eHp2d4J0cGppd2tkXlhZRjc5NzU1ND06NC8zNTpTVFRYen95dnN0cW9zdn+Fg5izgHFwd46NfXh7
eXt9hI99f3JqbW1yZ2ZmbnFkXmRhWVxkaHaBhoiOlpGIjJWRj4qJiY+PnIZqfYuWj4KCho2Vt5h/
e314eHNWR1BSWHFZU1hZXVxYXFxYVlZYVlZWYoyDfIyso5uboaSjqrOpoaCfmpWVlpORkZWenJyc
r9Lp04pxcm1lZnGOlJOanJ+dnJ2dn5uYn7PW6daOho+cno+Gg4OBipieoaGhpqmtp6SoqrGvsKyt
rKqqpqejnKGkpJWSjpKPj4+SkpqTj5KIgoWNhoSKipt8b3FiUFBQVFJSVVBWTExSR0NNVFZeZ2Zt
bnBveH1/j4mDhICGgn2BfHJ0cnd2dHZ3enp0cXR0eXd0dGBOUFleX2FYWWVeZ4OLhISCiI+Tl5iW
oJuTkpWXkZKVj4aMinx4gIqMjpWbm6WgnJiYp5uPjI2UuryOfYWPnqaqrKWcjomLi5adnZOKgXRw
bWpudnR5f3x9goCBf32AiY52kbqRe4GIg4SEg4qMiYaOlJKSj46PjYyLhX90XHyhqKCeo6Skp6ip
raiwp6Cptuj8/cOJiI+Rk4+Vj3dZT01HTF5gdoCBeHJrZWJfYWBoYmVla3Nzd3d8fX+CgIGIiIKG
jIaGjJeLj5OTkpqbmJiWmJibmpGPjoyIjIiGioiGkpeUjHp0dHN6fYGAint3fYSGiIyLhoqXqp6W
k4uLjZGFgoF7fXx9enyXinhybnJ8e3R4c3RwaXFxdHyEgnt6eXh/goGAhYJ4dnl0dHF4fX2AgHZx
cnFuamdlZWRiWFxdWWllWVVWWV9kam1vdHh2dnR2d3R0eHt/f318f4SKkY+OkpuSi4uGiIJ9dH1q
YGlrYmhmZ2ZpdGtucXR0cW5xdHFxc3uChomPio+Ji4yOjIuUk5WVm5aLiYaIhYODfXqKfXRxc3Z2
dmpqa3R3YnBwfG5fVWhzeW9rdHl3e4SMhoR5eXhzcHJvanJnUD46PEQ+NTg0PlBhVEtKR05SUE5Q
U1JTWFhVUFNUTU9gb2JeYl9iYltga3BydG1vcnZvbnBrbnN3f4iPjIaIi4iOjpqSdHN0cW90dDU3
MzIzNTQ1NTEwNTg1MjI0NTQzMjUyNzUyNTk1NTMzNDM1NTU0MzQ1NTcyMzU3MTQ1MjQ1NTIyMzM1
NDU5ODM0NTU4NDU1MTEyNDM0NTc0NTQ0LjU1NTU1MjIyMTMzMTU1MjM1NTUxNDM1MjE3NzQwNTg7
OTc1NTk6OjxCQTw8OTk8PD0+QkRFQkVGR0pLTkxNU1NOTU1PVFBPUFNQU09QTUlTUFBPTkpHSUA0
MDAzNTU1NTc4Oz0+QURDQD49PDk4Nzc1NTU0NDM1NTQ0NTc0MjU0NTg1NTc0NzU3NTU1NTU1NDM0
NzUzNTgzNTQzNzg0NTU3NTU1MjE0NDEyNTIzNTMyNDQ0Nzc3MTQ1NDAzNTMzNTU1MjQ1NTQzMzg3
ODg0MTUzMjM0MzQyNTU5ODU4NzMxNDc4NDE0NTU1MjI1MzI4NzU1NTU1NDU4ODQ1NTQ0NTk6NTU1
NDM1NDQ1NTU1NTQ0MzUzMjMxNTc1MzQ1ODc5NTc7PT0+Pj4+QUE9Pj1APTo7Ozc1NTU1NzQzNDQy
NTc3NTQ3MjU0MzU3Nzc1NDU0NTU1MjU1MDE5OTk1NzM1NDg1ODQzOTU4Nzg1Nzk4NzM0MjQ3Mzg5
NzU6NTI1NTU0MjM1NTc3NDQ1NTc0NDUzNTk4NDU0MTUwMzMzNTU3NTg4NTU1Nzc0NTMxMTE0NDIw
Mjg3NTMxMTUyMzU3NzIzNTMzMzM1MzMwMTU1NTQ0NTMyNTc1NTc1NzU0NTU3MjIyNzc1MzM1NTI1
NTIzNTQyNzc0MzIxLzM0NTc3ODM0NTUyNTI0MDU3MzE1NDU0MS8wMjUzMzAwLC4vMC8sKiosLzIy
MDQyMTU1Mzc3Nzs7MjM1MzQ1NTU0NTc4NTU5Ojo6ODo1NTo3NTM0MjQ5MiwwNDI1NTk0ODg3ODg1
NTQ0MjUyMzg6OTg5Ozg3OTk5Oj46PDg4Nzg5OTk8ODtBRkQ+PUJJR0E+PEE+Qz1AODU3NTEyNTg8
PUFDREZFSk1PU09QU1NXU1VZUlBVWVJGQ0VCREZDQUZHSkxTWV9kanhvTEJGR0NCQ0pJSk9WX2pq
b2tucWtwcW9xcm9ycW9waXBubnBxcXBtbm50eHFrbmdlZGRhYV9hXmFWUF19dGVobmJpdn18dnR9
hI2ar5Z3dHR2dHRta2piXmJOQT5GQjxAPjw4MCw1PUFHQkFCQUJCQUZBSWJgXlxeYF1dWVxiYl9d
W2Jna3d0cXBzdntyb3R6dnt6fYN9gH2Af4Sctp6hp497dHh0eHlzbmthX2Jpb2tnaWpvcG9xcWuD
oZR2e3J0a2prcIaapKaclpiYkYl9i4qauJJ2cXJweHhwcm1ucHB2b25qZ2Voc3Bxb25iWVlZWWFm
ZGFhXmJiZGJiaWpnZGJiYmJfX19eWVlYV1lgZWRkYmRmZmtmaWdiYl1ZZmJdXFlbZHh4a2pvb3Jq
ZmFrVEVSZmliYWJnbm5rcW9uampnXWJeXWRmZ25xbXBwdHR4hYaAhYqIhpKfhXdyfWRgYmtzj6am
qKehoKCnpKehpKiqrJePkpWYlpWWlJaMhnxmUklCPjc1MSwsMD1VXGRlZ210dHR0dnd3c3Z8fICA
eXRycm54b2FbWVNPRz07OTc7Qj46PEBFR2FYVll7jYFycXRxbXBwf31ua3NudHR7fYiAd3R3e32E
oX1tbXFwcHZva21qaWViZGhlb293g4iIjY+OipWPj5OPj4+Ljpq2n3t7g4SOiYWFio2Pi4SAf319
aEpOWVthdGFdW15eXWBcX11XWFZUUlRkbnR/j56gn5+fo6ijo56hp56bkpSWnJ6bmqCmqK/F9f7y
r3FeW1lfaICRlJiTl5uaoaCglpiuzdv0yIh9f4iGhH13fYCCjZWfp6GorbKxpKOqraqqrKqqrqql
qqikp6CXlJWXlZOWk4+PlZOMi4iGiouOiYaGgXtwgX1cSUdOT09OUFVSUE1FS1RXYmRqjnxucnN5
f4KJhH2GgoV/j494cnNzcnJ0eHJxcnNudHRydHNtYlVMTk5PVFRTUllieoCEiIiNk5qak4+hnpOO
lZiYmJyUlZuKgniAhoqSlpqXmLGmk5OYk42Nko+y05tveYiRlaGhoJ6TjY+YoKCdmJ2Yj4V2bmpv
eHx5gXt9fIGBgXt7g3y24Jp3fYaMiYiMi4mNjY2PlJKRk5GNj4uFf2hZiKmsqKGnpqmqrKykqKam
p6Oz1PT+5ZeGiY+Pj4p/b1ZKQ0RJU1NmfYGGd2hZWFdYX2JfZWt0d3h4fHx5ioWDhIaFhomGjo2M
l5KVko+Ri5WYl5qWk4+YmJKNjIuLhYKIhoySl6qnpZt5cHmCf32AgoODgoWJi52ll46Yl5yVj4aC
hoWIhYKFf3t3eoSAc3d0bmtiYFhXUlNcZmdudHaIg3BzeXx9fXl6e3p5iYx0dHd8hX17dG1rbWpm
ZWdnZWFZX2FifWtYUk5XYWlnb3iAeXeCenR4fH94dHp7e3uCgoWMjo+Rk4+LjIyKhnx0cWhhZ2Vo
ZWJkaHB5eXBqb3Rva3Bwc3d4dHyAho2Jjo+Rj42PmJaTk4+VkZKNjKSMgIF/eoGAe3yBe2tra2pu
bnpiT1VeV1NTa3Rzc290d319eICCfXh3fXdwcnFtYllHPTo6PTw4ODQ8TF9QTEtKSktGS01PUFRV
VlJQVlRUVWRqXF9gYmJdZHJ7dHFubW9wcXBva29tcHaCi4uFiIuFhIiMl5pyb3J6dHZ2NTU4NDEy
NTc1NDMzNTU3MTU0NDQzNDI1Nzo5MzQ1Mi40NTc3NTUyNTIyNDAyNTg1NTU0NTc1MzQ1MjQ1NTQ0
MjM4ODczMDU1MDc4NzQyNTI0Nzg0MjAzNTU3MjEyNTIzNTU1NDc1NDQzNzc4NTQ1MzQ8ODw8Ozo9
PURFRUdHREVDREVDREVLTEZFRktPSkdNSk1WU1BVVVRWVldUVVtXVlNVVFJVVFVQTU9XWEE1MjI1
OTs7PkFGQkpHRUlKR0RDQ0E+PTc0NTU1NzU3NzEyNTUyNzQ0MjU4NTg4NTU0NzU1NTMzNzc0NTQ3
NTU3ODIzNTM1NDU1NTM1NDU3NzU1NzQyMTIxMzQ0NDU1NDMxNTM1Nzc0MjUzNDU1NTg4Ozg6ODo1
NDc1NTc0NC8xNzc1NTUzNzU1MzE0NDE0Ojs3ODU3OTQ4Nzg1ODcyNTQzMjM1NTQ0MzExMzUyNDU0
Nzg5ODU3NTQvMzQ1MjMzMzQ1NzM1NTc4PDk7OT08PDtAQEE+QkRDQ0I+Ojc4Ojo3MzI1NTU1NTU0
Mzc4NzM1NzQ0Nzk4MzU1MTE0ODU1NTQ1NTo3MzQ1Nzk4PD05Nzc3Ozg9PTkzMzQ3OTk1MzQ0NTU1
NTo0MzIyNTUyMzQ1NDMzMzU1NDI1NTU3NTU1NDU5NTQ3Ojc0NzU1NDUyNTU1ODc0Mzg1MzU1NDIx
NTUxMjM4NzMyMzc1NDUzNTUzNTUyMzU4MjEzMzM1NTQ0MzA1NDczLzI0NDUzNTQ1MzM1NDQ1NTg1
MzU1NTI1MzM3NTUzNTU3NDUwMTM1NS4zMzk1NDM0NTE0NTM1MzExMi4xMi8wLy8wMTIxMDI3Nzkz
NTUzOzw1NzU3NzA0OTw6MzM1NTg5Ojw8Pj05NTM0Nzk6OTg4ODU1ODg4OTo+Pj48ODo0NTUyMzU1
MzU5Nzk3OTk4ODk8PD47Ozk9Pjo5OTs5PkBCRERKR0E+PkRFQUA6OTk9Oz47NTQ3PkVGSktKTUxM
Sk1SUlNWU1dYWVZYW1ZWVlVYU0pAQ0tOR0dHR0pKTkxTW15iZWJQRkdHR0lMRUdOV2Foam10c3R0
b3FwdnZ5eHd0c3N0c3F0dHFzc3RwcXmYi3JpamdiYmVoaWdlYFdXX2JmaWJkXWR5e319f5WdnsGm
iXd4enZ3dG9qamFpZFJMUkk+PDs9PjozLjJAQD4+PT5AQD5BQ0JFUllbXF5XWVtdYFxZWWJpZGFn
bnR0dnR0eHt5enl9gIKAgYF/i4aKk6WlkZGPfHd6fX1/d3RxaWhrdGtmaGhqa3B3cWJfYGpud2uB
bWhra2t0dHuu18GYlaGwnImYiX+KqINzcoifg3Z2b2trcXd2eHxvcXh7fXl2cGlmZWFhXVtcYGBf
YmBhYmZmam1mZWZiYWFiX15eWVhUV2BiZGJgYmliaWdnaGRnZldQUFJZU1Zia2dpdnBucGVfYm5g
TUtia2RlaGZmbXBtamhma2tma2FeYV1ha2hwj3qBgYOei4CGhIaGiYaEgnhyYmFpeJGxqqGepaGj
paGlrqqmpqqtn4+VmJqalZSVl5SKfWZUS0k9My4sKzAsO1BbX2RnaWtxcHR2d3d6dHqAhomTkn18
eWpmZ2BfW1dNQDs3OjlDRUtNR0pLVFBPVXaGfHR0cW9wcG5rZ2JbYmhwdHd3fH16dHJxeXx7dHR0
cm5ycm1vcXB/cW9wdnRzdHl9gIiRj4uTlJaUj4yPkZSSlJudl42KhKaXioaDiI6GfX17f3ZYTVBW
WFhdYl9eXltdWVxZWVhXYlRSXHp3dn2PnaCpp52hnqGjo6amoZiYm52jo6CmsqymyvH+/v70l1hU
WV9reIaYnZOWm6XAoZaXlZifn8W8jIOFiISEhYuFe4KLnqyzrKitsKqnqqytp6Wuqaqqrqelo6Sf
mp2WlZ2em5SSjo+TjpSYm5iOjomNjYmCeHB0knBJREdMTU1MTFxrT0ZLUF1lYWR4Z2VteH2IgoN9
fYaOi4WKiHl4d3x4eHhzeHBvc3Z0hHlwbXJrWExMS0xQU1VbanKKioCIj5+enpWTkpKYlJaSn5aP
lI+LmLuzdG9/i5aRlpidoKGjnpiVk5KNiJ+eeG2DiY2Pl5yfm5OOj5ypoZ6bnJyamJKGb29yfX16
dHR9hIF5fYGEdpq3oYx7gIGEio2KiImLj5GOlJeWkY2Mi4N0Uld9oaaqr6qsqK+uqqyqpqOpqam7
ztbBlZaNlZ+tj3h0YUpGREVHUGCAj5yNZVNZWV1fYGBna3J2eHuChoGEiYiIiYyPjYyNmI6Kj5OW
oJiUm5icmJiYk5SVl5WSj4WDfX2Ejo+k1eXWuHdpcn2Af4KBgoCGhIqMlp2Tj5OUmJ2SjYyPjIaI
hIWAgXx5fYZ5cnBramdfTkRFTVdbYmVlbnt9c3N5fYB9fX18eoGShHZzdHuCe3dwbmtta2pnZ2Zn
ZmdqaGlxX1dYU1VcYWV2jIp9f4B7enx/e3R0eHt9gYKEiY2Sko+SlZOPjIyGgYN5al5dXmRqZGhv
cW5ucm9zcG50d3R0eHd6fHyGjImJjo+Rlp+gmpqdnK28mI6Ri4uEf4V5eXh5dHl7cW56cGtrbV1D
RUlJS01iYG9ubnJzdnp0dnp4e3d0d3RubW9lU0RCPDg7PDo4PUFBQ01QUE9HSUdLU1JSUGFgVE9Y
VFRcg2tdYF9fYmFlcXZ2dGtvcndydHBucW9xdoWPk5GJiImLiouUjXx5eIR8dnszNDg5ODc5NTo3
NDMzNTc1MjU1OTU1NzMwMzEyNDQ0MTMzMjQ0MjcxMzc1MjMzNDg0NTU1NDU1NDc1NTQxMDM1NTE0
NTMxMjQxNTQyNTIzNDEwMjUyMzUzNTc0NTg0NTU0MzIxNDI1ODk3MjU1NTU1Nzg8PT5BR0ZFTk9O
TkxLSUdHQkA+PEJEREdFR0pHSkxMT1RTVVVWVlhYWVlbXFdYW1xZWVlZVlZVTk9ORzs0OTxBR0dH
TU9NUExHTU5LTk9OR0dGQzw8OTUzMzMxNTc5NTM1NTU0NTc1NTg0NTc0MjUxMzU0NDQ1NTU0NzU0
MTM1MzI1NTU1MjMzMjQ1NTQzMjQ1NTM1MjAvMzIzNTIyNTU3NDc1NTM1ODU0ODQzNDk5NTU1OTU1
NTE1MzU0NTk1MDU3NTc5NTQ0NTIzMzczMzQ3NTcyNTc3OjU1Mzc1MzI0NDAzNTUzNDI1NTQ1NTU0
ODk3NTQ1MjU4ODU1OTc5MjM4Nz07ODk8PkFEPj1AQ0A+PkBBQkM6Nzc5NTk1Nzc1NTMzNDQ4NTU4
NTQyMjU1NTc1MzczNTUyNTQzMjQyMDE4NzM1NDc6Ojk5Ojw7PTo7Ozs4NTU4ODI1NTk4ODc1Nzc1
NDAzNTU0Mzc0NTczMDU4Mzc4ODc3NTg3NDMyNTc1MzE1NTU1NDUzLzM0NzIzNTMyNDU1MjI3NTQy
NTU1NTQ0OTUyNTQ0NTQzMjU1NzUyMzQ1NDI0NzQxNTQ1Mzc4MzQ0MzM1Nzc1MzI1MzQzMzI0NTQ0
NDU1ODU0NDU3NDU1NTU1NDU3NTcyNTU1Pjw1MjMyNDUyMTMyLy8vLy8sLzIyMjU4NDM1NTc8Nzg7
Ojo3ODg5OTs8PDs6Nzc6Pjs5PT1AOzk8PT47Pjs5OTU1OTs8PkBAPTo6Q0ZCQ0M7NTc0MTI1NTs5
ODs7PTs9Ozs5Ozo7PDk7QT47QkRGRUVKTEpMR0VFQkJEQT49OTk6OjU9PT5NYWFZVlVQVE9QWFRV
VVVZVlhVWV5kXVlYVlNQTEdGRURGRUFDR05TUFNVW1hVUktERUZHSUlHR1lma2trcHJzc3NzdHRz
cnZ4dHZ4dHd4dnR0dHR0c25ycnt3c2tubm5rZmVlZGRiV1xkZWRoZWJfWWVvcXd6lI+joYZ6end6
enh0bmdkXmtZUE9MR0U+PkA8NzczOkdLQT48PjxBQENCQUpUUlhZVFVWWFdWXV9eYmtnZmVteoF6
d3Z0dHqCeHN5fXx9gYGCf4yjj32JioaDfXp8fHp3dHNwcHOFjWtmaXCJeWZmYVlpYmaCeWVoanN4
e3Fwcoy8n3hyhZSfloWAiYaGf3p9lJ2FeXp9d3F2kqB7b3SAg3p9goSDeG50aWVeWF5eYF1dXGRq
Z2Vpb2tza2dlYF9eYl5dW1ZYWWJlZ2JiZGJmam5tamdfTUdOVVdQUF9rbW5zbniIc2hmYE5MUGV0
a2RiaGprb3duam1oYlxgWV5gbWFiaGp7gIOCgoaChoaCg4SGhYaOfHhvZ2uLpqGenJyhqqWlpKWy
rKqlqa6omJOVlo+Pk5KRlYl0X1lTST0uKiwwLDU+UFdcYmRmaXJ2d3h3eHx9gIGFi5eYjIF5dG9n
aGVkYFlGPjo+R0dHR0VHSUxPVVlZZ32If2tycGtvbWdiXmJnbXFycXmCenh4e3Z3e4B3c3d3dnR2
cniDg5OIhYiLlYh9eX2JjpeVjpKTkpWTj5iPkZKYnJKTk4iEhIWChoyLiIF8fYGEeVVFWGBZZmJm
YWFiXV5fX1xZXVRZVlRicmtueo+anKaqoZ+joaShn6GhqqihpKagpKqspKrI+P7+/v7VcVBTWV1h
a5KYiYyjoKGamKGnl5KUlY+Lk5eKgoJ/oJiAeIKVqaansLOwqqqpqKiqsbCtqKmooaSfpqmhqKGb
m5+cmpiYmJiUlpuUko2NjJaShn16e4V6Tjs+R0lMS0lHUl1NTlNYWV5eZGdiZmptdHl9gn2ElJqK
hYyGdIF0dnR8gn14d3dzd3F0amtuc3NqYVlme2t0cniFeXh6gI2Tk5OUnbWYkZiVmpqzpo+JjIWG
p7p9e4SGjpyepJ+hm5ybmpaPjYqMnZNziI+Iio6Mj5qXlZGapKChpKCjoZ+doJp4a3R4eHp7eX19
gn18gnttYGedr42EgoOGioqLiYqMj46PlpaUlZOJemdVX3mcp6eutbWwrLG2sq2nsbGnqLG4sJ2O
j5SdoZaAd3ZwUElEQklUYo+nqoxYS1BWXFxbX2FqdHp7eXl8goSGiomIio2Njo2PjY6RkpWclpiY
mpeUlZyYl5iXlo+TiIaFgXeKhZjv/vDSu490fIKEgoaFhIaIj5OYlZWVlJuwspiMiZKKhIaPioB9
f397gHpybWpwZl1HPUBOWFliYmRpeox9d3R7hoaJi4F9lJ+JeHaGf3x3dHBtamZmZmZhX2RueoJ4
al9eWVNSUFhfbnmIiIB9fXp4enl4enR8en+ViYmIi42RjY+Ujo2MiIJ9eXJqamJZZmdlbXNra3N2
cnN3eHZ3dnmAgX16hYuTi4uLlZSXo6qmnJiYpbCgmJWPlYt9fXt0c29wcGhna21ra2tnW0RFT0xK
UFJZYGdncHNzb3Byc3N4c3NycXFrd2ZJPD5CRUI+Ozo5OD1HUE9OVU9JTE9KVVlfYlxUWGhhXGFz
ZWVmYmdpaWlyd3Z2dHZzeHh3dHJ0dnx5gI6Wj5SRjYuPjY+MfX1/gn18fzUyNDQ1ODMyNzMzNDQ1
NTk5NzMzNTQ1MzIxNTUyNTQzNTg0NDU1ODk5NTM1NDg4MzM0NTAwMC81MjU1NTc1NDQ0MzM1NTU1
NDUzNDMxMDM1NTc3ODg1NTg6NTU3ODg3NTU1NTtAPj5CPTs4NTU5OTg1OkRNS0tSUE1QU1VUVlVU
TkpNUEpHRUdERklPT01LSVJUVlhZXFtZW15hYFxcW1hbXFlcW1tZWFZSU1BHPjxBR01SUk9SUFBQ
UE5QU1BPTE5SS0RFR0ZJPjczMzI3NTQ1NDU0NDEyNDgyMzU0ODUzNTQ0NDI4NzQ1MzM0MzU1MzQ0
MjMzMjEyNzc1MzU1OTc1MzU4NzU1MzQ4ODU1NzczNTU1NzQ3Nz04NTU1NDM1NDU6NTM1OTU0NTU4
OTUyMzk4NzMzMzg0NTU3ODg1MjEzMjU3NTQ1NTczNTo3MTUzNTU3NzQzMjM4NTc1NTQxNDU1ODk4
Nzo4NTc0ODc1Nzc3NTg7PDw9PT5ARUVCPkBCRElFQ0NDPj49ODU3NTU6ODUyNDQ3NzU1NzQzMjIz
NTg1OTc0NTQ0NDI0ODc3ODU1NzU3NTU4Ozw7ODo5NTo9PD49PD06Pjo8PkE9OjU1ODc3NDU7NzU1
NTQ0NTozNTMzMzQ1NTgyMzU3Nzc0NTg3MjI4Mjc1NDQ1MzUyNzAsMDU1ODU1NDMxNDQzMzQyMDM1
My8xMjM1NzUyNTUzMjU1MzEzNTMyMjI1NTE5ODU1NTUwMTAzNTU0NTIzNTUzMzQ0Nzc1NDQ1MzU1
NDU1MjQzNTU1Nzc0MjQxNTU1NTU6PTU0MzAzODc3NzUvLC4uLzAxNDM0NTk1NzQzOTkyNDQ7OTU1
MjI1OT49Qk5AOzw7OTw6Oj0+QEM9PDw8QT49PUM+QUNDQT5BQkZBQEBDQkE6NTEyMDU3OTc3Ojs9
PkJDPT49QEA8PT0+QkNGR0xPUE1PUFBQUlBQSUdKR0Q+QERCPkNFR0teZFxVUElNT1JbXFtcXV5d
XGBhYl5ZWVlYVlJNUEdGRUFER0dMTlBUU1hTU05MS0dLRkZGR0pXX2Zrbm50dnd3eHh7enx2enp6
en12d3d5eX12dHN0dHdzdnZ0c3Jxc3FqZ29za2JgYmlrbXFrZ2FYW293dHiDlY2ChIJ6fX17d3p0
dGZeWVNQUk1KRkA+Ojs3My81QUA+Oz5GQkFCPjg8S1BWXlxbWVtcXl1dYGFfYmVmaWtzhH15enyG
hnx9f3x9hIOCgYOAhJaNj56OfYCCgH1/fXZ6eHJtcYaGbXJ0hJt7bWFgYmJiZGprbWpzhnCEgWpl
am9vbWt8hripgHh9gn19gIaIi4N/fXx2a26htXpreoSEgH2Agn96eHp6cmheXF1ZXFtdXWJlYnKY
enJvcmpnZGZhXmFfXlxYXWFkZWlrZ2h7fWtraVZHR0lUWFBVZGhoa2tqcHJva2txV0pVX3NvZmJm
aW9ra2hlZ2dnZWBfa01QX2hwd4WFhICCgIKAgo2Jg4OCj4p7iHBeaZKhn6GhoaSpqKOz09usoKWo
p6abkY+OkZaPi42LfWliWFBLSTsqKC81T1hXWV9xZ21ra294eHp7gISGiY2PlpKIhHp5bmtpamJg
YU9GRUlPSkdHS0pKTUtNU1hbcH19eHJzcWtmZl5fZWpve3RzeXh8e3p0eH2If3RydHF0d3Z3gIqD
hYiLjJGOjoqFhIqPmo6Oj4+TmJydmJqdpMSzp5ORl4yGhYiMjoaEf4J8f312U02KdFhhZWBmaGRi
YV9iYltYVVZWWWlwbnB3hZWgoaaqqKOlqqaeo6Wjoaeppqqtqqivwe700sTx/vGYYlRXWVZccISI
ipKPkp6cmpaRkZOSkY6OhoZ9fYWDf4OGjZ2opailqq2trKqsqqiqqqqoqqaho6imraOYm5qan56V
m5iUl5iVmJ6Yj5GTlpaGfHx5dmVKQT5ARUdGPDpARk1SVltdaWlrYmRiZGpman9/g5KdkoiKj4qC
eHd5fIZ/dnp0e4J3cXFzcHp4fHd5dHaDf4h8eoOGgYSJk5WTlpedqqOdoKGbmJeclZGOfXN4dnmP
i4mPlJqepKijoaGgnZePjIqPfH+LiYmNjpGRmJiYm5unqKGjp6GhpaShm31rbXZ/f32AhYF/fZGg
f2RWWYyqm4WEiIqJj4+RjY+PioyVmI+Oj4Z6Zl5kdpiqr665srm6sK6xsK+sqqepqqytspOLhIGJ
fX13d3JWSkpLTVBdr8KEW05QU11dWGBiZml2fYB9gYWGhoOGioyNio+Njo6Vl5OTmJaWmJqblZic
mJybmJiclouMioWEb2JilvT++/r8s25zfX2BhoWGi4aRlJGdnpWSmKmmj4+PjIiJjo6GhISDfH12
dHRzcGlnX0c8PlVcXV1gYmdvf3x6e4KGgImMf3yFhH96fIV6dHJua2lnZGlramBfYnCOno16bWBV
VFNPWGFyeHR4fIF6d3Zya3N4eX+Cf4OKj4yLiouRmJ6MhoOGhoSCdnJrZ2ViYml4dHJxc3F0dHl8
enR3e3x9hY+Lio6MkpeTmJ+enqOem6qym46PlZaPhX+BcmliZnNramhmbntuZGFgR0NNRkdJV2JZ
YGVpa2pnb3B0dIp7cnZvZWFlWExBPUVBPjk5OTw+Oj4+TUVNYFRHRUpMVV1XVl1fZ11cYmRmYmJk
aG9xbnF8eXh6dHl7dHhydHF2dHZ9jY+Rj4yNjYqNkoZ8e4SEhIGKMjM4NTk1NzU1NzU1MjU1NDI0
NTIzNDQ1NTc1NzUwLzI1NDo3NDU1MzU0NDM0NDcxMDUzMzQ1NDUxNDMyMjU0NDMzMzMwNDI1NTUz
NTczMi8uMTk4NTUyODU1NC8yNDEzMTc8QkVFQ0JFPjw8ODc6PURHTFBQVVZYWFZUVllVUlhYWVNX
VVNOSURGSkxUVVBOUFZfYmFgXllcXmJhZGBdXmJhYWJiXFteWVdVUE9JSlRTU1JWWFhXVVRQVFNS
U1RQUlVQUk9QTktJPDU5NzU1MTMxNTU1NTU0NTg3NzM1NTc1NDUvMjM1NTc1NTUyMjMxNDcyNTU3
ODc4OTIzOTo1NDM4NTU3ODU0Nzc1NzQzNTM3ODU3ODU0Nzk3NTk1NDk4NDIzMjUyMzU1NzQ1NTU1
NDc1MjU1MjU1MzU1NTMzMDc3ODU3NDAyOD05Ojw8PDg1NTQ1NTM3NTU1MzQ0MzU6Nzc3Nzc1Nzc1
MjI0NTM3ODU3Oj09PT08QkNGRUVCRERKSkRFSUdGQj48OTI0OTUzMjU3MjU0NTg6OTg4NzU3NTQ3
ODIxMjQ1NDQzNTU4NTgyMzM4Pjk4Ozo7QTw9QD49PD48Pj4+QkdHRkpMSUVHRT07NDczNTQ1NTQ3
NTU0NTUzMjU1NTk1MzExNTc4Nzc1NDQyMzUyNTU1MjU1NTU0NTQ1MzQ1NDU1NDU1MzQyMzQzNTUy
MjQ1MzU1MzEyMTE1ODczMDE0ODUyLzIxLzQ0NTUxNTU1NTc3NzIyMTU0Mjc4NTg3MjIxMTEzNTUw
NDU3NDIzMzU1NTUzMzg4NzU1NTQyODw4NTc6ODQvLC4uLy81NTU1MTM1NDU3NzMvMDQzMTEwNDU6
PD09Q0dAQEA+QD09PkBCQEFDRkE9QUJDQkFFRUVDQ0BBREZDQ0NER0c0MjI0NTQ7Oz09QD5BPkBC
PUFCPjs9PkdFRElNVFJQUldcWFhUUlJSUlJQTlNbXVlOTExLS09YW1VMTVVbW1lcXGBhYWBiYmli
YmFcXFtQUF5cVFhJQUNHS0xMUFJSVFRVUElLSkdFREtJS1RiaGttcXd2dHp6eHt8fHh7fH17fYB8
e3x6dnd4d3d4eXd4gnd0dnRzc29vcW9rYl5kam1rbW1ucltWaHl3eX2Oi4SAfX+CfH1zbm1mYF1W
VllVU09HQj4+QDw3MzU+Q0VGREdFQ0BDPUJPUllqalxcZGBcXV1dYmFlYWlrbXN5fH9/gYOJf4N/
fX1/g32Bj4Z9hISLmI6LhoWGgoOBeXd6enl5d3FudoqScWVucGp5cn1/enNraXFxcHBraX16ZFtb
YG6Fr5F/e4B9fH2Bg4iGhX2BhoR3dH9xa3aGioSBhYiGiYJ/d290aWRpZF1bW1xcZGZqbXyRu5Fn
aGZna2thXl9iX15gZGhtcmhla3l2bm90WEJDRkpPUF1lZX2Gb2tra2lra3dkWXFxYmRpcGtoa3CO
bWRiYmJdVltbV1lea32FhoF/goKEhYSJjIuPiYaJgn16dGl4mJ6qpZ2eo6iuvLvy77OgpKiqr6if
j4uLiImGhYFxaGJdWFROOispLkJZU1xpaH9xZmd9fHd7f4KFgoWMj5SWko2Jg3Z0bW9tcWtmXFBV
VE1JR0ZHSUtLTU1PUFVbanl3cHBubW5mW11laG50en99e313fHx9goaBeYJ6eH19f4OEiIqOi4uO
k5iVkY6MjZWWk5qRk5uhqrm8v766vK+qpqagppSJiIaEiIOLg3x3dIBnSl9iXmJlXmJlZmZiYmZf
W1ZUUFJZbXZtcXaCkqGur6q1tbCsrqmnpKaqqq2wqqmosarM/fe5sNnp2b+Pb1dXUFBbdoCGioSG
lo+Lj5KUkpKOjISNno58fX+BlaOjo6Wkqq2trKeqpqGnqqmpqaqkoKGhpaGfn5+hnpuYm5ihoJ2c
n5qalpiYl5aRjYmEgHt3Z0o+OkE9NzQxMThES1VpZF9iZmdkYmdpdGRib254k5iOkZicioF6d3d3
fX12dnyAem90cXN2enx5f319f4OGhoiKn7KYjpGPmJacl5qfnp2emJqXkpGKhXlpZWhtcX2DjpOa
mJuepKOho6GhmJePioF0hoiDhouSlY+TmpiWl6OnrbGvrK2nqqOajHlud4N8eXt9fX16gYZ5ZlRX
aZGajYmMi46Lj5GVlJOTjZGSj4+SmIBoYmlykaeoraytt7Wys7LItaqqpa2pp6/HnndzfHx6enZr
alhHTlBUU1mBmmJNT1RUW11dXl1haG55homCgIWGi4+VkoiPl5GOk5GRk6abkZGVmJqcm5ycmJib
nZyXlo+JiINwYWi6/P7j3+ydbXN8g4OEioaOjYuOk5ebmJiomI+Nj56VjY2OlIaDgn+Ci4J6dHFv
aGJZRzlAUlxeXmlnZmlxen19iIh9fX99eYGBenh5eXRubm1tbWhoZGFdXGBiboSFho10XFVQUFNU
X253fYOEhXh2dHBycXd9f4aNjY2Mi4yPnpGRkY2Lj4qEgn16b2dhYWBib3l2dHR3en2EhX19gH+C
hoSDhYCEiJOWlqGmmpuYoaeloaOen6eblJKLg3pnWFxeZWZiZmltcGhhXVxNTEVHUlNYWFhcW1lm
a2dqbWtxcWtpYmJkYl1cU0dDPDw7PT08Oj06Nzk+PENYVFBOS1BXWV1mYmFrZWZkampra2trbnhz
d4B9fYV4dHl0d318eXh9gIaPjo6Rj46PkpSSiYF/g4SGi4w1MzUzMzk1MzUzNTU1NDU0MjA0ODM1
Nzc4PDU0MDA0MzM4NTMyMjA4OTczNDUzNDM0NTQ3MjQ6NDM0MTM0NTQxNTQzNDQxMzIyLjI0MjI0
NTI0NTUzNTc4NDU4NzU0NTQ3ODxCREVGR0lDRENCQ0RGTFBYW1lZXVxYWVlXV15ZWVldYV5fWVlV
UllZWWJlYGBiZWFfYGJkZWRlZGJhYV5fXVxfXl1cYmBgXVZVUE9WW1tcXFhZWVdZVldZV1lXVlVS
V1ZTV1JQUlBMQDQxMTQzNTg3NTIzMTU1NDQ0NDM1NDQ0MDM0Nzc0MzM1NDUzNTg0MjQ1NDIzMzE0
MzU3ODc0NTcyMzM1ODU1ODg1MjMyNDs4Nzk4NzU1Nzc3Nzg4NTU3MjEyNTUzNTk3NDM1MjIyNDQ0
Mi8yNTU1NTg1NDQ0MzM0NTU0NTU6ODs4PDs7QUE+OjU1NzUzNTk3NzU6Nzk3Ozw7Ojs3OTs3NTU6
Ozg3Mzc5Nz08OztARERFR0dGSkdFSUZGRkBCQ0A8NTU1NTU4ODU1ODU0Nzc3ODU3Nzg4ODUxLis0
Ly81NTUzMjIxLzQ1ODk5Nzk9Ojk5PD5BPkJAQD1ARkRDSU1JR0lKSkxJS0xHQTQxNzc1NTU1NDU1
OTM1ODUzNTIxMzI0ODM3OTU1NTQ1NTM1NzU0NDg5ODU4NzM1ODczODU5NTM0NDU3NDIzNTM1NTk0
NTg5NTMyMTM1ODg4NTE1MzQ3NzQ1NDU5OjUyMzAxNTU3NDQ1OTk4MTU0NTUyMjM0NzU1OTk0Lzg1
Nzg6ODo6ODc5Nzc5NzU5PDs+QDs8QD47PT01MzEyNDQxMTI0ODg6OTg3Nzk1NTQ1Nzk6Oz05PEFH
T0U+PTxGREZARENCRkJDRUJGSkpGRE5GRkNFR0lHRUZHREZJS0Q3MTM1PT48QkRCQ0JERkJDREVH
R05WXVZMSk5VV1ZYXF9bWVlbXFlYUlhZZGtnWU5MTlBNT1VbVlBYZGtkYmJiZGRiYWRnaWtoaGZh
YVxdZWJWUEZDQ0ZHS09QT1NTWVRQS05MS0dJSUtJTFlqa3F3dHN4e3t6fX19fX15e32DfHx5en19
end6e3l7en2CenJ0eXd5d3JwbmtkaWptbW5qam5tYlVfcXd0cnqBhYKGhoF7d3dxa2diXFhTUlNQ
S0tEPjk6PjkyND5BQkNGPkBBREFAPUlPVFldYGFbXltgXV5iZmdqaW1zcnF6k4h9goOGgn99eo+T
nY56dn+Cf4aOmJKLhIOIgoGAf316fXt4gHFlaX1zYmlya3R0ZWF6ZYJ4hHhra29wd29dVlVbYnCI
iZKGfX+ChoWGhYqShYCEhYB5eHBvdIaXm46Ji4qFfYKCdIxxZGpiX19dXWRiZGZmcKrRgG1nbnmD
cmlpaGtWZW9wfH1ucW9vcXBra3NkVFBLSkxVZmVoeYZybWtub250dGFfbWliXWJraGdlbWloa2pt
Zl5fZmZpfZ6IgH2AgX18gIKDhoqFhouPioSFgXx3eIqVmJedoKGloKOnr8K8rKmpqKOpp6GbjIF9
hYV9cmZgXGBcV003Li44TF9ZWYF0aGJxgoaBeHeAiISJlJWSk5KTi4mBenh0cW1wbmReVlJQS0VK
SU5KR0ZJUlJSUFVkcW1tcG5rhnliWVxobnd9fX19gIF9eXuEhoJ9enl7hYSGiIyNkZGWnJSam5yg
m46Mjo2Rk5SbrLa1u76/ubW4t6ynu7qhko6FgYOGgYaUenNwZ0pGV2hkYGBeYWVmZWFfWVlgWFdT
S09khHxze4ags7WzsrKys7qyrKqsrbCqqrezrbGzsrzd9sGmrbu2yb6cYlNMR1V4oZKEhImIhoiM
jY+PiomOhoOOg3uBgpGkqqOlqqqqpqipqqmpp6mqqaGhpqOmpqShnp+hn5ikoaGYnKOgmJidl5iW
m6edkYyPiYaEfXlpUEZGRjw1LywsOT5GT2VhYHd0Z2ViZmZraGhiaH2Sk5aYj4yBg4B8gXp9en18
eXRycndwb3Z7fYGCgIGEhY2Nlbz19qqGj5OcnZeYl5+gn5ygn5uWj4yJa2dmYmtvfIiPk5qfm5yc
m5+opKCempaYf32JhoaGjZGTl5qYmJqcr6qor6yqqK6xraaagnJ6gHp2eX95d3p7eGtmXnqXpLGS
i5iSk5Sdnq2gj5eXk5KPlo+Jf3BpbniKoaqpqbG5vLKxtsOzraqvqKatqsWbenh5fH96cG1lVVZT
VFVTU1leVlBPUFRXV1lcW19obXSBg4OGi4qKiI+YlI2Rk5aLjIySn5aUmJiXmJWdnJuYmqGfm5aP
jI+Ng3RnaZLa0o59iYaEhoKFgIOGhIaFjI2PkpWYmL/NmoGLk5KNipiajoSChYN9f3p0eHBtZl9T
S1VZXWJkgoNnZWt7g4WCf4CCfH16e4B5dnd0cm9rbm1raGJkYmVcWF5iXVdkcl5QSkdMT1hda3F5
f318eXh0dHd5fIKEiYyTkpicj4+jj4aGj4qIjIaBgHpvZ2hmYGZxenpyeXp7fH+AfX2DhoaMi4SG
gH2FjI+WoaeXmJunqJ6gpKGjraitrZGDeGVYW11kZGloYmRoZmJhYlZURENPUFJUWF5ZW2BiYmpk
ZWdtaGVlZF5cXWFoUkVBOzo6Oj46Ozk6Pj49Q0FHTlJQV11kX2JmZmhoaXR5a253dnFucXJ9hYKE
f3h4gHp5eXd7fYF9f46VlJKPjI6Pko+Fg4WGho6ViTc0NTU1NTc1NDIzNTE0NzUzNDIzMzc1NDUz
MDMwMzQyNDU4NzQ0NTUzNTUzMzU1NTU1ODc4ODQ1NTM1NTQyNzMxMzI0MjM0MTIyNTg1NDM0NzQ0
MzQ3NTQ3ODMzNTg3OTw+RUVLTU1KR0ZGR0xKTVBQUFZcYmVeYGBiYmBgYWBfYGFiYWFkZmRqZWhl
Z25wa2ZiYGJoamhqaWReYWhoZWJkYmJhX15eX2BfXVlbW2BiYmJhYV5eXltdYWFXWVtiX1tZWVxd
WFtdVlNMRDgyLzI6OTk5NTU1NTQ0NTU1MzM0NTg4NTIxNTU0MTM0Nzc4PT05ODgzNDU0NDg3MzQ1
NDEzNTg1NTc5ODU1NTk8NTU1PDUyMzIyMzIzNTU4NTc3Nzc0NTM0NTMzMzc0NDQyNTU1NDU0MzE3
NTc1NTUzNTU0NDczNDMzMzc4NTU1Nzk+PkE+Ozc1ODc1NTk7PTs6ODc4PD07ODc3ODg3Nzg4NzU0
OTU4ODs9QURER0dHR0dLSkdJS0dHR0JGR0tANzUxMzQzNTk4Nzk3ODc4NTU0NTU0MzExLy4wMC8y
MTEyLy4yNDU+Pjw8ODk7Pj0+Pj46PUBAQ0FAQ0dMTU5OUFBNS1BPTkxLRDs0MjU1ODU1NTQ1MTMy
MjQ4NTIvMTU5NzczNTU1MjEyNDI0NTc3MjM0NTQzNTU0MDMyMTAyNDMyMTU1MjMyMzc5NTMyMzU1
NTUzMjc1MTMzNTU0MzQzMzQ4NzIyNDI1MjI0NDQyMzQxNTk3NDUzMS4uNTc0ODc1NTU6PD08OTg7
PD05PT04OTk9PTo6Oz49Pj46PkJAPjw0NTEwNDQyNTU1OTg1NTtASU9HQDxBQD5HRD4+PkFHRjw7
QElEPj5DQ0FBR0dDQkZHSkdHRUdHRURLUEtJTVBOTFBSSj03NDU4PUZFREVFR0dHR0dJTk5VW2Rm
X01HTFJYWFVcXFxeX15gWVZZWVlcYWFbUEtQTlBWW1lSTVhhZmZnaGZkZGZraWlnaGtqZ2pfW2Vl
Z1BFREdGR0pPUE5SUl5pXFJPUFBHR0pNUE9MXWlucnN3eXl6enx8d319fX+Ben+AfHt9fYB9eX2B
enp5d3h2dHN4dnR0f310amJmZ21xa2lucnBlXWR0eHd0eYSFg4B9fX15dnJraWFZVlNQUFBLR0E+
PT5BOTtDSUZGSU5OT0lAQkRGTFJSVVxcXllbWVlcX2JkYmJocnRwcnZ7gISnoI6Af4KJmop9eIOS
lImFiYaJjJiPiYaEhIJ9fX15fXt3cW9uanBudnBnXVdMR05fenlraHJ4eIVvZV5ZVlloc3iGmpSC
f4ODhoWIj5qIf4WEfHt9g3aBi5eVjY6JjImIin1xaGJkXllbXF9dXWJmaGprfYhxdoCYx7GIj4Zx
Zk9bc3eLqJhqc3NxaWVrYVteYl1ORVBiYWJoa2tydHRwcG9uZWpkYmBhYmBiZGJeYm13cWptYmtx
dnZ6hIaBenx9f4OGg4OKi4aIioWGiYaCfHuEoJiPmKGem6Glo6Optq6mqqmsqqyto52NbWZoaWlt
a2ZeWVZXUjguNEZPYGJeYWVtbnRzeH19fYaJipGTkZiYmpuOjYuGfHRwbnJ0b2tdUlJHTEtQT0xL
TlNUWFVQUFhpdmtqaGVza2tianBxcXZ9gX+BhYSFmop6dnZ3fIKakouMkZKPk5eYk56emp2ekpOS
j5GXnrC8urq8ury8trW1sqmpqqacmJuPiIaIgn15cWlUPkVZZGRkZWRiYWJhXWBpXllTWFJOUFt8
fHeCnK+yr62yrq+1sa2trKqxwq2lrLGvsLOus9TFs7Kqsq6oqap2T0VOX3qcioaLiIaGioWKhpOW
i4GAfXh6doOTo6yvrKaoqamus6mop6eprKispqGfoaajo52bmqihnZufm5ydnJ+fmpuWk5eUl5ia
m4yJhI2FenFZS0dHQjUxLCwzOUJNWF1hiJZvaHF3cG5rZ2JnfZyXj46Mi5eMhIB9e3l7dnZ2dHR0
dnJ2fIR/f4aFiIaIio6Y4v7Xn7OhmpiYnaGhn5+hpaCYmJSMi3plZmJlam19kZiVl5WYlpSbnaCh
n6CmqqGTmI+GiI2OkZagnp6alKCzsrGwsrOsqrato56ReHBxcnh4fYB3fIaIhG5vxNScjJKXoKip
pZ2qoZiam5uWko+Sko9/eHp4fYmeqK6ysamztq6ur7Gvqqqkqa+ss499e3p5eXpwamBWV1VVWFNU
U1VQUFBQU1RXWFhZYGBibXd7gYOGj4qMj5iYk5GPjo6Sj4+Ok5iYmJugnpuXmJ+hoaOhnqGllY53
c3BtaW9vaXR8gIaRjIWAf3+FiYaLjpSTlJ6es7+RiIiOj5OSlZaMi4aFg4GAfXl7cmdkZ2ZmZF9i
YmRza2ZrdoODf4mBfHt/fX2Cenh0eHh2cWhra2traWVkYGJkYGBNPkNHQEFHTU1NUlJhcHJ3enZ2
dnZ4fYWLi4+Tk5WgnJybj5+hi4aGhIWKhIGCdnZxZFxfaXN7fXx3e3x9gIF/hoGCiouLiIKFfYGF
kp+YmpycoKOkpJ+nrKOhnrfHoYt7YlZbXWdna2lpYl5kZF9cTkdGR0lNVlZWWV9hYGBgZGJpam10
a2Jla2JhYWRVRkNCQTk6OjU8S0RHR0VDSklQal9ZaYtuZWtycnR0dHd0d315d3Z0fJSPg3t5fIJ9
enZ8fX97iZeFho2ak46Pj46UjYaImJOEj4mGNTU1NTM1Nzc4OTc3NDU1NDI5NTU4NDMzMzg4NTU1
NDU1NTIzNDQyMTQ0MzUzMzU1MTU1MjM1NTU3MjI1MzIzMTUzMjIzMTMyNTU1NDUxMTIyMzQ4NTc3
MzU4NTU6PUNDQEZJSlBSVE1OUFJQUlJSV1ldW2VnZGVoZmdpa2loZWVmZWZpZ2VmaWltbW9vcnNy
cG1ra25tb21taGhnaGtrZWZoZWJlX2JkYmJkXVRZZWtpaWRpZmJiYWFhYGViXlxgYV1cZF9dYVtV
WFlURzw4QEVGQUA+OTc1NTU4OTc5NzU4PTo3Nzk3OTk1ODpAPkFBQT4+PTo3Nzg1MzM0NDU1NDU1
NTM1NTUzMjk4NTU1MzU3MjU5ODUyODg1NTc5NDc4NzU7NzQ0NzU1MzQ1NTk4LjA0OjU5Pj47Oz06
NDU0OTw5NTU1ODc9PTk8Ozs7PDs5PkI8PURDQkA+PTs5PDs5ODs+Pjg4NTk8Nzg6OjU0MjM5Ojk+
PT5AQUNBQ0VERkdJR0tNSkRFR0Q+RD03Nzo3NDAzNDU1MzU1OTo3NTo4NzMxMS8uLy8vMDIyMzAu
MDU1Mjw6NTk7PkA7PT49PD4+QkFFRkdHR0lTVE1OU1VTU1BPUktHRUE1NDQyNTM1NDU1NTU1NTU4
OTc5ODU1NTUzMjQ0NTQ1MjU3NDI0NTQ0Mjc1ODU0MjQ1NTc5NzQ1NDIzMzQ1NTc0NTQ1MzIzMzUx
NTw5NTM1OTg1NDs3NDc1NzU1MjMyMzU4Nzc1NTk1OTc1NTQ1Nzk0MzU1MjU0Oj08Ojs4PD47OTg4
OkBDQzw6PEA+PkNCPD5DREVHRUA3MzIzMjI1NTc5OTk4PktSWU1ERUdFRklGRUVDPkZGRUVHRElQ
Q0JBQkdKTU1NT05MTEpMTlBMTU1MT1VXW1lhZHBcTEA6QEJGSkpHRUdLTExOS1BXWV5dXVdUS05P
VllcWVlhYmBcXGFiYV5ZWVteX1tYVFVWVFZeWVJZXGBmZWJmaWdpamltbnFvb2lra2hkaG1vVkpK
TUdMS0tMT1NWZ21ZUFVST0xHS09NTE9dZmtwdH+AfHl7ent9fXp7d398fH19f3x6dHp7eXp4eHl7
e3p6d3t5eXd6cW5paG90cHRwa25wb2VYYGt3enp8fYGCgoCAenp4dG1mXFJKSU1MSUVBPkJEQkdK
RUdHR0pEQ0lJUElFQT1FUFBSWWBlX1xXXGBbYGpqbnN3dmprbnp6eH1/jH18g3xxcHl9hoyFhISG
iI6PioqPkYuGg3+AgH16fW1lbXFrfHlmXllQSUBAQkVgcnB0dGtxnHNYU1dcX2d2homFjoGDf4KI
jouPnJqMgH2Bg4aGfXmPkomGiIaGhoiFg3RpZGFeWVZVWVxeXGJmamVqdnSGkp3FxYZ3en98doSD
eXiCiIN7d319hHtvYGF0aFlQWV9eYmtwc21rcG9tcXlnZWRhYF1YXWJrYlhZXVZTUGJqdHeAmop8
fYOBgYJ9fYB/g4GDhoqKiYmKhoSFgY+dlpeWnp2boaGcoamprq2orbOssKyqoY+LcmhmaGVlXmFc
VFJHMyw6VFlZWWJoaGtyen19fH+Dho2OkZeXmJyYj5GRj4x9dnJwbW9zcWVbUk5OTUpOTU1NVVRd
VU9PUGJramdpZGRnZWaCj3hyfH2AgYOEhoaJg312eXuFlpWUko+XlZygoKGjn56cm5uSkY2Kj6q2
vrm8wMHAvLu+vrq3sLWxraGhsJuEgoF7fINrZlI+PllgYWJqZGRoYF5lYWZhWFdUWVhOWG94iaW3
sq+xs7O2tra3rrKxrqWmrLGtsby2rK61vK+/wKyuqqWkrX9QQlJ0e3iGjIuMj4qIhYWGjJOGg4J9
d3R7gJWsraqtpqSmqKisrKeqqaGmrKqhoaGcoZuXm5qYm5uhoZ2fnp2em56doZueoZqTk5OPj42O
mIt9dFlOR0pJQDkxKzE5PlBWV2BucHBzdHZ0f3FnYmWArJWJjpGRi317fHx5dHR2eHh3b3Jwa3R5
fH+ChoaGiJGPkpbN3p+TsaienJyfnqGhpJ6npp6XjoqDe15WVmBiZISYkpGPj5KUk5WanZuco8DJ
ppiUjIaGjZOVkpifm5aaobGzsLKxtbOxsLGmnYyGcHJ0c3NydHR9ldLWgobgvI+Ikpqcm6Okqqme
m5aRkpGUj4+Vko50cW5ye5iop6qusbu8s7DM0bGpp6alo62njYKFgHx8e3NpYFdZVVdZWFZUVVRQ
UFJQUFZZW11gYWhtfYaGhoiGjZOUlZGKiY+blI2Nk5OSoaChnpKao6GdoKGhpZ2jo62ShIB/fXNg
VmBtd3yBiYmFgYCBhYaFiYiJj5GVl5OYk46PjZGVlJGPjYqEiIaGgX+Ad3J0a2lzcW9oZ3FpYmpq
bX2DjYmAfH2BfX16eH19enJxcHBva2tramFkZ2ViYmFeXkc1MzI0OFNQR1BQUllqdHd0d3h6fIOO
j4yMjpKWoKGfrq+Pj5+Wg4KDhYWAgoGAeW9fWVtpdHl9f3x9gn+CiISFhIOLi4iIhoJ6dniJlJqY
mKGlnqGfo7vSrZiYoKWqoIhkV1lgZGl3amRmYGBdXFdFRUxER0dOVFhda19fYGVmZ25oZnJnYmJp
YmBfX1hYT0lJQDoxNEpXTlBSTUxMUFVwZWdvfXFocHR0enqAe3Fydnh9fYCEjIaEgHt3fX95eHZ5
fX1/f3x9ibekhoqNkqiPhIaPjIaMjYs4OzUxNzk1MTM1NTQ0NTM0NTU1NTI1OjQ1NDo1MzU1NDQ1
NzU0MzQ0NTUzNTgzMzM1NTc1NTk0Mzc1MjM5NTUzNDg1NTEyNTU1NDM1MzQyMzQ1ODg1ODU1NzU4
PkZERElJR1BNUFNXVFNUVldYXV1gYmVlamttbm5qa21tcHBrbW1qbnFxc29xcW5tcXR2dnNyb25r
bmtra2tpbmpramloa2tnaWRiYV1dYmJhYWVoamtrZmtqamZkZF5hYGFiXl5gXFlgYGFdZF5ZZl9L
QEJFR0ZLTExKRkVDPjw8OT06PDo5OTU4NDQ5ODU7PkFHS0dFRUA+Ojs6Ojc0MzM1NTU1NDU3NTU1
NDU1ODU5OTg0NDk3OTk0NTU1NTk1MzU0NTU5NTM0MjU1NTQyMjc0NTQ0NTI1Nz08PT4+Ozo4NTQy
NTc1NDU4NDg3Ojg1ODo+Sj09ODw8Pj4+QDw8ODo5Ojo5Oj4+Ozg3OTc3NT1QQzUzNDU4ODg6PkFC
QEBDQENDRkdGREVJSkZERkZJS0U9ODg7NzMxMzo5ODU1OT47Ozk9QEJAOzU0Nzs5OTo4NTQxLjIy
OTo+PkBBQ0ZHR0dFSktHTUZHR0tNTlJNTlNXWVlWUFJLTE5MSkQ7NTs4MzU1NTU1MjQ1NTk3Nzg1
Mjc3NTU1NTk5NTMxNTQ4NzU0MjM0MjQ0MDQzMTU0MzU6MjI1NTU0MzU4NzI0NDUzLzU0NDU1NDI1
ODs9PkREQT45NTU6NDQ3Ojg4Ojc6Pjw4Oj09Pjk7ODU1NDM1MzI4PTw+QD47Ozw+PTs6Oz4+Pj09
QEBBPjw9PTg8Q0JHQkZEOzU3MS80NzU6Ozo9O0BCR0lMTE1LSkZHSUtOUk9NTE5SVFlWXVtQT0tQ
UlRTW1lbV1VVU1RSUk5PTlRWWFhbWGByg4KAfVxQUFBNRUdHR05QTlBVWVtZWV1TU1NVTU5Yc25i
YGJiYWJiYmRhZmdhYF5gW1lYXFZWYGZZVGBkZWRlbWtqaW1wbm9wcnJycG9qaGVybmtYVVVNSUlH
R01PUFNhWVBWV1hTUFRPT0tLT1dla3R7fHt8fX99fX2AgYGAhoF6d4CDfXt7ent5eoB9end6e319
eXt8dnR5emlrcXJudHZya25raGJkb3Z7dHN3eX+AfH99dHRya2JVTUdKREdHRUZER05QTUtKSkpJ
RUdLSUpMUEZCQUVcWFRTVFhZWVxbXWJxgGtkbW1xcnNvcnNze3FpaWJibnqBg4GAgIaFhoyLi42O
i42PioKAhIOAfYSRbVtZXGJlWVNMR0ZESk9AOkBOXXmyhFRbWVVdXmRpaWuFhYF/g319hoaJipaS
jouPkoyGgYKBeJudhoWGhoaLhYaAdGZiYF5ZXlhXWWFiZWltcnt9goGLjo+Uj4uNiYiIko+SmJGR
j4uBfIB6gIR9eW9iYmZoYF9leoJ4cHFydHSBemplZF9gYWJfWGRfUFdvU05Za3h9c3R4enh9iYKC
gn2BgoaFiYSGiIiFhYyIhoaEmJWVmpuhoZ2hpKW1sqipqKmtr7Csr62mnZN6cnRvbWdiX11XUEU0
M0NXXFlhYm5xc3l9f4GFhoqKk5eXlZebmpWVk5GRint0eHp2cnFub3JbWFBOUFJUU1NTWV9XTVJk
YmlrZ2JmaGVlZXR0cXZ3fX2DgYODhoSFfXx6f4man5+aoaGhoZ6go6afmJyanpyUj5Wjvru5urrB
wsC8vsC8vr7Kwby2pKqcl4Z9dHd6cmtiSz4+Tl5nYmZlYmRiYndrYV5eWVlbV1lgcIOXp66zsbG2
s7O6uriyrq6uqaqur7WxsbWys8C8tbW/18qqp6WfjFtHWXZ7gIiMi4iKjYaGhIiFhYyEgX17dn2K
naaqqaqzrKinprKqpaampamtqqGYn5eOlJaWmJabn6GjoaGqn52dmpufnZilm5OUlZGVmJOTg314
ZldWU1BORUNCRUlQU1BUXGWApIR2dnR9gWpgYmh6ho2PioiFfXh0dnZzdHN3cXJycWtreX+ChYuX
j4GGiZKXlpicm56jqKOfn5+kpqmgn6OpoZiPioN0XFlST09UboCIkZyPjJeYmJuXnKqhloaNlZKT
l4+PmJ2am52cnJufp7i1s7Gys7Oyqqedi3txcYV4bmludnaIvMuBn8CYho2Pl5ihp6iqrqahoJeW
mJiYlpSSjIR8d3F5oKyprayut7nFuL7Iu7Kqo6iqoZqViIKDgXx9dGtqUEtTXVtXWFZTUE5QUlRS
U1BTWF5hamtyf32BhYODi4yIi4+JjZONjIqGjYyPnN3ltYuUnZyopq+8pJeXoY+Gg4SGeWpdWWJw
komChoV/f4GBg4WDhYiNlZWRkomIi42Pjo+PlZqSi4aLioiFgHt6eGpnaXp0cWlrdmppbnOAioWG
goGEfXt3eXl9dnl6dHJucW9va2toZmhiXl1bWV9iSjQvMzc7TU9LTU5TV3GAfXx/gYCLkpGUlJWY
mJuhn6Ghm42BiJKDg4SAgIN8eHx4a19cXW90eXh7g4WGhYuYj4aIiI6MhIV/d3d0do2bkpaamp6h
oaOsrLOkoaWjn6OflHxhXGBkZGhpfXNhYWBcVkRBSkVKTU9UU1xnYWJkZWZvfWlhaWJoamRlYl9r
ZXFVUEc+NTQ6R1JZWVtVT1BTYm5nfXxzeHF3e3l9hIF8f3yAhIKJi4WGhoKBgnx9iYB7d3mCfHh/
f4KGmpOGhoaNlIyEgYiMj4yMjDc1MzU5NzIyNDU1NTU1ODg1NzUzMTMzNDIwMzA3Mzc1MzQ8NTM0
NDM0Mjc0NDU4NTg1NTQ1ODU4MzE1NTUxODk4NDIxMjI1NTUxNDMyMzcyMzIxLjU4NTM0N0BHSkdH
R0tJR09PUlhZVlheXF1iYGVoaGtxcXR3cHJzdnZ2dHJ0dG1rcHRxdHNwdHRzcHZ0cXR0b3N0cGtu
bm1tb2tub29wcG9tZ2dmZ2dlZWZoZmJmbW1ub29wbmtpZmFbXV9iYGJbXltfYWRhXmJkX1tQTExL
TkxQUEtNS0pHRDs4NTc5Ozk3ODgzNTc8QUVKSkxJS0lGQkFBPj48ODU0NDo3Mzc0NTUyMTc1MzMy
MzU1NTU0MzQ3OTc1NTU0Ojs7Ojw+PDw1NDQ1Ojg5OzU4NzQ1OTU6Nzk6Pj48Pj08PTk0NDU0MzU1
Mzc6ODc7Ojc4PDo4Pjw7PD0+Pj0+PD48QD47OTc6OTs4OTk1OTc1Ojs5NDIyNz49PTw8PkJFQ0dH
REZKSUlHS1ZYTElHS05NTEpGOjU3NTk7PDU5ODg+PEA+Ozs+RkJDPDo8PkA7Oz4+PTw0NDo+QEFB
SkdGSkpKUE9QVFBUV09PUFJQU1VSVFZWV1VTVFRNS05HR0lKTE9HOjc1MTIyNTk+RUZHR0A3OTg4
ODQzMzQyMzI1NTQyMzQ3MjM1MjU0Mzc1MjM1NTU1Mzo4NTg0NDtAQT49OTg4NTQ0NTg3Nz09PURH
RUVAQEY9OTg0MzQ1NzU3Ojw7QT5BPj07OTo4NTMvMjQzNTU6Ojs+Pj5DREM+PkA+QT1BRENCQT5E
RkZBQUBBQkVDPkE8ODU1MzE1PEJDQ0RGTEpHSkZHR1BPSkpWXVtcV1JSVFlhV1NZWVdYYWJZWVlZ
WVleX11bWFZVV1BWVVlZWV5iaG55gXh6dGlrb2FVSktLU1BPUFRiZltZVlBST1NWWVtta2FnamZo
Zmhna2hnZ2FiYV5cWWBZW11iYlhMT11namhrcm9rcHFzd3Z0bW5ubWtramZmbVlUUlBMTEtQXWFZ
U1NUWVlZVldSTlJQT1BPU1xmbnZ6fXx9fX1/fX2Bf4GDg4B9fX2AeHl8fXp8fYGEhIJ9f4GGfXh4
eHpwaXBwd3N0d3J3eHFva2RqbnZ5fXd6d3yAgXl0b21mWVBQR0NDQEFJUlNQUk5QT1BMT1BNTEpH
Sk9OUElFRVBgZlZSUlRXWVxhZm5rbm5ucXJub21xcHF6c2VkYWtyc4WDgH+Ij4qKkY+NjIuIiIuL
ho2GfHqIln1pXm98dIpqV09NSURDQj41OktQZn1iVVZYXltgZGZkYmh9j4F/hIGCiYmKl4+RjIiI
i4aGkph9eouKiYmKgoOGhoJ6amJdW1lXVllbWVlgZnB4gYOLjISJhomKio+IhoyOj5GUkpaTpIZ4
eH17fH98dnRqYltdZXOCfXl6dG9zfZd6amBZXWJeXl9bZV5OUF9iZ3d9fXl4eHd8eX9/fYCAf4OD
goKEg4OGhIaGhoiFjoOMlJKWmp2YnaOwpayzpKmpsa+qqq2qpqqelIaCgHNtaGVcWVRPRzU4U1li
X2VycHJ6enuAgoiIi5OTkpaamJqbl5qXlo2EgH14fXdvdGpwhllMUlBSVVRUUlNXWVNQXoFkXWpx
ZmJoYmJndnp6gHx4fYaCfIN9g4h9e4SCjaGpo6GjoaSlpKilp6OdnJqfm5aarMrDu7y+v8C8v7rI
xbm8vs7DtaipsqOflYB3cm5qYlZHPj5JWF1fa21uaGJiYl5ZXlxdZG1kYmt7lZ+hrLaxsbe2t7i4
ube5s7Wwqa+zuLK1tba2tba2vNbZvqmqqqeSZ05bfIuCiYySko6KioiFiIV9gn95b2tudIajs7Kz
s7OyraqsuKejoaOenpaSmJqYlpSamJeWn5ugoaGhoZydpKCeqaqYnqmklZablJWcl5iThH10YmJl
ZmVZVVBUVldfUlJbboGNfXl3f4WGd2ZhZGWBlKOWhn98dnh2dnZzcHF0cm9pa3KCiIGIhoiGiIuM
lJOXmpqcn6WloaanpqSgpKWmrqiemJSRhnFUSUM9PkxteYOYlpOPk5GTm5yjsKGAa3uWmJeYl5aW
lpecm5ugn5+luLmztrOyrq+vsJuFe3FzfHdxdHJ2fYSKi3iWqpOJjZGan6Smqq2uraehn5qYmJ+l
mJKYloN5e3R9mqqvra6xuby1sba2sqyqqbOonZOLioaEgXl0cWpUU1RXWVlYVlJTU1BQT1JSVlVb
XWBnaneBf32BhoGEhYaPk5GGjIiGhoqLiIuY2+7loYKGlKCmrsKqm52tmIaDiIF9fXZrbnSahnyF
hYB8e3+Cg4CAg4yVk42Lj4+Pko+MiYyPmJSOhYyKi4uJfH12cW9xeXRzbm9ybnJ6hI+Pio2KhoR9
e3+BgHducG94eGtwbm1ubWtqZmJdYmJiYWRQPDc7QURKTE5QT1NWdoB/hYGCi5ebn56gnpqgoaGh
pKSkpoSPqZiIioyJioB6hXZnXltcZXiCf3h/gIaIiJeMiYmIi4yOi5SFeXBtfI6Nl56eoJ6jp6em
oaSmpKOdn5+Xg3FoYGJmZmGGhWRbVVddSTk6QURLT1hXXV9fYmFham1xamppaW9lYmJhXmBigWBT
T0JAOEJVVmJlfGJYW1lgZ3qwknJzdH18fIKGf319goWOlYuGhoKDjIiBgXt9fX14fYB2en2AfYKG
g4aIjY6FhoaIjI6Pi4yPNTo3NzQ0MjQ1ODU0MzQyMjc3NTc1MzU4NzI1MjQzNTU1NDQzNTg1ODc1
MzUzNTQ0NTU1NTQ3NTc1NTczNTU1NDU1MzU1NDc5NTg4NTE1NTQ3NDIyMjMwLzU6R0pHR0dFRUpQ
T1BMTlNdXV5iYGdqam5vb3Bydnp7eXh6dnJ3eXl0dnh2d3Z3dnBydHR4cnJycHR0cHR0c25ucXJw
a2trbm1vb2tmYmdnZmRlZ2tpZ2lubXBwb3B0cGtnYV9hXF1bWV5YWV9iZWRiYmFkaWBQS09VVFVQ
UFNSUElHQDw5Ojw+PTk6MzA0O0dLS1BQT1BQTUlHR0ZEQUE6Ozc5Nzs3MzU1MzU1NDg3ODQzNDc0
OTUzMTc5NTc7OT08PD06PkBAPj46ODc3MzUzPEZBQTk5OjU5PT1CQ0I+QURBPDA0NDg3NTU3NTg7
NzU1ODU0OD45PD5CQT48QD4+PT5APjs9Ozw6Ojk1NTs6PDk3ODc5ODU4Oz07Oz4+QUJGR0dERklH
R0tOUlVLR0lMSkpLR0ZDPj47OTw6Oz5AOkJCQT49PTs7PUZCR0NDQkRCPj1AREJHR0JCRkVDRUtH
TFBTV1lVV1lXVlNTU1dQUFJSWFtXVlRST1JQS1BUVVtZX15bVkU6NTlBR0pMT1JSU1BKQjkyMjEy
Nzk3NTk1NDg6OTc5NzU1MjQ0MzEzMTI4ODUyMzM1Nzo+RkVGSUpHRkE+Pj08OTU7QkVHR0dHS0tH
RkdBPkI4NzQ3PD0+Pj5BQT1DQD5AQT45PDczNDQ3OTs+PEBAQkJDQkVDQUJARUxLSk1QUlNNTUtM
TUNDRkVDQj07PTw0OUNJSkxNS0tQUEtJTUlMTVBXWV5gYmJiWVlZW1xZWFVYWWpxZF5hYmJiYGJh
YGBfXltZV1xgYV1hYmpta25wdHN0c3N9hXpXSkpMSk5TXGZgWFtbWVdYXVtZV1xhZWpqZWdnaGpr
ZmRlZWJlYmBdYl9dZGtlWFBTX2VrcG9ucXRxdHNvd3dzcGtra2hnZGloV05OTVBQTVBXW2BZWFlY
WVlZV1dTUFBNTVBSXGhwcXR5d3yAfXp3e316f318gH14eYB9fX+AhoCEhHuBf4GAgIaAdnh2cWtq
bXJycnFxdHZ0d3ZwZWlxcnR2c3h2en19eHRvZl5WUlBSR0VOSU5QTVBQU1BMUFNOT1JQTkxOTU1M
T0tMXFtVT1VVWVliZWRma3SBenR5gph6Zmdtcm9xa2llYm17gnl9gHyEhYqRoY2GjIqJhomGg4GA
fIGSfXR0l56KlpR5eVlFQUJCPjVCU1lWVllXWVheYGVnZGhmZG10gXx9gYSEiI2NjoqGhomMmJKN
mn90eH2JiIaEhIOBgHxvYWFkXlJUU1ZfbmRkcIiViZGGhImLkY6Mg4WIj5GPlJqYkoqCgnt8fX97
eHx6fXRgW15vf31/hH97dHh7i31uZmVkYmRkZGJhXmBpcnB8fXx/f3l0dnyBf3p9goF9fH+DhIOE
gYSGhoOJgn+BfIGYl5ienJygoamlpqmsp6itra22tayqsKSUgoOIfXNvbWJdWFVTSkllYmRqbYN9
c3d6gIGEiZGTko+XnpialJacnJaPiYR7eneGemdnXlliUktQVVdZW1xZWVxZWVBXX19ka4twZWZm
eHp0jYWAnIZ9gYKFhISGiYB8fYKOoaqkpqilo6OhoJ6hpqebm5aVl5+5wry8v8LBvMHAwsK/wbu+
4M6vqqqkoZqPgXRzaWJZTkxHPkNNW2FlZHJhXF5iYmBla2Jlc3BvcIaeqqett7e/vLu8wL6+s6+u
rbOxtcy2rbOzurm8u7a3v76zs66nrJNpUE5ogYOEhZWOhoWIhoGDgYGBg4BqWWRvhaS1sbCqsaWp
rKmhpaOdnJGChouRi5WUlamYkZecnKCgnJuXmJibpJ6cpJuamKGhoZiYnJ2coKOPf3Rla3dvamhm
YV5bZGZZTVZogYR7d4SFg4aCcmdlXmiBtZqBfXuEioF2c4Zva3Bva2dpdp6GfYCChIWNio+Plpia
n56gqK+mpqOloaChpqWlo6GYjYuDeVU9PT5BTW17hpeTkZGOlZaYlp+sqHRofZSRj5OSlZiamJeX
l5ifo6m3tbO4uri4tq6ljX1yb3RxdHBwc3qDhoyDgZOck46Rlpibp62ur62qrKGenZ2dnZ2XmJiY
inh5eX+LoK2tsLWws7avs7y4uaqlpqGdko6PlZeDenFwXVBOWFtbWVlXUE9OTktHUFJTVFlfYl9o
dHxxbW12hISAg4iJhYGAf4Z9fYF5goSd2u2aeoaPl5ujvsCgnZ2Xj46GiYiBe3l5fIqKfXh9eHRy
eX13eXRzeYOGioaGjpiLhIqNio6PkYuKjY+OiY2Kg3RzcHR7eXF0c3Rydn2PnJiSi4uCgX9/e3l4
c3Bve3l4b21pa2tpampqZWRiYGFkYE9JTVhoWFRiWFZXV1trd3t9hYiTo6mhnqCloJ+kpqSlpKSl
mqm1sKqnoKGbioKCcmJZV1JffHx2d319gIWPjIyJhYaDhomFjH10a2dmeIiUmJ6gn5ygnKGmo6Sj
oJadnpZ8bmpwa2prYmlmYFxZVlZAOkVAQEdPWVtbYGVoaG9xa2pqaGpmaWRhYGBeYmZqa2hdTT04
QmpgW2iFZ2Bpa2VkaoiAeHZ5eoOFhIKDgIGEhZOWiIiNj4uGhoiFgXhyd3SBjn16gH+AhYuGj4+N
ko6SkY6Uj4yRlJ01NTc5ODg5NDMyNzc1ODc3NDI1MzE1NTc1NTg1MjU1NDAwMjUxMTM0NDI0NDQ0
Mjc0NTUyNDU1MzU4MzIxMjU1NzQzNTU1MjI3NTcyNDg3NTc0MjAyNDQ1NUJMT0xLRUdLS0pHSkpH
T1ZbYWRrZmlua25zdHZ0enl5fYKBfX97eXt6fXt6en2AfHl4c3R5dnZ0cnRycXF0dHBycnFud3Rq
bmpwbWtqZmJgZmtrb2toaWpzbWpycnR3dG5rZGFhXVxZXFVQXWJlaWRkYmh0c1RPUlBQUlVVUFBO
T1BLPjg3Nzk6NTM1NzhCR0tQTE9QUFBOTlBbVkdBQ0Q9Ojc5NTU5PEA3MzQzNDU1NTU5OTEzNTUz
NTQxMzU6PTxAQkI+QEQ+QEJBPDc1Nz0+RERDREI+PDg7PkFDQEBAQkM8ODQyNDUzNDg4NzU3ODU1
RDw3OTw6PkBAPjs7Ozs5QD47Ojc8OTk6PDk3OTc7OTw1NDU5OTw4R0E7QEJCQ0RGQ0lFR0dGSlBT
TElLT09PTU1GR0tKPjU0OD1BQENFQ0RCQ0BDQURDRUZFR0lGR0dDREdHQkFBQkFCSUdNUlRVUlZZ
XVlZW1lhYl1XWFtZVFNWV1dXVlJQUE9XWFtcYGJkYl1YVlJOR0dKU1ZUVVZWTE5LQDc1NDU1Nzc0
Mzc+QkdJPTU0Mzc1NzMxNDI1NzMzMjIzMjU7PkJHSklHR0lGR0ZBPTtDQkNHSUdLS0xMTEtQV09Q
VE1CPDk7R0c+PkBEPj49PkJFR0dGRUNJRD0+Oz1BQT5BRUdGREFDRkdHR1BTVFVYXFhcaHCGdE1E
QkRHR0dHRkJFTFJPVFdTVVhQVVJUVVRUWV1iYmRoZF9lYF9iYmFfXVlZZGdmZGRiZWdnaGdmYmZi
YF5eYGFiYmptdHRyd3Z3d3d5cnmGlHlXSUdKUGCNi2dhXVleX15fXVxdYGhqZmtta25raW9qZ2tp
aGRlZmJfWWRraGJQSlViaW1wbnFydHp4enpxdHlzbmtva2ZlZm5ZT05OU11xWVRXX19YU1hXWVlX
VVRTVFZTT09ZZW5yc3p6e398f3+BfXyEjoqDe3d8f316fIOEgICEhImDg4WGhX18fHRram9xcnRx
dnl3eX1/eHBvdHd6fHZ0dHZ5dm5zc2thXVtTVWVbT1dYWVdXV1NWVFdSUFBUUlBQUFBSUFNZWVhg
a1dPU1ZdWWJwZ3R3eYB9eHh9ioV2dG9rbW1rbmtneHl6d3uDhIOGjIiKiYmLio6GiISBgH98eX13
eol7eoKupXiAaFBBPUA3MTxKV1xpX1tlaWhlYmBiZmJgYWh9hnp9gIGFi5aalo2Li46OkZh9cnJ0
hIqCgIaFgoWBe3JiW2BYVFZVVVtnZ2qFhX2Ci4uOj42MioqLiY2Rk5KUmJeShoaGhImBfXp6e3t6
fHtncn19gIKGf3x9fX2cgHBoZmhtbXiGj4VwcHN3eXR6gHl5enh9f32Bg4B9fX98fYKAgoaChYmJ
hIaGfHhxcoOamJubmKCho6a6p6Cqsqyqs7KzsrOqoZaEhIl/d3BrbmJZWVhZXGdkamttdHh4en+B
gYqNj5OVkZWUl5iXl5iWjIuEf3d2d3BcVFBMSkdGTVBQVVBZZ1xWVllZWV1gXm1/a2ViYWJrcHyJ
iYOFg4aIf3yAgqCNeXp9hY6oraywrqWoqaGmqKWkoZqanpqhscXHxMDCwr+8v7zBw8C/vsDOuLCv
rKWlppR/eHRlWU1KTEI+Q0lTW19gXV5ZXWJia25ucHJxc3R0haG4sKqssrm8vrm+w8XDsrOxrrCz
qq+5uru2trm8uLm7wLy4s66ulYB5b3p6fYKBhYaKjYyOioKBhoV9f3xkZYKvsa+vsLCxsq+qqqqk
m5aKf39/iImPlJKYpZyanZ2foKqemJeXmpyhn5+craGYoa6jmKCmoaClqp6Lf3Bzcm9tcWtoZWJk
aW1pV1l0eHmAhX+FgX99Z1hUZXN0dHSEhn+wvJhuem1kZ2drZmZxg3x9fX99iJSJhIyWlJuknp2h
oaWho6alp62qp56gnZuTkYRtS0A9PkRUcH2GlpKRjIyPlp2co6eafXiWm5GPk5iXm5uTkpydnJ2s
t7KusLOysrCvuJZ7cWpucHhvc3N0e4CGhn2Kk5SRjZKYoKWqqKq3u7Oqn52co6OhoKCbk5SNfHd4
fIijsK+ur7e4rbO2r7ayp6Ghn56Yl5GMhoR/cmVVU1RZWFhWUFJWU05LTU5QVFhcXltdYl9na2lp
bW12f32AgoF/hIN4f319gIWNj5vt+6pmZneEjKGupZugn5+ajIyMlYyDgoaKoKGJfW5lYGFlaWFd
Xl9fYnKFhYWPjomIhYiIho+PiYuOjI+Pk4h/eHt0dHp6d3B9end0fZWdlpWOioaGf318fXp3bmhx
bm1oamlra2llZGZiYl9bX1lYVFVdX2hdWHRiVFJXW2t0eYSMmqmup6GnqqenqqynpKSjqamtsLmw
r7KqoaOblo9xWUdGSlNpdHt9e4GLhY2NjYuJiISFgYJ9c21oZmdzj5ien6GeoKCho5+foaaknZqe
k4Z0dHRmYWZiamJeW11eTz06QUJFR01QXmt/dHF2mKV8ZWJiZmRkZWZiYWJhZnF6aGRZQDU1VV5g
a2tmZWJzeGRia3R0dnl8gYaGhoGDiYaTmJGMjIiKio2PkoyAfH+GeniWhnp6e4CDi4majI2OiIiP
j5WekZGYnzc1NTU1ODUyMjU3NTMyNTU1MS8vMjQ0NTc4NDI0MzU4NzU3NTg3NTEzNDU0Ojc0NTU3
NTg5NTEyMDEzMTI1NTU3NTU1MzQ1NTU0MjU1Nzc1NTg1NTIyMzhCSk5OTUxHS0dLTVBPTE1PU11h
YmFmamtxdnZ4fX2BhYB/gYJ/gYCCfX+DgoKBhYSAfXx9eHR0dHR5eHl0dHBwcnJycXN0dHRua21u
b2tpaGlrbmdka2lkamtvcnBxcG1wbm5qZWBbXFlXUFVgZWhoZWZraGhoVU1VVVdWU1VVWVlUUlZQ
Rjs6OTw8NTIzOkdPV1NQTkxOUE1QUk5PTEdHRUdNQTU0Nzk9Pj07NTc1ODg1OTc0OTQ1ODIzNDU4
OT1APT4+QUFCRkZDQkVCOjU6QUZFSklDQkQ+NTg+Qj48Q0NERUA1NTQ1NzU4PDo4MzQ1NTc5Mjo+
Nz1CQj48Pj5CQj09Pj08ODk7Ozk7OjtCPTxEVko9MzQ3Pjo6PT1ARkRDRkdKRkdLSUlQWVBMUk9M
UEtKTExNTk1OPjo5PkZHSUdERUZHRkdHSklNTEtNTEpHSkpGSUdHREA+Q0VKTU1UWVZbV1tXX2Fg
XmJkYl9hX11XVlZYV1lZUFNQUFVbYmFiYmJnZGJiYmFeV1BUWV1ZWVlZVFBJQDQ5QEFCQT47PkRH
SU1HPjg5MzMzNDc3NDQ1NTQyNDc5QEJFSUdHR0xQTU1MSUdFQ0JGTE1OUE1QUE1LTlRfVlBQVlA+
OjxDR0I9PURBPkNDREJDR0ZNSklGQ0ZLRkA+PEBESkxLT15kUFBVV1tiXlxZWV9kbX2FYklDREZH
RkVFSUxOUlVSWFZWWVlVT09PUFVfYmJma2plZWdiZm5rcmZlX2ZubWdra21pbm1ubW9nZ2lhW1ll
Z2hqbXR0dHd6dnR3d3h5eoSIgmRUS0pPYoR2YmBiYmRkYmJiZ2JmaWtoaWprb3Fxa25ramtqZmli
Yl1hamtraVtNTlxocXRyc3h7dHl6eXd5c3BwcW5vam1vZFlQVl5YXH1yW19eZFlWWVlYWVlZWVdY
VExPVFthbnFwb3R9fYKCe3x7fYJ/enRxep+Vd3eBfH+CgISIioaDio+KiYN7dGhnb3l2dnl8eXl6
e3d4eWtrdHR7fXh6dHFvcWliYF9WUE1OVVNMR0tNT1RWUlVYWVlVU1RVVFRTUFBPU1xgYGFgXVZH
TFBMUFZrdnZ8fH17g4Z7eXt4cGtqbnJycGltenp7gH2EhIiLhouKiYqIhoWBhn99enZ4dm5yenl0
eoN9dHRtW0dAPTUzO0lZYmJcWV5hYGBgYWRkcWhiYmJtfYJ9goKGhpGvsJKTioaKj3pyenx9e399
eoGCgoJ6a2JiXkxNUlNWVVhcZ3J0fH2amImKj4uMiYmLjoyTl5iVkoyRjIOVj4x/fYB9f4F5em96
fHuUiYt/e4SDf4Fzf4NyaG90eJjRsXhudnl6e3l7eXl7d3Z8fX1/fX19f319en+Af4B/goOCiYZ2
bmVVaYiWlJebm6GhpaiorKqwsq6ysbKxta6llomNi4aFenFzaVlZXmJlYWVqcnJ3d3t/goGFho2V
lo6SlpiVlp+YmJOPjH18d3FqWVBMR0JEREVHTldXWV1eXmBgYl5kZWRrcHBpa2RiYGl5i4iGjIqJ
iI2FhX2BkYuEfH+Gna6qrMW2pqaloaWprKacm5uYmqrEy8XCwsDBxcS/xcTAvsLCvLq7ta6qrKaj
kYZ6aFxUTEZFPj09QktXXF1ZWFtlamuEfW90dnJwd3mLnaOts7W4u7zAwbq6vMO7s7O4sbCvt7m/
yrm5t7q2s7e6u7O1rKiXqu3+9opgbXqFhoiJipidhn1/fXp8fGuB3Pa+o6WurrOwqq2no62kk3pz
d3uBio6Mj4+RmJyaoJ2anZ+clpaYpKSco6ekn56tuaijo6Ghpqespo+Af4SBgnt5c29ubmlwdG9b
XXB8gH+AfY6bhn1mV1t5hoF3dH12crr18aBYVGBma2diYm1ydHx9fICAgoCJjI2RlJiYnqClpK6m
paepp6ehqaOem5ORgFxDPTw+QlBwfIGGjI6Ojo+XnZybobC7iZaTio6UkpGYm5WWkpigpLC6uLW1
ury1s7KyjXhpa2lqb2trdnyDio2KhouSlZGTlpufnqWusbWzsKqjoZ+joZuaoKGhmpF8eHd9hp2v
qqqxubWusrGurKWmp6Sjp7+qkoyKgXp0Yk5OUFZbWVhZV1dYVlBNS1JXVFlgYmJfX2VrbnNyfYKA
f3t6e4F6eHaGjJuXjpSYpuz3nVxXZYGdrKGaoaijoZ2Rko2Tj46OjIuVk4+LeW5gWVhXU09QVFRg
cn+Eg4aDhIaJjIqGl5OJi5GPjYiJiIGBdHl/enR4eHp4enp/lZiOk4+IiISCfXuAfXxza2hxcG5t
aWpqa2doYmhiamleWVJTW2BlYVtiZl1iZ1VccXZ6hqq5qKWopqapraqqsK6sqaekqK2qraqtrqek
oJ2Rj4phRkVNUFtujYV6fYiCgYKGjIqIgIKDfXJnZWFiZ3qPl52hoKChpqShoKGjoZ2gnpSOiHxz
cmhfaW52cmViZGVcUEE5QEJOVF1laYN6doGXx8JrWFlhZWZiYGdiZGhrbW9wcmJDNzhFWWJuYmJh
ZnR2bW5tfHtyd3p9goGGiI2Li4+MiIqTkZSPjY+OjYJ6fIR5d398fX9/gIOFiouDjY+MjIyMlZ2V
mKGqMzUyMjEzNTg4NTM1NTQ3NzU3MzQ1NzU4MzM1NTQyNDUzNTUwMTIzMzMzNzU1ODU3NzM3ODk1
LzQ1MjI0NTQ0MjM4Nzo4OTM0NzQ3NTIyNDU3NDI0NTQ6Nz5HTlBQT09MTE5QTUpHR0lLV2JkZWtt
bXFxcnd9fHyEg4KGhISGhYaEhYaMjYyJiIaJjImDfHh2dnhycnRzc29ub3JxdHNwdHdxbmpubWtq
bm9uaWdiYGJoa213eXRxcnRzcnBxb2lkX1lVT1lkZWVkZGZra3BdVFRXXFlTVlZVWVtYVE1KRDo4
Ojk4Oj5ZT01QU1JZVVZYV1JQUE5NVE1JS1BNRz47QkFGREA7Ojk0NTcxNTUyNTU0MjI1NTs+QkpA
PkFAQEBEREFDQUE+OD5CQkVHSklJQjo8PUBCQ0VDQUNFQTgzNDg6OT1APUBHNzM1Ozs7OTs9Ozw9
QEFCPjxBPT4+QD44Nzs6Oz06Oz48PkNWTzo4ODc1NTc7RURGRUdJR0lHSklGSlJmVk5LSkxMT05P
TkxMR0NAPkNGQkRGSktMR0lGR0dLS0dMTklLUFBQS0dHSUxGQD5CRUxOVFNSWVZbXVleYWFlYmFp
ZGRlXllbWVlcW1tUT1BZXmJkZ2hoaWZiYGRkYmJbWVxcX1xbWFZWVk9JQUNBREpJR0dGTExLTlBQ
R0dHOTU0NTg5Ozk5NzQ0O0dCREpLS01NTU1NS0dHSkdFRkNETFJMS09PTkxNTklHTU5MUEdSU0xD
PUBAQT49REZHS1BSVVVSVVdQTU5KRkJHSUpPVFVbb3dkUlRYXWRpXl5cYGpqaGtoWElHSUdFSU9S
UFRdWV5fWFlZW15XUE9OU2BiZGZqa25nZmVrfXRrZW5qb3hxbWtva2lvcm9xcW9wcW5pYWdtbnJ2
eHp8e3x4eHp9gX2AhoaGc1lLR09dbXNpYmZkYmJra2ZlXV9la29tam1ra3FwdnR5cGhlZGJfYF5r
b2tfVU1QXGlza3F0eXd3fH17enlxeXZycXRwbWZZVFRXZl1YV2VcWVRZYl1bX1lZWVhYV1RQTFBY
YGJmbnh3cXR5e3Z4fXR7eXJrZWFlhp2GenqAgXx7goiEe4yuybaniXhoXm50dHh3e314e3t/fYl9
cmt3fXl2d3d3dG9uaGRgWVRQTVBWUE9OS0pQUFJQVFdYVVRTV1ZWU1NVV1ZcWV1fXllcZFZHUElL
WXB5fYN5eX15eX19eX19dHRvcXh0dHZ3dnh9gYSGi4uGhIiIhoKCg4WCfX18dnRzd399gX97goJ9
eHZlUkU8NSw6Ul9ZW1tbZmtiXVxeXmZkYWJlaHF9hIKDhoiGipOqmImEhnRrbXCAgH1/gX2Bend8
eW9iZmVYT1BXVVZYXGFuiHx5eoaJlpuKhYmNjo6Oj5SYmJWOj4+LhoaGhoKBfYGBgnp3e4KAe4SG
gH+AgXt7dHKco4JydHZ5gZqPd3N9fXl4eXd6enh5enqFfYB/fX17e32AfX2BgYOCg4KCgYRvVUp6
j5SXn6GhoZyhoamwwK+psLWzsbW6pqGPjJiPkoh5cmtiYmdhYGJoa2hwenl8fX2AgYWFgYSRjY+W
mJWTl5eWloyDg3lrYlVNR0ZER1VKR0lETllgXWFiZHdtYm1ra2lnZ2VmZmhrcnONjJSmi4aPi42G
ioyFjZd/eYOuya+prq2vpqqqp6iopJqWmJyjtcvMysO8wMTBwr7Cwb+8uLOztba2r66qo5yPgXhi
WEpHSUE+Ojg+QkZQWVxkZmlpbnuBeXRzdnR0eoOarLO6t7m7vr+/wLy7ubq3s7Gws7Kxt7y2uMK7
sLO5ury7uKypoaHb/v78lVhidoKFhoaPmI+GgoB/f4V9boLT/uCloKyzsKqqqaedpKCObWdub3mP
j42NjJSYnZydnpyboJ6Yl5ufn5qdnJ6go6qys62qqqmtrKamm4qKjIuKioR7dHRzcXZxb2lZaXx8
fXt7hoaBgHRqcZeqnIN6i3Rui8jsoFJPWWJge2Jia2lrb3F2gH2AgYOGi5SVmqyamJyhnaGkoaSm
pqyqpaCaj4aIX0I7Oj4+TGl0fY+Tk5OWj5aVm56gtap8jKORi4qRlZabmJSVl56qt7i6u7y4tbG4
urCWeXFzdGloZ2tygYaIhouMi5OPkZaWmp+hpqevs7CsrK6dl5yfoJ6bo6OeloF6dnyEnrGuqrfF
sqmsrKWhoaWjpaijs7OaioaAeWtZTkxSWFlXVllSU1VVUEtTVVBXXF9kZWFna3R9hIaEhYaCfYWK
bnR2epGeoZ+foaHS7rZ9a15fco+Yoa2vqrGpl4+Sjo6cno6Kj5iYk4+Ee2hlVEtMT1BSVmJzfYSF
hIaChoyGhYmPioiLjo6NiIiLgXR3f4B4dHh8fXZ5fH2Im5iPhoSEgn2BfH94c25maWhkZ2ZiZGRo
Z2hkYWZxa1dQTlJdYmdiYGJiXl1iWF1tc3mCl6WprqqorayqrbO4sLCzrqqmqqiwsK+vrKGhoJaM
jW5QRUZJUGCEiXx0d4WEhIWLiIB/fX1zaGZraXSGi5eWmp6fp6SeoaSfnaGhn6GhoJGTgnp4dG5v
dnFwb25raWdcST01RVNfZ3J2fXh3fH2cuYRfXWBiZmJfYmBiYmp5iJuGZ0AvNVBbYGBdX2Jna2pr
cm5we3R0dH2BfYGKlpqJjI2XlJGRj4+RkYyMjHx0dHR2eX1/fX+AfYKJjZGKpbafjYmOmKGkoaEx
NTUwNTU0NTczMzc3NTMzMzU1NTU1NzUyMTUzMjQzNTUzNTMyMzQ1MjU1OTU0NTc3NDI4NTQzMzQ1
NzU3NTU1NTU1MzU4NTIxMzUyODU3NTU1MTQ1NTg7O0VKT1BQUExHSk5NT09OTFNeYGZna29ycHZ0
eH19f4OAf4GBhoaFg4uLiYqIjI6LiYmGg4OAf3h0endxb3FucHBxb3JycnR0dHJxcXFvaGtpaGhq
ZGJhV19la29ycnBycXB0c3R0bW9qZmtqZmJmaWZlZGt0i2pZVFtXWVtXVlheYltVWVNFSkw5MjQz
QVVUTlBTWFJUVlVZV09OT1VZUFBOT1NQRUNEREdHR0dQQDk4NzU3NzM0NTQ0NTk6PD08QkdEREZD
QT5CREFCRklCQUVLTUxKS0dCS0A8R01FRktHREQ9NTM1Q0VER0VFQ0A7NU5JQT09QU9CPj5AQT5A
QkA9PkA9Pj4+PTw4ODw+Q0FGRkdPSTw3NTs5OjxDPj0+PkJHSkxLS0dMUE9JTk9OVVNTT0tOTUtM
Qjk9V1lGR0lKT0pMTlJSTVBMTklMU1BQTU9QUE9LS0dER0ZKTFBWW1hZXV9fX2FkZmZmaGVlZWRl
ZFxdYGJdXFhZWWFiYmVqa2tua2toaGpmZmJiX1lgYF9YW1lZVFBLSklHR01OUFBLT1BQU05NREZA
OTUzMTM1NTgzNDg+TU1MSkpOTk5PUlBLTk5NS0VJSUpHSUtMTU9OT01LTVBOTE9MS1JJQUA9PkJA
PkJETlJZXFxbXVxeXFlXVE9JRk5eWVxiYmJncnxhWV1faHRwaGlqa2Zud2RYT0pKSkpKVFlbV1hh
XltcW15fXFdVUlBTWV5ia3FvcmtpaG5yd2pod3Z9cGppbXFyc3RxcnBwcHNuamloa3JzdnN3fX2A
fH17e3x6gYKDhXd0YFBHT1lobWpobm9va31xZWdhYmpoampqamtra3eUfXRqYmZmYmJiZXRzbmhZ
Tk5TX296dHR4dnt8eHR0c3Fxc3p6cnSKjGBPUFNWWVZYTlJeYWBgYF9eXWBgVlhZWU5NVVlhaWZu
cHR2ent0dHN3e3dyZmViYmRndn98eYGCfYKGgW9riMjr5cWNcllQYW93fXt/f3p9gn+ChHtybnJ4
e3l4c3JycGlkYl9cU0tJTUxPTVBOTlBTUFRWWV1ZWV1YVFVTVllfWV5lZlxfXlhdYVBDR1VmdHx5
dnR2e319eXp/gYaKgoCCgn99fXtwdHN7gX+FhYaGf4GGg4GCf319eXd3dHh2fHx9f396gYZ/c3th
Rz05MzhQUlVYXV5nZ1xdYF9hZGBfYF1eZm1yfY2GgImPhoKDe2tiYWVveHp4fHt0dHh7enx4a2Rg
Z1NKSUdKUFBWZ3Z6eHyAio6Sp5SMjY+Pjo6SlZGWm5GLj5iShZOEfX19f316d3JwcnZ4fYJ9end3
eXR3eoiFd3R6eXx4fX2CgX99fXyDenR6fHZ6eXNxeHeBhX15en+AfXyDgX+Bf4F/clhMR2eGkpiT
mqCup52hpKimprCur7a6uK+ej42Nj4+MiIR5al9hZmdmZWJka3SOeHR0d3t/fYB8fZiajouJi4+S
kZGPiYJ6cWlZVUdEQkVMTkdDQ0pSW11lYmtyfW9paXlxaGZmaGViX2Z0eYaPlJiLjpKNlY6SiYGE
goCBgI6lqqaqrbGoqKqtqqWjn5iXp6G31NHDwMLJw77Bwby6u7q4v7i2srOwqKahmIx0YlxQR0VH
RD49Pjs6QEdZamtnaW1vc3t4dHF4enR7hJiqs8PFwrvBv8C/vruzs6+zs7izube1t7m1u7e6s7Cz
t7qzqqealbv2/uBkUGt7fYKFhYaIkY+Gin17fYF0cqT75Kejqq+urK2spqihnH1mZ2FkeJyPiY2O
k5Wan6Gho6ejm5ign56fnZ+YmJyhtriwsrWzs66tqK2pj4WGipGGgX10b3BvaG1tbWBQXG50enp7
e32EhoSLjpaSgoWJhntviZaSZktKS0pXUF1ramtrb3aCeXZ7f32CiYmOmJOYmpiaoaWhoaCmoaCd
mpqPkYZZQjw4Oz5JX3eAiI+OlpOVlpicoaGnmoSSk4aOj4+RlZednqCmqrK6u7W5vLq4t7W2s6qb
jIN8aGJrdHSAjI+MjIuNko+Rk5qYoaasqrGysravqqGeoKCgoZ6koaSdgHR0dn2dta+orbeqqKin
qqqqpqGtpaGjrqiPjYh5bldOR0dZV1hZUlBQVFBUUE1SWVtfamZhYmZyhYaGjIuMmoZ9f3FiboKV
n6Ghpp+oqMDErIZ9dmJmfZSszdfOr56gm5iSjZqbkZSRkZSUl42Ac2dcVU9LR0pZcHt/jJGEgoSG
hIaIhIWJiYyRi42Ni5OBcnd4fH16enl4eHR0eoKUlI2FhoSEgoiFgHh0bWlraWJiYmRiYmVqZ2Jk
aGtfUk5VXWRlZGRnaGJiV1dWWIaAeX2Opq2tr62srrCxs7uvrrCnqrKzrbCqr7OvqqWkmo+Id1lD
QEZQXnOJg3+BhYiGhYaCgYR/eXRpcXSFlpidnZyjp6qkpaqpqKGjoaGfoaazpbORgoGFd25zdHRu
a259b2RXSUxuZmJqcnd4e3h7e3uGfWhgYVlfZmJlZWtmZ3d/eHp3RjM9V3RkXFxgYmRkYmZua259
d3BzeoCBg4aPj4qOmJeUlJSSkZOVj4iJgW9td3h4eYCGgoKDi4qMjpXS/c6hkZibmp2gozAzNzg1
ODU0NTc1MzU1OTUxNDIwNDQ1NTU1OTU3Nzc3NDI1NDI1NTQzMzU3MzAwNTQ1NzQ4NTQzNTU4NzM1
NDM5Ojg7PDk1NDM4NTc5NDAzNTQ1MzQ3NDc+RUVGT1RQTU1PT1JQU1JUWVtiZGhra3Bxdnl8e319
fYWGgISKioaIhoqPjY2Nj4+UlI6GhoR9fHd7d3dzdHJzcG90eHRzcXJzcW9ya21qZmdoYmFiX11d
Xl9caXBvb3F2d3R3dHR0dnl2dHl5dnBlYFtbaYaTbVxXV1dYW1tYWV9kYF1ZUE1GOjQ1NTM+SlBQ
UFZWV1dZWVRQUFNSUFBQUFNVU1tMQUBCR0lDRkE8Ozs1NTMxLjI1Mzc1M0FCOzpBR0U+PkBCQEVH
R0dESlZMTEtQTk1LR0lPQEFFRkdLU09OUD07Q0dHRUdGSUlLT05SVFlUVlhZVVBGR0NCPj5GRkRE
Pj09Ozs+Ojk5PEBDQEJDSUM+QkQ3MzQ5Pj49QERCQUVKSkpNTFlZUFBUVE9TUFBQUFBQTkdCNTRA
T01LTlNQTU9QUE5QT09KSk9QVVBUU1BOTktHR0RFSkxPU1NZWVxfYGRkaGZqbWpqa3BramdhYWRi
Yl1YVlhcYmVpbmlwcHF0cHBwamtrZ2lkX19hYl1ZW1hWVE9PT05OUFBWVVVSTlJSTU9KR0RBPjc1
NTI0NDk8QEJCRklKTk1MUFNOS01PT01NTElGSklMTVBTUFBQTlJSTk9MSkdJRUNAPT5DQDxAR1dh
YGJma21oa21iYWJfV01LUGZkXWJkam1wgXBiYmhzfHJraGppaWlpamJcXFRSVVZXW15eXV9iYmFi
YWJgXlhQU1JYa3Nyc3JuaWpvendyZGWAfHZ2dHNyb3J3d3R6d3pxc29ra2lrdHh/fXx9gYODg4OB
hIaFg4aBd3ZrW05QVm9za2loa21xb25pZWRoaGhlbm5rcXBtdHtxcWtubWllcWltf3Zual1OTExd
a3F0d3Z5e3l5fX96cnFzg397en2GaGBYVVJXZHBnYF5cXWFiXFxbXWBbWFlfWVNcbXFwcHFxb3R9
fXR0f3ZxdHNrbWlwfGpud32Ig3R0dG1nZGlzsvL+65dkSkVYaXp9gYSCfYF/f319gHZ0fH19d3Rz
c3NtZWJgXFVTTktMTk5QUFBSVVdYW1ZcWVldXVlWVFZdXFteXGRqYl5eYmJgWFBSX2tzdH19fXx8
en19hIucj4WGi5GJhoSAgXp5eXuAgoqMioh9gIaBgIOBf397d3h0eX2DhYSCgnt9gnl9nWpANS4o
LD1TWFZZYV9fXl5hZGRcXV1fX11naGtvfHh7hYiJhI1zVVNbZ218fXd2eHl9eHNzc3RlX2JcSkZQ
SklLUlyGlIR3en+GnZWdmJOOioyKio2NlpGPhoaOmIqMhoV9e3l4enRrbW90dHh7fH13dnyCdnN7
fHp4fXuBgIB6fX17fX17e3l6e3p0dHRxb3Fwc3iCgYF9fHh3e3t8fIN/gYBrU42Kan2OkpibnaWa
mqCgqLCgsLylqKqvppSTj46Oko2Pk3hkYF9nbWhmam9zdHd2e3p9gIWDg4mAf4WPk46Kj5eWkoyA
e3RtYlJHQ0NGR0dQTUZJTVJZX2JpcW1rb3BtcH2BbmdkZGVhYnR2fIiPjYqGiY+KhoaCf3p9gIB/
hJSxrainra+trKepqLKck5idpsXFxcfTw8XHwL+8uLu4uru2s7azs7CwoZiWjYBrYFBHR0VBQkFC
Ojg5QlZrcW5vbW53dHR0fYyPgH+IlKmzu7zBwry8xcPEvrKzs7q3tq6zw8Kys7e6s7K3u7e7uLCw
qI+Cc2JhYVVod3iCiYaJi4mMjIKNhn+ElI17o+vZqqGosbOtqaioo5yNdF9hZm2DlI6TjZGYl5qh
oaqmoKWon6GhoKCdoKChpqW5t7OurrWzrq2wsbKRjJWUkYaFgXt6d3J3dHB5a15GXW12eXl9iIqO
jpGNjI+JgX2Di3dkYWpgWU5NQkFHVmVra2tvd4V0dnmCgZKKhIaGjpSamJygs6Cdo6GgoZ+dsJ2O
eWRHPj04O01gc3qDi46PlZugnaCfoaCfjJGMiYiGj4+Rm6mqp6iws7a4u7y8v8G8uLq+u7ejlYFr
X3h7fZGMiIyJiYySkZSal6GnqrCzs6+ywrGnpKOemKSgmKCfn5d9d3Z2f5Gqs6+wsrKopq2qp6yx
uqykm5ygmIyTinlrVkxHUFRZVVhXU1JQT0tNU1VTWFtoZGBma3qBhYiLioSJhoJ7X1lnjpiepaCl
p6mgmKOakYuMfGZ9p9bb3cmysK+qp6WSmKSUlJiWmJahk4qAcmldUEpKU2p9gIaJi4+DgYOFiZGK
iYaKjI2SjIWGhXx/gYKDhXt5en2GenRyb32GgYSJjIiGj4V3dHRvc39zZWRlZGRmZ3JxaGJdWFJQ
VmVnZGFhYGZnZ2JYVlhYdHt6gZe/ubCvsLK1trOztbCws7Kts7OsqrOxrq+yrKSfk4qCbktAR09o
d3uJjomKhoGEgnx5dn17en+SlJSgoKGhoaWorqeko66zrKasramprbChoZSKfYBzdG92eYB2a3p2
amZxd2ZeZGhqcHh5fH99fH99dGlkXVxfYGJgYmhrcnBncm9FNThQa2VfYGJkZ2lramtoaXd9eHp8
eX2Fio2Kj5OTlZWWm5OSko6JiIh0b3N9e3l5goWGhoqRnZ6dpL/s58ykk5OWoKGhMjI4MjU0NDI1
NTM1NTU1NDc3NzU0NDU4NTQzMzUzNTg3NTE0NTU0NDMyNzg3NTMzMzU0NDc3NTM3NTM1NDU0PkdN
TktNTEI8QUFBPTs8OTMzNTIzNDM0PEJJTkxMTlBMTUxQV1hYWFZWW2RrcHJ0dHF0c3d5gIGAgoSA
gIWGio+Oj46RlJOSkpKPi4uMiYV8eXx3c3NzcHFyc3RzcXRwcm9xcm9oa3JrZ2dkZWFfXVldX2Jo
a2trc3Z9eHl/fXx8dHd9goR/fHdrYmBda3FiXFlZWFtbXltcWV5eYWBbWFBHOTo8OUxiVlJQWFVc
XltXVFZVU1BQU1VTU1BVU0xJRkdHRUZHTVVDOzo5NTArNC8uNTo7ODxEQEJDQ0JCRUJGREdJR0lM
YmtZWVdPTElHRElHRUdMTEpOS0Y9PkZMSkxFR0xKTlBWW19dXmBhXl5eXlZKSUlEREdKTVJBPTs3
Ozk8PUBAPkJHRUNHRkI+Qjs1ODQ3QTw8Pk9QTUtMTk9JUFdQVE5NUFNUUEpQUE1NST41NDpCS01N
Tk1QUFBUVFBNT0xNVFBQVVRYVlBJR01HRUdGT1JVV1xdWV1gYmFiZnJraWprZmRiZWRnYmFfX1tZ
XWJnbW1xcW1xcXBvcnR4c25raWZkYmJhYmBfXVlVUFBLUFJNUFRPTU1MUFRVUkpGRkRCQTo8Ojg1
OD0+QUdLSU1QTE9PUlRTUExPUE1KTktKSk5XWYCKXk5QUFBTU0tJSk1HPj5CQkFERUlVZWdlamlp
cHFycGtuZmRcWVhXWWJoYmVnaXF0amBibXhua25paWlramlkX15XV1lZW2BgYmRkYWFkZ2FhYWJi
YldQVV5vdnRya2pra3qBdnNpYmRmdHhydHR4d3JzdnR0c3NwbXRtaHB3fIWAfX+GgIWLjYqGhoSG
iIF5bmRZW1lbb317bW1vc3RwbW9rcXJvZGJqa3Jzcmtrbmtra2tqZmJoZ2d7eW1nXExHTVtpanF5
dHR7eYGmp5Z5dHF6jJiPYlVXWF9qYF1ia2llYmpeXFlfZVlVWVhXWVtZYWlrcXFzdHJ0d3NxdHR0
eHRxb21ra25panR2eZGjk25qZ2RkZGJ42v7vmFBAPFRygIR/hIWFgIODgYGAfHZ7fHd7fXRza29y
YVlVTkdNSkxVVk9PUlNZV1dXWF5gXVtbWVlYWV1fXmBgXWJmZ2hraGtqZ25weH19eHl3c3Fze3+L
ko+RjI6GiY+OhYJ/fXt0eXyFiIaCgoGChYF/fX16dnh0dnx9fIaJhYB9fX2CfHJmT0AxLCwxOE1Z
W1xgX2FhZWRmYmViXVlcZmtvcHZwb3J0f3x5b2JbW2Jna3yPgXh9fXl3eHaCc2poYEY9PEBAQU9L
V4+ehXNzfX+EjaGfj4iJjIuMiouNj4yGiImJkYuFfX16en16c2hla29zdnl8eXR2dnR4dnuDenp9
goOGg4aRgoCFgIKAenl0dH16cG9ua29xb3B2eIGCe3l5fYN9gYGEf2pZfH14gYuMj5SdnZ2coKqq
rJzFyp+Sl5eYkY6SlJiPjIp9amRhZ2loa2traXB4d3h7e4R/gYSLgHh3f4GOmJiYj4+RjIR9d3Bl
UEdER0ZHSkpFQkpPYmJlaXZ5dHh0cW9udHl3amdkYl9lcneFiZSIjJ2PjoqIiIN9e3h2fX2OobCq
pq6xrKSqqKahpJaXl56uyszHw8PIxcXEwry4srW2s7Ozs7i2saehn5iLiX1nUkVFR0NEQDs9PUBF
W2RmcHFxdIJ6eXl7hIJ8gYSNpLbBwrq/ycK/wcfMvLawrq2tsK3AybOztrW7uLOytbe1sLGfhnx0
XTczQVxueX2BioaEgYWaioR/gIaOioqXmp2gqbOusKamqaGYkYJwXn+nl4CGj5OPl5iYmpydoJyd
oaekoamhoJ6hoZ+eqby7urazs7W5uLOtnJGPj5GPhYB8eX2EcXBxb3ttUEBHXWtyfIWPj5GdlpKT
lY+DgJiGcmRcWFVWU05CQ0dQWWFlamtra213eXZ0gnt5eoKIpJ+KkqagnJ6cnZ2ampafl46EcmFN
R0E+S2F5fYKPj5OWl5yeoaOlo6OPgoWCgoWMkZaaqbGytrWzuru8u7u/vry7urzAvry2oXpnYWeT
komGiY2GiY+UkZSbnaWorLK7vrGnqq6poZ+bnp2dnJ2bk31zdHp/iqisrKqssK2xsKqqqqyuoaCg
naCYj46CeG1VRj5ERlRWXlZSUlJKTk9UVVlZWV9gYWJvf5SXjY+Oi4ifhn1rXnKPoaGgnaaopqGd
nZyVk56VdoW2ztH26baosbOonZeYn5aYm5WYnp6alIx9c21ZS0tVcH1/i4CGqYZ8e3+IhIWEgYyP
kYqKhn19gIOEg399gX14fJSAc2Ved4GEhYSFhYaEhIJ5cGdxcG1tZV5gYmpyaFtbW1ZQUFBZcmli
ZWttaWVpZGJcVldxgoOPpce7rrK1sLO4trKusrGvrbC1sqmqrbOvsa6no6GXkoZ7X0xLW3OChZSP
j4+NhYSEfXh4d3R6jKGjoaehoaenqqiurq6qsbCyqqiqqKivqqmmmo6DcnNzc3l7j3hycXt0cndz
XVxiamt2enZ6e39/f4B9Z1lZWWBrcmtoanKEb2aBhVY1OFlfXVxiZWVnaGtxb21pdIR8d3l9hIiG
jo+Mj5qal5iTkYyPkYyGe2ticH15dHmCgISPnaynrq23srOzqpiTmJicpKQ1NDM1NTU1NTs4Ojg1
OTQzNDU1NzQ0MTAzNDU1OTg3NDc3NzU0NDU1MzQzOTUzNDI3NTEyNTU0MzUzMzg6PUZJTlJQVE1P
TU1HRUM9PDU5NTU1MTE1NzU9REdKTE1PTExKTVRXW1xcXl9iZmpvb3B2dHJzdHp2eX+Ag4KEhYaN
jY+Pj5WTk5eSj5OXiIqJhoB6e3l2c3RxcXNrcHFrbXJzd3hvam1tamppZmViYmJeXFtbXVRPX2h2
eXh9f319gIF8fIOFiYF/enR0eHN6nYliWVtcWV5bX2BdYmlgXFlXWUpBQz01QllXVFdZX2tzaFle
eHhYUFxicGRYVlJST0xWX05FRkdSUkRCPT44MSwsKSwuOkI1Nzs9PkBFSkdHQ0VCREVHRlV7ZVVr
WElMS0dJRERFSUtOT1VTT1BTUk1LTkpKTE1PVFxdYmZnZGJnaWhiZ1tVVFNQVl1ZVz49PkA6O0E+
PjtAPT0+RUA9PDo8NDhDNzEyOz4+TEpKUlhPSUdOU1BSUFBSVVNQUFJSV1RQRzk0OURLTkxPUFVW
VlNXVFNUUlBPUlROUlBTT0xLTlBLS01QUlBVW15cXmJgXWJpa2ZmZ2lkZWhoaWJmZWdkZV5fZWlr
am9ycnR2dHRxcnRwb2tqZWJgYmFhXV1eW1RUU1BQUFJVVVtWTlBPTktTUExNREdEQkJARUNBO0FD
SVBPT09QUlJQU1VUS0lMT09NR0tTUk9Sb3xkXFBOUmBXS0pKR0dDREJEQUFCSV1qaWprcG5wcXFz
cXJrZmRgV1NWV19nZ2ZrcnR0a2puc25ubnFwbmtra29oYmVtYlxbYWRlZWRiZl9hYmRhZm5kVlBV
aXZ6cm5rbWhwdnh0a210cnR4end4eXh0d3t8dnR3d3Z0cWtveXl7fYGIhoWKhomMiYuPmIyGg31z
Z15ZaWtyc3NubnF5dHpuamppZGVrgXhubm9xdG9vb2trbWtraGJoZWtua2tiUk9TVltrdHh4eHl4
g6/LlXFxcXSAcmJZWVVVYnaGbWJgYGZlamRdXWJwYFlYV1tbaHFwb29ybnN0dHFyd3l6cm9xcnZ4
b2tqZ2trd3h5dneDgHBqYl1YW2GFqppoTD1BXHmBgYOLjYV9f4KFhoOBfHl5eX18iYFycYxoTEI+
Pj5ESVBNTlZTUFBVXl1VWF1dXFdZW1hUUl5cYGBiZGhtcnRxcnl9f4SEhIqBeHR4hYKNk4+PlJub
j5WNiYuKg4GGfXt2dnyAhISDgn19fXx9dnR6eHR6fYGGhoaBgn+Ff3t0cmVKPi8rLDA3TVllZWpq
YmJna3Jwa2ZgYWFobYJxam1rdHZ9e3RrZV1YX2JkaW5yc3Z2d3Rxd3draFlKREI+QEVNa19UYnp9
dnd5e3+Gk5eLg4aLiYaKhoiGg4aIg4KEhoaEeXZ3eHRwamRrb3Fyf4J8kX1ydHZ8gJKCeHyBioGC
gIF9fYN/gIR9d3p8g3FvfW1oamtvaWtwfXp9enl7fX2AgYCDi4J9eIGLi4iNmKihkY6PppeTnKay
oZGPj4+NjpOVj4aEhXJiYmJoZWZqe3FmaHl9cnl5fYSGg4Z8dnN4eHuDfZybj4mFgoB6c2VSTElE
REdFRURJSlRtb2tucHZ2dnl0c3JybnNqZ2VnZGlyfYiIjYuKi4qPjIOFg316eIOIf4alrKisurqm
pKespaGampqpsry7vMPHxcLIysW+ubeys7Kvs7m1s7W1uKeblo+NfWZUSkZBQ09HPD5AQUxfaW9x
cnt4enx7fX2EgYJ/ho+hs7y8u77CwsDHxcq5pqmysLPEua6us7K1s7a2ubOwubWjj4qCeXRQNCw5
WXR6fX19goGDhIqFhIGAiY+Pj5SXnq6xrqinpaCemJaVfWJiip2NhoqPk5WYnJiYmJuenZ6hoKSe
oaGenpyanaGluLy7urm2us24rq+jkY2Pj42Kg396eHx6eHNyamdVPD1OZnuNkpaXlpyXmJiSj4yN
lIR7cGVfWVZSTURDR0tUV1xhbWlnaGhxdHSAeHR5e4KSioKLm5WdnJyck5SbnJKEhIF/fG9kU0FG
Yn9/e4ySlpSYm5qgpKWhsr6DdHmAhouSmqStsLOyuLe5ucLEvLy/xcO8wcS+vsGnhW9ecqGOg4WI
iomMj5eVm6Ghp6mqrrOxsbOppqWjo5+dmpyan5iGfHGFgnqBnaqqqqqqqqaqqKqnoaGlo56empeT
jY55X0tBOzU3RU1hVlNQUFNQT05UXVleX2FlYXOBj5OPkZKPjZSGem9thJaqpJ2hpqykn6Ggn5uW
m5OGlrfB0fTywaq3uLmum5iXlZaYnZukn5uhlIuDgWZQT2d3en2Ef4aKhX99g42KgoSGhJS2k32B
e3qDg4CEjoB5eXyAg3t5aFlidHl8fYKChIGFfHNrbXtva2lnaWJlYlhQTk5UUlBQT1lraWhlZWdn
a2trZF9fa3qDiZOfrru1vLy1r7O+r62wsLCxsK2sr66xsK+qrrPFqpSPjYNoUFV0g4mPk4uIj4+L
hYZ9eHR3fZihoaagoaWmqq+wrqyqrbOxra6vsrCora+srqqjloZ6cXJ3dHF3eXRvcXJycW1fYmFi
a3F0e3p3eXh4hIxrVlhZXWFmaXBwbWtiZHJwVzo6YGhhYWRiaWRqa29uaWdmcnp8fYOBgoaNipGb
qqieoZyYlZKOjn9dSk1icXp6eoGEmqano6OnrbWmpJyak5KcnZyfoDozMTEzNTM0NDI1NzU0MTM0
NTM0NDQzNDUzMzAxNDM0MS4wMzM1ODM0NTgxMzU1MjU1MzU1NTU0MjM1OzxHSU5SUFBTVVJPTUxH
Q0FCPjs7NTU3NTU5OEBBQ0pJTU1NT1BUX2RlX2JgZGdudHNwdnh4dHqDfYN/gIB/g4mGhYaMk5GU
k4+Tj4+Rk4+PioaBfHR7eHRvb25rbW90cG9vbm5vcGtqamdramppZGJiYWBcXVdUSUZQZnp7ent8
gIOFhIaEg4SGg4B9e3dxeoNrW1xeZGVhXV5gYF5hZmVeWFZbU0dHRzg0VWFWWXRnX15ZWW6Oa1Nb
hZOYgHNWT1BQTk5OREVHR0o9PURcYmZZNSwrM0tCNDg6Oj4+REVHRUdERUJER05XZoBUNU5oaVRK
RUZERk5SU1hgW1JSVV1YWVNOT0xOS1RgaWdrb25tb21pamloZV9XU1RUVlRQSkA+RTs4ODk7Pj49
QUJEQ0E8Ozc1NDMyLzM+YUxCQEtVV1NPSlBOUFBSU1hYVlZSVFJKTE1LOjRCTFRXV1NQUlNVWFZQ
VFRQVVVVVlJSUFBSUE1MS1VbT0pQUFRZXWBdW2Jlam9ra2dlaWpvbWlra21qaWpkXmFla2t0dHh0
endydnB4eHRwbnBrYV9ZXV5fYmFdXFRPUFNTWFtZXVhQTkxOVVNNS0ZHSURCPkBEQkJAREVKT0pQ
UFZQTk1PT1BVWFNQUElJTlJOTFBOU1dXU1NWVFBQUl1hUkRBREdJRkdQX2lucW5xdHh0c3h2eHhx
bmplXFRcaGtrcXd3dn13cHZwcnN0c3Rzb3NwbWhmam5kYmJgZGdnZGZnYmBlYmFkaWtcWWZ2e4V6
bnJrcHBra25zdGtvgYaCe3h8e3t4eoF9eHt8eHdydHl9fH+EgoaGjouMjIyNj5eomIqAendpXVlg
cX10b3RwcnNxcXJyamtxeXl3cW9yb2tta21xcW5paW1ra2piZnJxcmhXT1VcYWRqcXd2dHh6fYh8
eH1/eXJ3aXFeWWRtdHRzaGdiZGdgYF5dW1dXV1hVWV9uenNtdHR2bnR4c29vbXBxcm1vcW1wcGtu
a2t4dHJua3imemRkYV5YWVlbV1JNSkpheIaMhoaGhoSEgnt8gnyLgnR0e4Sjj2JQbV9HQjk0NDg8
S1BQX2FTVVJiXlNSV1hWWVhbXVdZZ2FdXWJkcHNzeXqAhoGIio6Ni42ViomYo56hlo+KkZKRj42P
kYqLjoiGgn16fXuChoB9goF8fXZ0eHl5e4GDhomPioaGgoKCkpF0X0Y9OSsoKDhOYnFxa2lmYWdt
doCLgHFhXWVraWlpaWltcniNgWlhV1BLVF5lcXZ9i3pybnZtamdfVFNTU05Na45gS0lUbnt2d3l3
gISGhoaIhoiIhYKChIB8gH+Fg4SJgX13d3h5dG5lYmpwcHF0eXt6dHRydHp7fYaEeXh9eXd4eXl7
e3h7fXh3cnZta2txbm9pb2hnb3Rvbnx9e3+AgICAf5GyloB4e4OGiIaSlY+PkZSVlJihocW/lpKY
l5aRlZKWlYaAaVtgZm5rZWdwb2pqb3Fzenx9gn18fXmGenRyb3B0fYiOhYF8enpyYldQSUZHQkRD
REpOVGBpa3FzcnJ5fXhybmtrcGtrZmFedoB9gn9/gIKChYqPjYiGhn10cnd6j6anpamuqqqjpKqg
m5uapLe6w7u2tr/Fxby5wLmtsKyhpbC1tbW8saWcnpiYk42Ga1RHQ0E+QTw7OD1ETVtncnNzd3Zz
f4WCfX+FfYGGkZauury7vrzAwsjIubOxsrOytbWyr62ssry4pKOtpKGhlpeMgXhva1A5LzJUmo14
d31/f3+DgoWCgoaPlpOTkpSdpqaqqaOgoZuXkZKBYXmTl5aWlJWYm5qYl5egnZ6enaOjoZ+cnZyb
m5ucnKe/wbq1uLu3ubKqpZ+VkpSSlI2IfXl2dHx8dHBvaFM7N0NZe5SenJ2bmKCnoZ2Vj4mEg4Bz
amddU0xHR0ZGT09OUlliZGhoaGlxenl2c3R5eXx/hIWEiqGVl5iVk5SRqJaChoGBfIF8XVBZYVtq
hZuXmJacoJ+foLLCr4J4eYJ/i5eus7Cxsbq1ube5uL+/vr/BxMLBxczLtp6Pd2h/k5WGhoqLiIyV
oJycn6akpbCztbWyr666sbCknJijn5idjnh3d4aJi4KFlqiusLOmpaipp6ynoamjmpaWlZSPhnRZ
UlJFOTc4QUpKR0dPUFBOUFdoYlhbc2tha4KKiY+Tj5KKgIF8e32Pl6OfpK2lp6aqpaGdmp+an5Ok
uLu/0M66s7Oz1N2njZaYm5iYmJiboKCXj5GJblVebXp/fX2AhIJ/fYKGioWGiH9/iaGNg31/fX16
gIKKf3t4d3d8d3ZqVVVrcHR4fX19e3l4bmltdHNtamViYWJeUlBPUFBTU1BQWWhpa25taW9yb2tt
dICFgYSLmJqes7i1sbO1t7assa+vrrOzraquqqywqqiqwNyvlY+RjH9whY+OhoWJjI2Pj5GLiIOL
hIaXpKeqrK2wrK2xsqqztbOywbOtqq+xr6ytr6qqqqejjXprbXN5c3R2c29vcHd5a2BpXWRygXd0
d3h0dHt7iGZVVFZdX2JkZ2VfZGJeZWZPNzpmaGJiZWRoaGtubWtnZGJtbXeBgXx9hImRnqGlmpik
oZuWkZORdEAuN1Jlb3R9gpWqqKSmp6qspqSlo6GhoKCenqGeMzUxMTU1MzEyODg3NTU1ODg1MzQ1
MjI1NDc1NTU1Nzg1NTUxMjk1NDU1NTAyMjc0MjM1ODU0NDg1ODc+S1JWVFVWVFZYVlJQU1BLRkM9
ODs4NTEuLzM4O0NGR0lLTk1OS01ZZWJmZmZla3Jxc29xc3iAfX18e4CEgoWFhIqLiY6PjomPl46O
kZGOj5GJiYWCf3t5eXNubW5vcmtrcWttcG9rbXFva29ubmlra2lkW1xXVE5FQ01idoKDgICKhYaO
jomDhoqJiYZ5eXp6fIBiV2ZfYmJhYWJlYmRgYFtZVFVTUEtNRztCZHFwfHFrXltebmdoZHCMp6+I
eFhUUFVbYlJKR0lEPjEsM0Vne101LjI3PkA4NTk6PDo7PkRER0ZHTEpKUFxuX0s6OUdKR0VGTkRC
SlViX1RUUFBXXldUV1dUVFxbWWJnamhra2pwc29ubW1nZV1XVFhXUldSVFhZV0E5NTo+QUJEQEFF
R01KPD0+MzE9NzdATEQ9PU1SRTo5XGdSUk9SVFVXVltXTkpHSUxARE9UVFtYVlVUVlheVlRWVlJU
VVlVUk5QUFBNTE5LRUdQU09QVFdZW2BlYmRrfYxrZmZlaWlra2twb2tqZFtbaG1vcnR2dHR3dHR4
d3Z3dnR0cGRbW2FiXWl0X1lXVVRTVVdZW2FZU01OVlVUUFNLS0lMSURDPj5APkBAREdKUk5QVVJS
U1BVUE9QTk1JSkpPTk5QT1RPT1JQTU5LR0dPbV9TUktHR0VJS1Bea21zdHJ2dHt5dnZ4c3Rxa2Ri
W1hkb3FzdHR4jX19eHN0dHRxdnRzc3BubWhiZGFiZGhlYmZqZmRiZGJqaGhvcl9ianh2f3ttbmpr
b3Nta2dqbW92gH1/gHx5e313eXt8fHiCgXh9f4ODgoaIhoqOi5KSjY+UkpSKiIqEd2tkWVZogI54
b21vcW50c3Nta3R0eXaBdHFrbXJvb25waG5wa25ra2Jfbnl5c2JYWVtgZXByc3B2goaKgHNyg42A
a15ga3uGfX15cGtobmpmYmdoYVhXV1dZVFllcnd9f3t0eXd2d3h3d3RzcXNzcXNucXFxcHBtcHt6
cXBtcpRyYWJgWVlcW1ZUUlBTUGl7iIyJiIuIf4KEf4OFe3p7fH95d3RlWU5PT0pCPjo6OTxCRklQ
Uk9QT05UU05TVFdnYmZucnB0eGVfZ2pud4J/g4SGiYuIio2NjI+YnqOckYyPjY2RkpGUlpGSkpSM
iIqJgn98e4COiYJ8hoF2cXF3eX1/hIaIjI2KhoKAfXyJo3ZTPjU1LCosRl5lZmpwcmhpa3SAgn12
cGlxZ2hqYmVma26CiXRtaWRXTEtNW2p7hYN/gntya2RcUFhibXRvamqBk2tOSlNicXR6gHl9fYiS
k4uIiYmGgYSAg4B/fXx7hIiDgn1yc3N3cGhnZmlwcHN0b3JxfH94en2DgXl4eXh5eXl5dHl6dHd4
eYB0dHFta2+Dd2lnanByenNwfI2AfY2IgoWGj5ORiYmIhoaEhI6YpJSJhIuXo7Cxu7KmoZ2YmJ6b
lpicmHBfXWBofH1vaGtvc3B2dnd8gnp9gYmAfHl0dHFvcG1wd4GFfHd3fXhtZVNMSUZHR0ZFQ05U
Zm1rcW9ydHR3c3Rycm5taHB2YWJ3i3x0d3h6fX2AgoGBhoZ9d29na3ulo6Coqqqoqamqpq+toLe/
wrO3urm8v7y/yL63rqyjoJuaoa+3rKOko6GfnJ6Xj4Z0XUtBQEREQj0+O0JOYmttc3Z0dHd6e3yA
gYKIiYuTm6ezvrezvL67v7y2s7K2rrOusq+oqK2oqqqRlqOjlI+TjIR7dG5pYEozM0trj4VzeH19
fYSFgYWMoLGTioyRkpKTmqajnp2clYqKj3J0jY+TmpiWn5uVlpudoaGns6GgqKGhnZubm52hvKqY
obO6vL63t7m7tqqlnZOPi42MiICAeXR5jHh0hHhoTDQwPlZ8j5ekpaamqqSjn5uUjouGgX18iWFQ
R0NCREdHR05QVFBXYmleXGRkaGtrcnh0cXR4eHh8hImSmJ2PiYabo4mWi32BgXp3bnlZTlx8j5KV
mJ2knqGgpbGGeX18fX2Ckq6zta+zurm7vL68xczKycnHyMC+x8m7pqGJcGt2houIhoSIi6empaGj
p6GhrLKzr7Wxr7Gqp6CwppuWlYF2c3N0d5GffXmGnaeqs7GorKqlramfoaGbmJeSj4x5ZlxZWVVT
UFlMQkJESUxQUlVXV2BiX2FpaniDjI6Wm5iWjYiFhYaDho+coKaqqqmqqaqmoaGloJ6enrC5v8PD
xbq7wcfNtpaalpyun52alZyko5qVjINuXGByent8gIaYn4F5fHt9hYR/fHt0fYKAe397d3t8hImB
gHp/fYF8e3heVV95dHt5d3t9dG9tb3FvcnFrZmViZ2hbWVNVVFdZU1RdZWtva21ydn2BiIuGkYyN
jY+Yl5yqs66uvrq2rKiqsLOxsLOtsbCurK2tvLGuvLGhl5aShXyGiYWJiIaMkZOSoZSKhoaLn7Gz
sK2tqrGzsbO4s7+8urO7tbm2r62usK6xsrOvt6mXfXFudnRyeXRxb3R5dHNkXWVfYoS1fWZvdnZ0
b25rXFZXWV1cXWRlYmJfX2hqZlM4OV9pZWRmZ2Vpa2txamRfYFRccn17d3yDj6Gjm5qYm6Wmm5iX
l5h9Oyk0SWBpfJKfpKanp6WnqKOlrLO1qKaooaCfoKYzMzU1Nzg1NTU1MzI0Nzc1NDU1ODc1MTg1
NTUzNTk3NDU4MzIzNDUzMzM1NTU1NTQ1NTUyNTIxNDQ1QVJXWVhZWVlXVlNUUk9PUE5JR0VEPj01
Mi8sMDU8QkNGS0pKS0xLU19naGdoZmtyc3N2eXN0d3t6e4Z/fIOIiYiCiIiNjY+TmJONjpGVj4+R
koyLhoF9fHl5enFvbm9ra2dramtrbnFxcXFyc3Jxcm5taWRgWFJQSkVFUm+BhYOFi4mJjo6LjI+L
iYqGgnt3eXJxcXJlYl5eYmViYmZqfGtiYlxXWVJQS0pLPTpit4tkUF5gXFZUX2Bpe4+jgm1gV1BW
WWCMhk5FREI8Mzc1Q09OTUc1OT44Pj08O0dCQVRTRkdERk5MTUtQWV1YUEA+SUlGQkNFRFB6ZllZ
V1dXVVdYXF5ZW1xZYmVngHltc3N0cnFvc3RxcGtqYl1VWVlZV1JQX01GPj09Pj5DRUBDREREQks9
NTQyMDUxMzAxMTU1R1M0Kiw1SlBQVVdUVVRbalBLSUdLTU5WWV5eYmViYlxcXFhYW1tXVVhbWFVV
UlBOT1BTQzU9UE1OUE9UV1RXXl9gZYJ3ZGRnZ2hua21wc3Jxb2tnXVxncXRzdnl3d3R4e3x7e3p2
dnZtYllYXF9iZ2hiXFxZVlZWW19lYl1VTE1QV1tWUExJTE5KR0ZEQUE+PkZSVFBPTk5TWVdSUFJQ
Uk5KT05OUF5WUFNVUE5LTFBPTkpLS0tKTlBZXFZWVlVSWGJtdnN0eXp9gHx8fXl7e3R3cmdiZWhu
cnJ3eHmMinhyb3N7enZ0dnZxcW1qaWJiYmRqamdnZmtqZ2dnYmFkYmtoYGtwb3Fzb29raWZqaW5x
aG59cm14gImFg32Aent5eXmAfHRud3t0goaPioaGioyOkZSTlpiYlI+Ogn19cmJYT15xeHuOdG1t
cHR3bmtwc3h0dHN6hHZydnFwbmpobW9xc3BqYWRvlp+PdGJfYmVrcn17c3J3fYaBdHmXoZN0aG10
nreWgnNuZ2trZWJoaWJcXGRYVV1fZWt0dnd6d3eAfXp4eXp3fXl0dnR0dndzc3FrcnNwfXZraGpr
bWtnW1hdXFlgYVNQSkVMYXaGjouDiYiJiYWGhYGDfXyCgYCDfFlPUFleVU5HR0dFRk9hV1VQVFBQ
UE9QT1JZYmtycHNrampzZ2JqcXl/gYOIhoOKjY+MjY6VmpqRjo2Pj5GRjY+Pk5WUk4+Nko+PhoGA
go6FjH12cniAf3p5dHJ3gYKLi4uNk5ONiYiMgn94aEo8ODAqKzxZa2dpcXhrZmdyfYyIfXZubWtt
a2dgYGVmbXSBc2hkXU9NT0xicHt9g4qPhoNnVExPYnqDi4qMhnd3a1VOUGRqc3FrdnuCgoaIhIJ/
gYWBgn1/f319f314en2EfXB2eXh/dmtmZWZqc3uGcWlxd3R9fYB6d3N2eHR3d3h4dHN3eXR0dHZ4
cW5paW1oZmJia21tb3Nyd3x/jI5/hI2Rj4uIiYSBgoJ9goaIhImGkaixuLa1s6+xp5iTmJeVkZKG
WUlUWGBiaWdoa290d3x9eHNzeXh7pYlvcW1xj39qam5wdHR4cm9zcG9vXUdER1JMQ0NFTFRibmpp
am1ydG17eXFqa2hmb3RhYW10dHJxc294eYJ7fH1/e3t0ZV1hcZGbnp+pqqmloaSlsrCuvLmtt7a7
vry/urzOurCpoZKChY2bo7OwpqaqpJ2Ym5qPhndiUkY+OT5BOjc5Qk5ca3Z0dHR6fIF8goWGgYSN
lp2ho7G7vLi/wru7xMfV1r+wqq6vpqWkoZyjnnl6hY+UjISDd3FyamlnX0U+XW57d4CPgXh6f4SB
hYmVqJeNkY+WlZWXl5+hnpiOiIqFeoaYl5WbnZuhoJidnZ2goKOsqryelJWYm5icmJeopZ6htsK+
uLm7traxrqqfl5aRj42MiH10fHyBc25zbnZWNTE9WY6enpuhpqGkn6ClnZ2hrZGGe3duYFdKQUBE
UExLTlBSWFRWVVVYXGJdXmJnamtxg4t9cnJydH2KjYiEgoOXvtupe3h5dnZvc2FJTXCPm5+koZ+h
paOXjomIhoR/gYSgv7CztbG1trW7usLIxMXIy8vFwsTDxbWzqYxyYmh7g4WIhoSKmp6gp6Ggqqim
rbCxu7G1rKmhoKWhmJiGdnN0dHZ3eH98fH+Np6mz2rOeoaGmn5yjnpuYkoqNiHBeWFlcWFhcYVlN
QUNLSkxLT1BZa3RiYmJohpOPlZ7DoY6UhoSJjouGj5ieoKqsra2nqKqnp6OhoaGlsbe6vsLEwb7F
1tCjoaOYlZugm56Wm56boJqPhnNZYXB3fYKEgpipg3l9gHt7fXh2fH97f4B8gn95eYKGhIGCfX99
fXl2blhTZnJ0dnh9fXRycWtta29tbWhoZWZpcGpgYFtgX1leYGdma29tcXeKnJWSjo2Wj4yTlZOY
oaGlrrGqrrGwrrWwubOxsbCtsK+uqamysampuqqho5ONhouLiI2NjIyPj5OVk5GLj62zsLG1u7Oz
vLeztra5vLWzr7Czs6yysqqtrraur6+sqJ6Dbmt5enFxc3F2dHJzb19ZW1tmfY1ybnBvc3RwZl9T
VFZbXVxeYGZoYl9hX2pkV0VHaGtna25ramtnZ2llZ1xZQD5Ldnx9fISPnaito6GhoaGaoZ+YkYxZ
PUdQWGV3i6SpqKiqraqsqq+zs7e2rrCwqqmnqjU3ODU3ODo4NzQ1NTg1OjUyNDc3NTU5OTczNTU4
NTc4NTQ1NTUzMzU5Ojg6Nzc1NTQ1Mzg4MzQ1NUBUV19hXmFgWVlbXFlTVVBQTklKR0RAOjU0Mi4w
NT5CSVBSUlJQT1BZZmdrcXJ0c3d3eXd2dnl4d3iBgYSGgIGDhouIi4uOj5GUkZKNlJeVkYyPjoiD
hISCe3l2c3NxbmtqbW5qbnFtcHR0cnJ0cHBuc3FoXllVUkpHR0VNaISKi42NkpKRko6MjpKOjYuN
g3x5fXRyd3JkW11nZ2ZpaWtzbmdgW1VTVlRQTkpKUmt7ZldfeGlkXmRwZXjBzHpZVFlYVVBUWZaX
UEJDQDMvNDg1QDU3NTAzNzw1ODw+PkFFYlBJR0VHSUtST1BbXltgRDRFTEZFR0dJXGZiWVdcV1dc
VlViYV9iX2JiZmVmaHB3cnFvdHh2dm5zdnJoXl1bWVxYVlBDPUE7Oz5DRENERkdLSUA+PkE5MT4z
ODg7Pjw9T1xVaEYxLCw+TlBQVFNXVFNPSkdJSlRUWV5eX2JhYWJhYGBZV1dYWVlWXVxXWFBQUlBQ
TUs+ODlSU01OUFJUVlVcXGJwa25oa2tlc2trb2tqc3FqZV9bXGdwbXF3dHN4d3x5eHp9eXl9emZb
V1leYWdkYmJcXFtZWVheZGleTE5SV2FTTFBQUk1KUE5LSUtKSU1ETHSOblNQSk5bVE9PUlNOUE1K
TE9XWVlXVFxWVVNPUk9QUE9HR09OU1hVVFRWVlVea3BzdHh8f3x9f3t9fH16fHt9cmZlanB0eHx3
dnuAcG5yeHh9e3l3eXR0cnRvYmJiZmZmaGZrbmdnZmdoZGZnYmtwbnBrcW5ta2txb3Fta2tpa21p
aXiIj5qejoaCgIKCf3p5cnFrWWh9ho+KiY+Rl5qUk5iYl5SSk5GGgXtrXVlZYG5ra3Bwa25rcG9r
a3J7fICAfHd3d3Bxc310bW9tcHZ9e3hrZ3qs0cycenBraW55gZSEc3d0dGtwdrbIpY2Gdn2Jgntx
b3BvcXNnZ21qamJhYF5UYGB0fXh5enx6dHx9f4B6d3p5e3p9eXx3cnR4d32OhndrcXB5bWZla2dg
X2BfX1lYVFBMTU1ifYqOjo2IioWLiYuIgn9/f3d0fYR3a2ZtcHZvYV9cWVhUVltkZWFZU1BTVFJT
WWRtcnBvbmtra2trbWt0eoCGiIiGhoyPj5GPlpaWkpGRkZKPj46PkZqUlJWVl5OPko+Pi4SJkWZp
dHRycnFuZ2pnbn2EhoaMj5SOiImFgYSAfXJmTj01MzE7VWhmamtucGtma3R8gYOKenBudHJ3fXhi
XmFkc3pxZ2BeW1ROU3mKeX2CgZWPc2leWF1qiYuFfYCOd3NzYlNSYmtrbm9xc32El5GDfX19gYGC
fX17en2MfXZwcW90eXR6dHZzcm1pZGlucZ5/fXhtcnF6e3h0b25wc3t7eHRxcm5xcHR2eXl4cW9v
aWhqYmRubW50c3aAfYJ/hoaJhoqKi4iGiIKAfXd3YllmfYmdrLKxsLW1t7a4qZuYn6Galo5mUEZP
XWRla29zcnd8fX95e3R4eHSAgHR0cnKlp2tkZmd2dnBwdHNza2JWT0tGSkdBREdQUFxnZmVhZ25v
a2tub21ramViYmFiaW9tcXN0dHR0eHd0ent9j3hnYllkhpaaoaWjpKOjpaGfoa23rrCzvLq8uLq7
ubexsKGBamJkcoqgsK2lpKWhnqCfm4+MhHBfTEM8Nzc1OTo+TFlncnd0eH14d3+AhIaIjpaeoaeo
qra+vLGzrrjg/P73yKqws7OspKOpqJp8b3FtdomGhoiBd3Nva2hra2JmbXmAg4R7fYCBhYWGjJWW
lpOdnJGPjY6SlZWTlox/eIiXnMG5nqmlo6ajpqegnqeloZ6nyqSPlJibm52YlpWXnKGxuLe3tre6
s6+ur5yUkZOOjo+KfXR6enZzcm9tYkc0MUN5oJeVmpqcoKCgp6Ggn6q6mHx2cWlqgGJEQkBFRUVM
TE9TVVlYXWJeXl5bYGBrbmd/wrVrX2Jrcnh7f319hpXW8e6db3R2c25ybl9pcIqTjZWamJibl5SP
j4yFg32Ij56uubOxtbe2tbe+5OvHwMnJysXFxcXIu7GdinFgXmp5gICCiJaEi5qnoZ2kpaGnqrO1
sLW3o6GfoJ6RiXZ0cnd4f3h0cnF5eYmWoa7MsaCgoaihoJyYlZGSjoN2aFtWWV1fW11iZWBLRUlF
R05UT1hoeG5pc4WRl5ibprWhj5aNi4+Uj42UmqGnp6ytqq+ypqepp6ipqLGyr7e2u7zAwtXZ0qqh
npKUlZicnaCbnZ2kp42IeGhqe4B/g4GEhoZ/fYSGfXh3en96enl9fXuBf39/gYOCf3x9f4B8enRi
V1lyeX19hY+Df3Zua29rbnR2c29ucnN3cG9taWlnZ2loa29wcHh9hpGfmJaPj4uPlI+Wnp+coKGp
rq2vqq+xrbi1sLCxra+usa6vrKaqqqego6GenJWRkY6MkouNkouRl5OTj4yVrru3trW3uLe3u7y5
s7O5urm6t7K2uLqzrbO/uKyvsaqono5za3NycnJzdnBzeXJhVlRYWVxkZWducWtta2JZVUlOW1BU
Xl9hX11bXVteYlxPSllza2llaW5rbm5qZF9eX0owLEJua2p2jJGbqamtpp6mpp+goZuRhndfZ1lV
X26BmqSlsKmtrKatsri5sLKzsK6vrqyqNTc3NzczMTg4NTQ0NTc1NTc1NzU1NTI0NTc0NDc7NzM1
NTQ1NTc1NzU1NTk1NDQ1MzMzNTU1NDdFUFtiZGFgYF9bWVxZWVVVVE9QT0dEREI8ODMuKiswQEBF
SUpQT05QTlVkbW5ydnR4e395e3p9e3Z0fYF9f4GCfYOGiouMkYyNj5KPlZiUk5STj46PiYuEf3uA
eG9xd3JxcWhwb25ucHJtbnRzcnZwbm1yb2lkXFlZVlRQT01ff4+WjJKUkpaUkpKUjYuNkoN/fXh0
cnRrcndnbWh7bV5hYmhoZ2FbWFRYVnJbVldbZ15YVVlmdGBkYHS73c2nkoFhVlhZWVVXaHmFc0c4
MzIsLCwxNDMyNDw4MjpGQj4+Qk1mTklKT1BNTlRUVFVUXVdHSlBHRENFSlldXVhbWVdcW1xiYlle
YmdmZGRlcHR0dnZ0dHd3d3x7eXd5dG5lX11gWVhXTz46PUBBQkRJVElER0NHR0RCSUUxLC49R0tE
Ozw+PT5BPj43MThJUlBYXlZUUE5HRUtQWWFgX19iYWdmZWJgZF9WVltbV1dbWVlTUlJQUFBNTEY7
PT5PT0tNS1BSVFtcbXxvYmtxb2qDfHBraG12hG5rZV5XZ3Btb3R8eXZ6e317dneBgYWEZV5eYmFk
ZmhmZmhiXVdXXWRkX1lWS0tNTU9TUE1PT1BPUFBLSkRGRERHRlN0dHZdTFBQUE1QUE5QTE5QTVBV
WVVXWVRNT01SU01QVFJPT0lUU1BVV1ZSYnF7eHZ5fHt9gICAg4KFg4KBfXt6dHJqb3l4d3Z0cW9y
dG5zeHt7eXl9fXx3dnRvZWVna25vbWhna2tiYGJibW1rZ2pzcnRzdHRycHFraGlnZWtya2ZmbX2B
jqiVj4+BfYODhn10ZFROX3SMnpuPj5KRkpiamJqcmJaRlI6Fe3NnXl9oZmdrcG5ucHJraG10eoGA
eoB/hZp/cW1rbmdra21ygYCDgX2Bmsro5bmJdHR0d3qBiYl5dG1iYGh3j56NjZN/fYF8d3Zxb3h9
dGtkbm5yb11WXFlXX3N2d3h6e319fYGCe3x4d3p9fXl2d3t3eXl5enx9gYScgWtxcW5kYGBgYmZr
a2JZVk1NTF95ho2OkY6LiImIioaDg3x8e3mDlHRrcXFqa2lkZmZiYWFeXmFdYl1YVldVU1Vga29w
a2tvdHBtaGtwb32IiIqIhouPiI+PkY+Pk5KUk5KVkZSPkZKWlpiTlpaSkpSWj4+PmI+PaGhzc25n
aWlqZWR4goiMho+RkYmPkoqBgnt9iG1FQDk4OkxfZGhob29wa2Vrb3F4fYN9d3R0cHB3hWVbW2Bi
ampoZ2JlYllZc398gX+Bgnp0dmppb3mGhnl2fH96fXdnVlNcYmprcXFwdHaAgX17fYB4dnh3d3Ry
enxvbW5qaHZqa3R2d3RvbmtiYl1UZmltcnByeXl4end0dG5xd3Zwc3ZzcHNuc3RzeXx0cHFuZmZr
cWtpZ3Jzcnd3e3yDhYqIjYuGiYqIiIR/dmlTVXaDkaCpsba1s7WwtbWznJaenpqdjXFORVBiaWho
bXN5e3d6fYWhlX90eXZzdHN0c3Z0bmlwbnJyb2trbm1pXktHRkNCRUREREdOWFxhYmVnaGhraGtr
aWpqaGFdXGJocmpubm1ybm9yd3R0d3qYhmFWVGF9j5yenp6ho6Gkp6WhqK2wsbe6vMC7t7m2s6yq
noNqWF5wjqSsqbKtp6GgoZuVlpeIeWBOQzk4NTUzNT5MXWZubXB2eXp3eXyFjYaPmJybn6murbCs
pqeooam349TEwrOzsa6lo6Ohm4+Oe3J/i4iIfHh9eG1rZmtwbWp0fX+Ag4mNiI2NjI6PlY+Xk5ia
lJSSj5KXlI+Gc3J3j5ygp6Gd0OOvmJ+mp6OfoJ6eoaGhoZiYmJaYlJiVlpqdqa+ws7O2vL+5rq+2
mo2Oj42FgXt3dnR0dHhyZ2JTPDE0R3iRnJyanqGepKano5+ao5+hj3dqa2iGcEZCQkJGR1ZYVmVw
Z2Rrdn1lYl5YVGBnZWaWjWZdYmZrbW5/en+CicX1/tN9dHx2enRra3R7hIuOlaqzmI+Oj5Oeqo+G
gYGVqq61t7i5s7m8vMjv4MO8xMnKzMXFw7+5r6GJbV9hYnKCfX9/f3JujKWmo56kpKazt7Csrreu
o56cmI97bnB0dHh8eXp6eHJ2hJOeo6WmoaGmpKOfnZiXjomIeGtpYldXXmJhYmJfXVBAPEBJV1RY
XWBkfImRmJeYmpqfnpqalY+UlZGSnJqYoKGhpKWvqaejp6eqpLKzqq23u7u8wry83dC2oJqnp5+X
mpiYnJueoJ6Wlol9aoKKhoKIhIF/gYWEhHh2eXR0eX1/fX1/f4OEfX15fX2Af4R8e3R3bmFZYnt9
gIODhn19dnFucGdqf3JydHBycXN0dHN0a3F0c25wdHRxgoyPl52cnZqgnpiUmJuYnJ+lpaeqsa2s
r66xtr61raqxrK+3rKmsqJ6boaCfnJ2hnJSVko6Nk5aUk5KOjJKUj5iquby4vLy8u7y/vLq5t7q8
vLO3v7y1trW2r7a1sLOxraajmH1va3R0dnR0dHd4YVNSVV5bX15cX2FlYmJZVE9HSUxOTk5UUlle
XVtXW1ZWUE1MWHBoZWRiaGZna2hiYl9SOiwqQ3RgV2icmp6mqaigqLKzsqOhmJKTj3l0X1dhZ3md
o6mnp6yvqrC6u7Kws7GxsLKsqqo1ODk0MzU1NTc1MTQ3MzI0NzM0NzMzNTU0NTg1MzU1NzU1NTg1
MjI1NzU0NTIyMjI1NTg1MzU4QFZhZGhpZWZkYFxZWVVTVVBQT05MR0xOQDk4NTIrLCsvNUVOS0pM
TEpNUGVxdHN0eHp7f399enp7f315eXyAgX98hYiIhoyPj4uRj5OWmJGOk5SVj5GMiIGAfXx6eXh0
c3Rubm5tcXFxcXBwc3R2eHl0dnFvamdiXVxrhoKksHl5j5aPj5OamJialpicl4iAhoB/f3x5dnBo
TlltaVliYmFmZmhlZWBhcl1QVGpZVlVVW11gYFtdWVtidHGCjF2VpH2Og2dVVVJVlp10RC8sPVA9
MDw5Mi81OTk+Oz4+PkFGU1BQTktPUFBPT1RUU1NVVUU+PkVFREddXlleXFxdX19eXFhYV1Zdamhl
dm1rc3l3fX19gH14e4F/eHp2c293cWFcWVhZVVJOS0lTc2Fxb0dBQ0RHQT4+MCwvOEFDQD0+RkY+
Qjw4OTo+PjVAUFhQUk5HRENTXlteYWVlZWRmZmRoZWZlYV1dWVlXV15fW1dTUlBTT01LR0xHRWtX
RUdLSU1OVV1iYWJna2uGlHJrcnRwbnNwbm1pX1hVX2RyeHd0c3d3d319fYx/YlldX2RkZGZrZWln
Z2JfX15iZFtVXWBVTU1NTU5PTlBTU1BQUFBQRkFDQT4+QEZLW2pQTU1WTk1PYllLSk1VU1RVVVtX
UE1JS0tPT1JTVFldU09PUE9UV1xgg4F4dnR6fYB9fX2EhoV/gYSBf315d3h4d3x9dHBucHJydHR3
e3yAgX95dHR6fXRvcG9qaXh8cmhqZ2RkXmJrbWtqanJ2c3Z4dnNvcnBiZGlvbYZ0Z3B8bW97fX2G
hoGBhImBd25cUEtQa3yOnJiPlJWTmpqcp5uamJSPjY+DbWBgX2VkaGppbmpqZ2Vqcnt/jn94eoJ9
gX13cGhkZ2prbnmcl3t/goyduc2+qY99e3x9fZGqoX1oWV50jJecn6Wejnd6pJt8b3Nyc3hybW95
gHZoX1xVVFNlcnd9enp5eIF9f4J6fH2Agnx5eHl6dnSAfYKGgHqCgH94a2ZkYWdoZ250eXt3cXF9
clNUboODhYqLi4iIjIOAgICIgntycnFucnSBenBrbW9qZW1oYmdiZ2Zqcl1XVVRTWW1zcW5rcHBy
cG9ucW93gIaBiIqPko6PkZKVk5KSlZiRkpeUkZiampqhpZucmpiYlJiUiIWDfWpcXGlraWJcXmd7
j4qEgoqJiYyJiIqGiH98dnJwUkA9NUZXWV5gYWJra25ra21wb3R7eXt2dHRwbXBraFxZWVlXWWJk
Z3JxepS2joOCfYKGgX19hJt8cXiBenp2enx4eX9ZS1BdeXuCk3tqb3Z8gIB0dHZ0dnZxdoB6a2Jf
dHNnb2uIeW5rb25nX1dKPkVcaHJvbnJ2dnR2dHZ5dHNxcXNzbnJuZ2tpa3BzdHt8e3RnYGRnZmlo
bXBydHR8gIKCioaGiouJio+GiXtfUE1ZjI+WqbW1trOzr7CqrrmznZianJqPjWZQZ3RlaHB2fHl7
eH1/gZijioF9fHRwbW5tb2pqam5ta2twbWttb2diTkNGS0VDRERDRkdNWGRmYmJkZmJlaGtva217
ZFVQV2BnamZoamtra21ub3Byc29qZVlWa4qPk5WjoaGhpaWmo6GnrbO2ubzBw765ury3tbGmlHRb
XHKMoamnqqakpaqmoJiYlZGGc2BHPj09Ozw+Pk9laXNwbXZ/g399eoOGj5ibnqGnr7WyqKWpqKSh
pKyztby8wby6trCqrKGepMSOcnmGioF/gHp2dnBwcXNpcJ3JkXyGiY+SjoyVlJOXlpiVmKCglZOT
j46Mi4V0cnuRpaWnpKe637ipo6GmpqqppaOkp6CjoaCdmJ2YmpeYnZiaoKqztbbR2sGypaChkYuP
i3hzdnZ2c3J0b2tnWUMwLDpigo6OkpyfoaSopqGnoJ+dloSAdHBqbWBMRUZCQkdMV2Jte393cnR6
d3Z5bV5QT1VWUlRVWFlgYWV0fXeEfXh9jKPdp3t/fX1/eHBzeIKFipGUoLKYk5WWk5ORko+IiYuh
tcHTu7O2ucHDv8XFx9HOzs7Hx8XDwryqmIJoXF99j4qJioWFf3uGlZyhoKinqaqqqq6qpqScmpiS
fXBra3JydHJ6gHt5e3+IkZehpKOmpqquqqOhoa6cjoyCcWhiXV9ma2RhYmFbVUA9QkNNV3tuYWp/
s7Cbl5iYnaCgo5ybmJWWlpKMj5WaqK6lqq6qqrCqpaakqKeln6W5v8O8ur/EvKOUlaOlpKmhkpWd
nZ+YlZeUjYSBj5eSjoqEgn+FiYR/d3R4ent0d4KAf4OGhoJ9e3d5enp7gnl3cmtlXWBxe32DhoqG
f397cXeIeWllZ3J0cnJzc3d0b3NydHNyb3Rzc32IkZifnpqdm5yhnJqYmJiamqGqraqqqqmtr6my
ube4s7CqqaWoqqqnnqGlnpqfnaGhoZycl5aTlpKOj5GVmJ+UlqG+xcPAv7y6v8W7t7i7uLW5vL+6
t7Kztrm8ubK2srKzqaqkm3RreHiAhISDhHFbUFNQVl6BaVtdYWRcWVRKRkZCTGROSk1QV1lTWV1k
W0xGRUmFhmlfYmVmZWlnaGdmZ1k1LDRLYFNQd7aqoKCmp6qnqqijpKWjnp+OiHJfW11lj6Gmpqeq
wbitsLe3sbG3s7Cvs7O/sDgzNDc3ODc1MTUxNDU1NTc7NTU1MzAzNzgyMTA3OTU1Nzg1NDMyNTU1
NTQyMjQ1ODUyMzUzNzpMYGtvampobWpnYFhVVFBPTEdLS01KRDw4OjcxLCkpLC4vQUxOT1BOTE1Q
ZXR5dHp9fX19fHqAe32Fg3x3eXp/gYWIiouPkZGPkZeTlZeTkpKRlZGPjoqIi4V/e3d2dnRwc3Rw
b21va2twdnJycXZ0dHR0dnJra2pkbXaMr8W2o5SWmJeWj5OXl5aYoKeLe4mNhoOBgX12bWtMPklK
WGhnZWRteW1iZ2dhWVJSUlNVVFNbYFxfWVxbVFldaX9yUISci5OYk21QUFRYVVBBLissLDRXhXY4
KzQ3ODk8Pjs6PENSXlRMTk5QUFVWV1tYWVddaE1NREdHYGBYXFxbXmJiX15dWVlZZWl0d2hnbnJz
dnaLi4B9fH2CgHh7eXRyZmJfYWRlZF9ZWVdTUFBQUFlcTERCRUdFRTknJSs+QUFAQkBHSkI8Ojo7
PDxHSTlLV1NMSUtTW1dYXWBmaGdkZGdna2tpa2hnX1lbWVhcXVlVU1JWUE1NT0k+OT0+R0FGRUdK
SU5pjV9UYGZ8c2ltgZF0bXBvb3FxdnBnd19XYGZrgXZvb3h9hpp8gHFiYlxeYGFmaWlqZWtrZV9f
YmZeWV1bWV1eUkpOTE5PU1NSV1VSYaF4OzdAQ0RERUVKSk1QVlNVVVBraFJPT1NXVlhVZVxSR09P
UG5bUE1OUFZUS0xMS0xSU1tzk4R8eoB8gISIgYSEhoaEg4SCgn16c3d9f3txbXF0cnR4eHZ9fXx9
fXp4fHx6fHZ/d25ra3BqaGVgZmFZYm1wam50dnN6eHp2c3RzcGVgZm1va290dnp5c3l5fYB9enaB
hoh2a2JdWVdWZXyWk4+Pj5iVmJibmKyplpielYxzZGJhZWZkaGdpaWRgZXZ9gISChYKEgYN6ent5
aGZoaGZwdnt7enmFjZGYpa64mIJ9d4CDiqS3j3Rtd4yVlp+oo42AfX2MjYF0dnl0dHNzdHBtZGRb
WFlqZWd2g4WGfX17e3h6f4KBf3x7eHl7fX13fISKhYWEg4Z/hYt7dmpmZWd7koR8fXhxbm1walxo
e4WGjImDhIaGiIGDgIaAe3p2cXR0dnd2dHlzcHFuam1taWhnYmJvYllQTlBgc250enNxb3BxdHp0
eH2AhImPko+OkY+PlJORko6UmJSUlJeal5efqampra+woZOPkpKPin14aWBcX11hXmVldIuOi4Z/
fYCBgIiNhoOFgIZ7cl5EPjs4Pk5bX15iZmRra2tqanFydHd6e3t2c3Rta2lrWVBSUlBXanqIg4aP
l5qViImEg4iGgH2EmItzc3eCgYGDgHp0bl5SYoaShX2AgIV5faaGd3Jzd3Jua3Bram9paWJiZGBi
Ym92f3hvaGhbTTw7Q19ta2luc3R5eXRucG5ta2trcHFvaWdiYWdrcnF2dnmMdG5mZ2RnZ2txbnJ2
gYKYhX+CgYmGiZGPko+GbVRKTVJyhpSkr7Ovsq6vsa2ysKSenJ2dmJWKZ1VgYmZtcW90d4GEgIKF
hoaBfYZ5dHNvbm5ta2Vrc3Fra2doZmtxYlNKQkJGQkJFR0JCQklrhWFYX19gXWVmZmtnZGtmYFxW
WFtocWJhZWpra21ub3J4cmtiX1lgfYmOl52foaSgoaWlrqmsr7W7wr/CxcjEvLi7ua+jfWRic4uv
r6enqqqnqqWgoaeYjYiBb1dHR0ZEQUBESl52fXR0dHZ6d3l5g4aPkpuhqamopaWopaCqqqOysKy7
xMXBt7Gyt7CtrKylno57fYSGg4OBf3dzbmpyb2twiqCakY+Wm5aRl5uWmJiTj46PkpWWm5ePjYaI
hHl0eI+kpaOprrDItaOmp6asqqeop6GeoaOdo6OaoKWhqKqkn5ibnKqxsrW7uqmkoZeTj4l/cW5v
c3RycG5odGlSQTIzQnGJjpKTnJacoaWjoKOhnZyagndrbWtkX1BKR0ZFR01ecHZ0eHd7enh0eHly
al5XT1BTT1ZZWV1geHBpam9yeXyIioyFhIWIgoB8b3J7homLjZOTlJiYmJaUj4+TmIuKlq65vMLB
vLvEvLjZ3MTFytLL0s7JxcfEuqmSd2JbcbizhYKNjo6NhoyNkpaYo6eqqq+prKiloJyVkoBzeW5r
bXN0e4yNgniCi5KVnKOkpaelpKWqqaWhoZaUhoB0a2FdXWFkZWJfXl9cR0BGQENQbnRla4+voJec
oKCcnaGjn5uTlJidlpKVmJGTm6apr6quraysqKakp6Scmq27vLezsa2hnJWVmJOVo56Vm5igoJ2a
mJqPko6OlZORk46Ff3x9fYh3c3F2enp7fYKDg4GBgHt8fHx0dnd0cXJtZF9fYo+Pf3yAgoWCgHt3
f3pwamRndHZ2dHR5dnRzc3R0dHN0dniAg4iRmpubn6CbmJifnaGenaGnn5qepqipp6iusaypqa2s
qrK5paOjpKCenpiXnJ+jp7OnnpiVmJuYmJeWl5KOkZqep7i8wLy8xMy6try8uru8wsXEvLy3trm+
v7eysLW1sKyqpKGheGtxgY+UmJubj4NuWU1NUmBVU1tZZFVMR09EQzxDTkdGSk1MU1tSUlVQQkVB
R3SCYVxfa2ZiZ3GAenZ0aFc7PEtKUFd/paeno6anqKinpKijoZ6bnZaPjXBdX2J4k56jqqrMuqqu
t7a1t7O1sLW4sbWtMjM1NTU3NzU1NzUxNTg5NTc1NTk4MjQ3NTczNTUzODg1NTc1NTQ1NTUxMC4v
LiwwMTU0NTpCTVlvdHdwamhpZGdiX1dVT0lMUEdHR0BAPTcxMC4wKicoJztES1RSUFJNTlBcdH1/
fXx/fXqCgn+BhoR9fIR9e32FhYOFjZKRj42PkpOUk5qclZGRj5OPjImOhX16dHRzc3JvcG5wdG1v
a2ltbm50dHRycnZ5cmtteHZ3fZW4x8q2n5OPlJWYnJWYlpiShYaCg4SFgX19eXJtZVI+OjU+UGJw
a2JiZF5cVVlTVFReVlhrWVtdWVhYV1dbW1lfa2t/jXt6iIuGfYqGW0tJMisqKCosL0ScuE0nMTM1
Nzg6OTs9UltSVVZTTlJVWFdZWVlVVFNHPkA+QVNfWVxeXl9hZmBlYVxbVlhYYXRqfW9rbXF4gqWM
e318fH19g4B9dHNiXF9hbm5mZWFiZF1VWFVUU1dXUEFAQERLRywoOUJCQkFAQT5ETURAOz06Oj08
Pj5JVVBQUlZZXV9lZWhpamdoa2pnZ2tmZWFZVlJZVlttYlVTW1ZPU1JLSkI9QUFBR0dJSU5QVFBQ
WGdiZmJpa255jYNycnBxdHh4dH1rYFlkXlxbX2FgZ2ZiaXNwaWBiYmVlZmhoZ2traWlqZ2Vma2tV
VVlcVVxfWFBPTU9TVlVQVVlqhmdEQkZDR0dHTUtHRk9TUFBPUFZWUE9TUlNUXmBiVU1HSk1QWVZP
TEpOUFNTUFBQUFJWWXSViXp6fICFhYKJiI+JhoaJhYN9f3p2cnR0cG5tcnJ5dHN4e3qBf3+BgH18
eoKFeXR6dGtpamVnZmFiYV5rb25vcnN0dnt9gX19fHhyZ2Zlamlra4V9dHJ0gIGDi4N9eYGGf3x8
jI+Jf2tkboGMj5GSk5iVmJeXnJyYm6GCZmRkYmZnZmhraWdiZWdrdHt5eHl6e3x6fH14enBlYGFi
YnRvcnR5e3+EjIial4+OhYGBg4iJjI+YmI+Ki52cmJqXj4qDfHh4d3SDcnBzc25ra3pqYF5ZXVtq
fYuPl5OMgn18fXl9enp/f317fY2GhYOKko+Og4OBfYKFfHd5bmRncImOi4F7eXZ0c21wbW57fYCG
goiOjYF9fXt/e3l0bnZ0cG9win1ydHd0dnRzdHBta2toZmhiYlZPT190dG9xa2tucHR0cXR0en+G
jImOj4+PkZKTko6Nj5iam5qamJ+hoZ2joKSlp6qlnZGPi42EfXhyYl1dX2JfZ3SChoyJiYOFf4CB
hYWGe3p9dG5pV0Q4MTU7TUxMUl1dYG57al5dZ2hrdHd5cnNxbmtvcW5lTkFBQ1OJoYuTkZOSj5Og
ioiLhoN/eHx0f5KBeHd5fX99eXl0YlxtdHqAeYGDhoR8k3xxbnB0cGpqcmtna2VhZFlYX2JdaXZ3
a2llYllBODxDZm5obm93eHx9dHNzcHByb3BtcXFuZWFhZGhvc3Z0e3p3c2tqa2hqa2trbXh7fZKU
gYKAfYOInJKNlZp0YkxJWXaGlKazsaqorKqora+noKGYlJqYloVqWWBpa2hrbnB2gYN7fYSEhoaF
gXZ3bWZkZWhlb2pnZ2doZWFiaWtZS0VAPj5APjw+Q0VPSlhiXFlYV15iYmRnYmJiXVhZYFhTT16L
dGJhZmhua21ydnd4dG1uZXaIho+Rl52foKGjqrCxraqutrzDwMS/ysW+uraxs6mLcGhyls67qKqz
qK6noaSgm5eSioB5a1lTUlNWYHJiZW1yc2tzeHZ8iXl4f4mUnqGhrK+wqqWcn52hoKmztsDJw7y7
ta+vr7G3u5+bnZGLhICAgIJ9f3hvcnFtcXyGmJ+8rJSRlpqYlZGVkY+Li4yOlZOVlo2LhoN9cXR9
obGjp62tqbLKvKOlqqyqpqOnpZ6hoJ6dnZ+hmKHJ1aaUkpado6mqsraqm5eSlZSGg31wbm9va2lp
ZmZ3Vzo0OTxFWHaGj5WSlJibnZ+oqZybnaeDaW1rZmBeWV1VSUdNZnp3eXx0e3p7dnR3c3Zwa2ln
WU9OUFRVU11zZGJqam1wc3mUmIWBhYWAfYB3eIaMj5KgnJiYmJeblpWXlJOWj46YusDAvrzCwb+/
v8LFxcXNzdLLxb/CxcjCqI5xWVh0paONjpOPj5GOj4+PmKCdoaqqqKWup6amppqLfXSAa2hqcXF4
f4WFho+SmJqdm5+hpKClqaaqp6SenI2Ggn1oW2JiXmdrYl5bWV9GNEI8QkpcYGhvmK6YlJ6hpKWl
np6plpWYk5OMhIaEhY+Yn6Gnqq+uqqqoqqqomI2YnqOnrK2mrqiblJGNj5KSmJaYm5ibm5iYl5uX
lJaVmpiRj4uAd3F0hHZzcnSMfHyDgY2AfYB/enl4eXZwa2trZGVlYF1hg4OBhIWFg4GEgYR8c21r
YWR2dHZ0dHd3eHZwdnR0d3Z0dIKFjZSYnp6en56YmJyesKmWmKGen6enp6ansa2qrKasvq+jpqie
mJyanKablZihp6elv62jpaChoZyYmpWUlpaNmJynscDFwsTg3sG2vL+7vL+7wcW8vL++uLi6vLu3
t7W1samko5JrboOXqq6qp6OglYp0UklKUFNUVFBPTUxPWUlCOjdBTkVGTVRYXFBHQkFAQ0VCR1he
YmJrYWh4laGVjYJ4alxTSUtZdpWlpJ+lpKWlqqmkpKGmqqGalpOPd2hhYHCVnqWqp66wsbi2ubOv
srizrKyuqqY1NTU7ODUzMzQzNTc1MDI1Nzk0NTQxNTM1NDM4PEBHR0Q+Pj45NTIxLzQ1NDIwMTc+
SUpPYXtkYm5yg3RraGhoZl1ZU1JLSkZKSUM8PDgzNDIuLi8xKissN1NhWFVYUE9QZWdygIB7f4B/
fX15fYWGf32Dgn19eHl9gI+VlJGPlJWUlp2amJaXmJORk4+MlI98d310ZmBgYmZna21taGptbWtr
c3F5enh4dnNzcXN8gIGBjqS8yMOsnJSWmJybmJaXl5yEfYB/gIKBhYF0d2tmXl5XVVNlb2ZqYmJh
YVlQUFJSUlBfWV1eXFxcYnhnZH1mXmFqhJqKe3p9gn13dGhcUlBMPi4qKiwyNWVrOzI3Nzo4O0dB
PT5SV1VPUlJWWVlVWYVhUlJfVkpORkFFWV9eWFliZGFeXl9gYVlbXlhTXGtycGtwcHaDhYZ/e4OG
gnx/fHt4bmRgb3BrbWlnZ2lnYl5bW1lcWVdVT0dFRj4zLCtJSkNAQzs7Pj0+OTw+Pjo5OTo7Ojk8
V15bYmFmaWdkZ25ua3Fra2prbWtmZVxcWVVZa52IYFdVVFRWUE5GQz5GRkxNS0lLTlBWXVlXZ3Zy
ZXFqa29ycXB2dHB0d3J0eWtZXllgYV5dXWJkYmdpcW5nZmpraWdlc3Jra216b2t0bXZiV1hXXGBf
Yl9fXlBZXVVQUFNWVFlSQ0FBRkZHR0pPTVBUV1BLT1hYUE9VU1RUUFVZVVdTTkxKTExOUFNQUlBN
UFNQTExQVVlgaX2AfH9/gYSFhoSMiYuKiYWDhISAfHdua29tbXRycHJ4eXd2fX14f3x/gHmChYVv
XGJ4b2ZpZ2tlYl1dYG9vamlzcHR3d3t/hImCd3Jpamhob3Rucnd2d3t5fYKFiYWGiYiTnZiVmJ+a
j312d3h9g4uKkpaUlZyhpJaThnNpZWRkZGZrbW1wcW1rbm10dnh6fX9/fXZ6fH15ZWBcWVlZX2Zy
b3R4domPf4KAgoKCgYSDg4mMk5GLio6Pmp+YlpOXkol8fHx6enl4cm9yfG5paGJkZWBgZnuJlZWY
lZGLf3t8gXx4e4WjjYSIjpeanJuXkYaGhIOFg315fH1zaG9/ioaDf4V/eHNxcG9wepSFgoSJj4mE
g4B5dHh8d3Z2f3Zzc3BzcXd5eXl6e3h5dHNuamptZ2JZU1BQaYB5bm9zeXd0c29ydHl/hoqOj4+S
lZeTk5WclJOWnJ6hoZqYqKGjrKagpqanp7CpnJKLhoN/fHhtX2Jnf3Z4e4KGjoyGiIODhYaAhIaE
fXZzc21cRzIvMDpEREpSVlhdYmRfWV1iZGttcG1taWtpZ2ZrcGRJOTpHYH+LlJqXk46Sk4+OjImG
gXpza22Aj4N8goGGhpSIc3J5gHNmand9hoF/g3ZraWhrb3BzbW1tbm1oZWZhUFBVVl5veGtoZGZk
Rzc3QkNXYmZnb5OMdnhzcXBvamZpa2lqbWpmZWFhZ2trcHZ2d3R2coRuaWZlaW5ueHp2en2Agnt9
goJ9gYKDgXdrZGRteYWbqaexqqimpKalpKCow6eUk5OOg3JYVGFmbnJyd3h6goSDg4WKg4aPhnNk
W2BfX19kamdkZmBdXF1gWExCPkFAPj4+Qj5AQ0tFREdPVVhZW2FdYmVkYmdeW1lbU0dGWWpoZWJk
a3FxcXR4eIN7cGlnhY+JiI6TmJ+ho6eno66urrO5v8TH1dDCury8uryxqZR3aW+Np62wr6+mp6mp
pp+Yko6Jg3l0Zl5ZWWBla2tvc3Fub3l4dHh6fXyCiJaboaatqKizraGhnZ+hpbG+zM7Cv7y4sa6s
r7azqZ6poY2Eg4OFgYF8eHl5e3R5hI6SnrCso5yamJihn5SMioiGioySl5aYkYaKgXd0eozDsKGh
rbGzstvcrZ+lqKqopqmooKGjpaGem52gprDJppWXkpWSlaCemJeYko+KjYp9eWtna29uaGBeUEs9
MjA3PkpefYuOkpSYnZ2coZ+cnZ2PgHJranRqYF1ZXmJXUn1/dHp7dH1/gnx7d3t/cm1ocJyEW1BQ
V1VVVlxhZGpqcW5zeoiKjI2PioiNg3x9krmTiY+anJuUl5qVmpiVlpKUlZuwv8jIxMDFwLy8uL/L
ysfLzsjEv8DCxMKnimtYVGmEj4+Ri5aUkpiUjYmVm5ifqKeenKmsqqajoZiLf3NrZmpye4aWnpyh
paOmnZidoaOgoaekpqSjoaGalY6JfGhbW2JoZGFeXFtZVUQwLCwyQFJianapyJudm5+dn6Gho6qY
lpePk498cGJmdIyho6inqaekrq2opZ+Vl5+YnKOho6Ggm5iSkZWfl5KVlZWPlpWWmpWYnZiepJqX
k5OVjHhybnN0d3h4eX18f4GDiIOAhYF9enlzcW1oaGteV1lcX2F3fYCEiIaOj4SEg3h0cmplcn15
eHl0dHR0eXRtdHZ2dHSAfYWYqp2dnJifn52dnaGjoZubnqWhoaOhpaasr6qjpaS4sqCYmp2flZWX
npedsq6joJ6pqqeqp6Whn6Gcl5iatp6Mj6i8vLvEwt3RvsDEycC8vMHBwbu+w8XEvre1vMC7s7O2
r7CsmHx5jbjHsaqko6GcnZNiR0ZKTFBUVFNbZmlqYVNCMzNAPj49SlVFQUBAPkJDQEFFT2BhXmV2
jZibn5yWkYx/bWpUWHeSn6Senp6hpqimpaOmqqiqpZ+Xk42CZlldZneRqamura61t7m7urW5u7Wy
s7W5qjg4NDU5NTU5NzU1Ojc3NDQ0Nzo5NzUzNDU6PklOUExQUFBMTkZEQjs3NzcwMTQ8RU5QUmBq
YlxibW5wb2ttbmZlW11ZTUdJR0REPDs1ODUwMCswMi8sKi48R1RBXG5/inNlV2eGgYCAg3x5gIGG
iYaDgISCfHp4c3RzeoyRk5OOlZiWlpSYm5GUk5GTkYulr4NycnJ2a3JnYGRdWVBHYHBrbnNycXh8
e3l7end5goWDgX2Ek7DLxKybkpSbmpqYlpeeoaWMe32BhH+Cmo53cnFqampocHiNemhiXF9hYVZT
UkxQWVdXWWFfYWBkXF1iZW9rX2J9j4R9gIWDf3p2aGJcWWJ3iFlHOi4sMTQvMzc4Pj0+QD1AQ0dO
WWJgYV9hWVtbWVRZUE1PREREREtbYmJnbmRkZWJgXmJbXV9hXl10indqaHB0eHmCfX99gX19fXx7
e3hqXmFydnNxcW9tbWpoZWdiXFNWVVNTTEdCOCkqM0JCR0dAPkI9PD0+PkE7OT4+PTw+PEddX1xc
YmRmaWRpa2poZ2ltbWtra2ppX1VVVV1ugmdgV1JXV1ZQSkVBR0lLS0dJTUtOTl6SgVhddmdlZ3J0
eXRycm90bnBybnNnYWJfX2FgX15vaF9pa3N0bWtqa29ubnOSdG1paW10e2pmbllTWF9eYF9dX2Jg
WVtfUlBVUk9UXFZBQkVKTVBPUFBQVFVQUE5Xa11dWVRQT1BUWF1hdFxGRUpVVU9TVVBST1RTV1BS
TlVbX2Bka3R9f4KAhYiCho2Ki46MiISDhIF9dm5qcWtrcHNwdHZ5fH16eXyImIl3eHd/dmdZYXB4
dGppamlfWF50d3BucHR3d3h5fYySmJR7dHNzampziIR7eHl9f4GEipGPjJWeoKGgnpyhpLKhmKGk
lIt8fIKIhICGiIqPkYZ0a2VkbXtrYGR8fHJ9f25ycm90c3J0enl0c3Z2fHhiWVVVUE1PX2VriIFw
cnZ2dHyDhH98en2Ei4uIjYuMjIuNk5SSl5WNfXp6fXp6dHJ3cm9ucW5lYmFeWWJ4j5aVmJiRkpeP
e3R2eHp4eoCAipKUlpybnZ2Vj4uKiX2EhIB4dHZvdIqRjIaAeHl0cW1tamhocH9/enp7f4J9e3d6
dnR0eHJydHNzd3Rwc3Z5dHmEn390dHRubWh0aVtTVF1lcW9xcnJycnBycXR0d4KOkpiUjI+VkpWY
nJqTlZGYnJuepaqpqKWko6GoqKehpKObk4SCgYF8fHFlYmmIe3d/hISKjI+Pj5iRg3+CfYKKgnNw
aVhENTMxND0+QEdPU1JXWVxZWFxib3JramtqZmhpZ2VkXkc+PlOEi42YmJqbmJiTkY6Min13cGRe
a3R7fIOCgH2AnINvdoB3aWtzeHqChYKKgGtlaWhkbXFrb29wbWRnZ2FfUFBQVV5rcGdiZmBGNTdW
V1RfZWZqcHZydHt3b21raWhiaWtrYmJhZWJiaG5tcXJ0gJV9l3FZWWVqhXx5eHdzc3d7gHt4eHh2
eHRzc3aAenF3f4+Xmp+6u5yUnZ+goKGekpOerYx0YllYX2Zoa25went9hoF8gIaCg4Z/bl9cXFlW
WV9iYF9bXllXXk1HRzo6QD5CQ0BBQUFBR0JAR0xTVVVVVVldXmBbVVRWVFVLPDtJYGhqaGhxdnZ0
dHx8eHZtcXN9hoOIipKVlZufrpyVoa6zrbO+wcfHvsTAvL66trOvlHpvaHucpKayx66hoaSqoZiP
hYF8d3FoZ2hycWlnbnZ0cXd5eXl0enx6eHmPnaaqqKmyu+C8n6OtraSvwMXMzsvHwbu1s7a1tq+w
v7CTfIOGhoOBf4B/eHZ8dH2KkpigqqyopKeooZaSj4qGj4mGiI2Uk5GLg4J7cXF4hqGmo6eqqq2s
rq6pqqmqp6GjpqGgoKChmJiVm6Ohp6Wbmp2ThoOPmJ2TlJWRiIF/fW9pa2dmZWRrWVVNRj49OjlD
Tl10goyVmJaXmpiYmJqcl31wbmtqZ2RiZWdkXVlkhn13enyAf4CCe319eHt2c2ttdGtlamRQR1Vd
XmRiaWlqb3R0fJOtnpGPiqmfhoCNnJaPkpeampWYoZicoZ+doaiqqsPIwcXAw8XEw8DAycnFxMjI
yMXFurq8uqiIa1NVcYaUjo2TlZGUp6CUkZaWo52hpJ+gqaqnp6mno52RgnhxeY+UmpufoKOhnJuY
mJ2dnZ+do6Oho6ekoJiTnJN9alxcXWJiYl5ZV1dSPSwmKC85Vm5ud5etlZafrqCdn52amJqWlI+N
j25eWVxidJOdoaeqqqGpoaSelIyPlpObm52gnqGdkpSRl8OmjJSOj5SWlp2foZiao6agm56WlI+O
eGVlaW93dHp4f3p/gYSNhImYhH99dnRwbmZmYmJhXWJlZHSEiIaGgYaFhoaBfXlya2qAgHp3e3p6
e3p7eHRydnd5eIaFipSfoZ6joJufpKSem5ycoaGfoZqjqqehp6WmqKGhpqWloaCcnJiTlJibnqOo
o52hqKmoqKqurKSlpKGdmpihkoaWscK8trzAyMrEv8HDv8PAwsPAwLy8vNfKxLu2tbO3tq2praqg
iomsurGoqamqqaSfpYtSQkxUWWJub3d3a3JpYFZKPDksLjA3ODg4Oj49REI9QERNUFlie5eamp2q
pJuWk459aGJ4jpylpaWmqamkpKqsqqOjoKqsn5WPhYZnVFldcZS7ta6ut7q7vLq8vrq1try4srCq
OTQ1NTU0NTg1MzQ4NDI1ODU1NDM1NDU4QEdLUE9QTFBWVFVVUE9NR0ZBODU0NUNNWF5iYmRiYmJo
bW9rbW1paV5bV1NPTkdDPjw7PkRANzUuMDUuKyoqKzM1PkVbiKp3S1BYTlNuhYmCeYGFi4aIiYiG
hH93eHR0cnR4gI+Xk5KNjZKVl5qfl5SVjY+Ri5OPhH15gHRybmtoYEM3NUdif25rcHR2gHx9eXuC
hIiGhomGg4WWqr+8pJeXnZuanJqWmJScmoB2f46CgX19g4GEg394dHd0eICCc2dlZWdnUkxPUk9S
VllZXGFgX19ic2VfZWF3dIaJhoGNgnh9fIqIalxeYF9gXl1VQCwrLjQ6PUM8Pjo6Pj48REtUVVRY
V1VfXVRUV1RQUE1HREBAVFliZGJiZGZgXl1gZllbXW1fWWiMhmtla3R4eXmAfHp9e3h8fX17eW1g
dIZ8cnNxcm5va25tZmJdVlJTVE9QTEM0LCk0REE+Pj5BQUFGTEY9PERYPjo9Oz47TlhnW1lgYmRp
bm1vbW1vbWttb25pZ2JYVlhYX2JgXVVNU1tdWFlMQ0E+Q0ZFRUlKTk5XerexVkpQVmR0dHNwdHx2
a3Bub21rb2h5aV5eXmB0dmFca21tcXRxbXBwcnFtaWtoaWdrbXBraG9nXVRUVl1eW2FeYGBcVUtT
WFJQVltZSj5ESU1PUE5NT05PVFBQUFhWWXhmXldSTU9UWWRxVUZFR0xPUFBSUE5MTU9WUEpLUlNe
ZWJob3uCiIaBg4SGiI+MhoaOjYaFfXp2bmhrcHR4eXR2fXl4fXl7hpiqqYF3eX15ZVNSc3x3b25n
XFdVXHB0b3R2dnt9fX+FioqLhn10dHd9eXeRlnx6fICGhYiNjo+WnKOnpZ6eoKikp6qtraako5aG
gYGEgIJ9e318dmthXF5xlHNna21xc3hxd3Ryc3NrcXRzdHByeHNzbV5STElCPj5HaGd/eGtqb3N2
eHR6f4KIj4yMioqLjo2MjI2PlZWWnIh9d3R6dnN2eIN0a2tpaGdlYl1lcoaMmKCcm5qXlpKGfXdw
dniAhYqRm5ubnZ6gm5iSj4yLiJOGfYJ5c3OAjomFhoF4dHR3cWdudHJzeYOElIN9fHh2eHZycHl4
cXNyb29vdHR0dHx0eXh3eHZwbm5ucmtkX1hTVF5wcnR0cHFxc3h0dHd7hZSemJaSkpidmJWcnpqa
n56dnKGjqKOsqaaoqKmnqrKppJ6NhoF8f4B0aV5gYWl0enuEhoqLjpWor56VhoaKi4yGcGppYk05
NTU5PUtXWWqBU0ZJR0dJUF1zd25mYmppZWFiYWVZS09hf42PlZifmJiboJWUlLW4enFtXlllfX19
gn2CgYJ7eXR0a21tb3R0e3t8gZZyZGFmZ2lpamdqa3BnaGllYllEPkZOVWt3bmJfV0tDRkxQV2Vk
ZnBvcH13enRwb2tqaG5xa2tvbmZgZGhrcXBydnd0eHFyaHBqZG14dHR0c3N0dnd9gH13eXpyb3J4
fY+EeHl/ja6hmqSknp6aoJ+gxcWelZiRgHNfUE9VYmpxcXR7e4CBfXyAfYGBf3lrWVRZXFlUVVlZ
V1lXVU1FPDc3OT1GREdHSkZHRkVJQ0BER1hOU1ZYWVdcWVZYWVVZV0tCQUlXZWtobnB3d3x/g398
eXZ3fXyCfYaVko6XmJ6dj4qOo6mxt7nCyODMu7jCw7+3sKyPdG1qdJWoqq+1rqinp6eck4yEf3lw
ZmVqbnt9dHR4dHR0dHR5enx2dHR3fY6gqqqppqqttbGqsLO1vtfiw8XLw7+/vLmzrbO4sq6tpZiG
hYaLhouFg317f395gJOYoaSqp6mqqqGdm5ORkYuOl5iGjZWVl5OKnY9ta3aOqK6oqq+vs6+qqKqp
qqekp7Cspqinn52bmJeYnqOnpaGcmJGAeX2OlZSPkomFfX13aGZnaGZlYWJgVE9OTU9MR0tPXnSF
jJaYmJyenZ+dmpyPeGdnbmloZmVlZmpfX2V0d3t9enp4d3h9gXp3eHZ0cm9qZmJiYV5PR1ZSV2dt
ZWVpc4CXtsKgkpSRj5KDhI+Ti4mPkpOYmp6wrKywtbWyqq+2w8fCwcDHyMXExMXFycfFxby+w7+4
tbGupIxuWVt2jpqLi5GRl5aTk5SPj5SbnqGgpaeqqqqmqaWfoZuVhn+JpKSenJ6hnZqampybm5+h
oZ6lqqqmn6OhmpiYkYJiXFxfYmJfYF1XVlJELycjKS9KaHZ7hpObn52mpaOjoJ6cmpKWkYuCaVlU
UFZicoqkrKeko6aflpKRjo2Mi46UmJeWl5uYqpeMxKWJhomYjY+VnZ+soZ6go6CampuYk4+GcGVo
cXJ3e3x6fICCgIaEjI+DfXd7b21waGBhYmRpZmJpfaSogn2CgoB/g4SAdm1tbnODgX2AhIF6d3R0
dHl9eoGAhYaNlqChn6ChoZ+epKCgmpqan52Ym56en6CgoKGemJeUlp2YmJGTkpiWkpWbnaGhoaSp
raqvtbOvpqSjoaSmmJKNi5axubi7y86/wcXLycTBw8G/yMfDwr67w8PAvLu2vL64sLGsp6Gapbqz
rayxsK2po6GfjlZBTF9mbnyAfXlraWtkXVtNPjMuLi8wMzg3O0FCPkJFQEFFT22UnZ+dnqSfnp+c
lIhrdIaXnaChoaanqaqppqOhoaeopKmglpWRgGJZX2JvnrOzsLO3u7e7u7zBwcW8u7awsac6PDg1
ODk4Nzg5NTM0MTQ0NTIyNDI1PUdJUFJQUldXU1ddW1lXVlRQTEdHRUJHUFNZXWBgZWFmaGJna29t
Z2RiYl5dWExMTUNAPjw4MjIzLy4sLzIxLiosOk9LVmWGm4J3X01iWVR6moh6gIaKioaGhYWIhIB7
fHl2eHd2iJGOi42WmJuYl5KSjpGUk4yPk4uOjnt6c3J9g2tYVFZbgHhqanBxdHZ4dHh7hoqIiomJ
hn9/hIagsKicmJeXl5yYlpOYm56bn398fXx7dpioioaDhIOFhoaGgn2DfXBvcW1uc15QTVNVa3lf
XF5ZcHZugHRgXl1ke4qLhoaGhIB8ho9uYmBfYF5hYmBZUzsuNTk8QllKPkBCRUJASVBVVmBkYmRr
cVlPTlRPRkdDQUNSW2FgYWBbYmhdYGddWV1iWFVUVnCIcWhtdHl5e3t5eXZ2d3l3cnmEamJufX12
eXFydHFwcGluaWJZU1dVUE1MSTwsKDdCQEdGQkBCQ1ZhSzs6OTg1OTo9PUlWa2teX2praWtucXBu
bnBra25rcW5rZFxZYF5TYG15WVt4fFtTV05BQ0FOSkZLTE1MT1Jty7xhYll3dGVua250a21xbmpo
aG9wYl9kYl9fXWFeVlxvfXFydHFycXB5gHhuZ2lraWVobmtrZllWVlZbWVxeYGJiYVtTUE9MT1VW
Vks9QEtKSU9KR1BSTExOUFRWVFNUWz4+bltOSk9XXVdHQkVFTVNST0tNTk5QT1BMSUdUWV1mZmhr
a3qGhoGGhIWEiI+PiImKhoGDfXFpbnJxcXRzdnt7eHl8g4KRj5S7j3R5fX1vYUBYbm1rbWRdUldl
fIZ4cXd8gH2Af4SGgIB/gYF5dIKLf5SJfH+DhYaGiIqMk5SeqKejoaGqrKqtsK6koKGhn7OhkouO
kXpxcW9oZF9fX2Jxamtua3F0eHR0dnZ0cG9uc3R2dHJxdGpbXU9BODUyNzg9SmFwaGVlaW9yd3d3
fIKYsY6EhouPioaNkpGenZGRj4F7fHh2dHJ0g3Z2bmp2a2JfYmp9lZ+boJyal5aXlo2BfXRzdnx/
jpiXnJucnpqYn5eWjoqGk46AfHRycI6TiYiDgoF8dHJzcnN5fYOLhYWtlnd8gn2AgHh3dHl0bm90
dnN4dHhzd3p0d3d5dnN6dG9ycGRbV1BTWWhwc3Z4d3hwcnZ6d3l9hpejmKGTlpybnp+dnpyYmp6f
qLOqp6mqqqypqq+qrayhmpKLf3l0eHdqYF9ianF4fIGFiYyMjpaqkYWLj4yJjIiAbWJeUD43OFVS
VFlbZm9bSkpEPUNGTVl5dGhzc21tam5xcW1nZHCBj5GYpp6Pk5ublJabp4xya2BSU2d3gYaCgoWG
hX95dGRia3J2dnd7fYKAjm5YXWRoZGhta2ttj3lmYl5gWUU3O1JkbndxcGliWVhZV1JYX2JwZ2Zp
b3h6fHRpa25ob3Jtam9ramdla25rcXR0dnp0b25iamZhZGprdHRua2tzenp2cW5yc290fX2BiIB9
f4iLl5+YlJabmqGel5ukrZyPioyDc15UVFliZmtoaXJ9iX15e3l6eH9/cF1SUFJXWUdGTFRQUEdB
Ozk4NTU5PUdOTU9SUkxQT0pFRkRHSUpOUFBVU1VUWWRZV2BeW1dNVF5mZ3F2enh7fYB/g32AlHpz
dICAgIaMkpSXmI+KhoaVoKmzvL+/wMW8ur68vrappJF2bnl0iJ+mqq6pqqWhoZyViIB8c2trZ2pt
bXJ3eZWEfX1ydHd3eHl6d3eLqri4p6Gkp6q1ure2u7zAwsjL0M3Ewby2s7i3uLOvqqikoZqSkomC
gYWDf32Af3mDlZuksbKnpqqlpqGalYygi22MmImMmKeej4aEeXBxeJWzsK2srK+2sKqqpamtpaaw
raCgqKCcnZuamp+dnpygoZ+Xqoh0dnmJmJKlg3JqZ2JgaHZhXFlZWFRVVFNQUlJTT1BZbn2Gj5OX
lZiWlpaTlYBtYWJhZWlnaWViYV5iaG18f3h6eXZ4eHh7fH16bm9tbW5oZGJnZ1dKRkFOU1thb3yG
mqauqrikmJiTk5SRj42XmJOUl56brcvAwLy4trq4uLjCwr6/x8vKxcPDzMvHysC+w7y7tq+xsaqd
g3BnZH2GhoqOj4+RlZiakpSYlpOYnaeqrKmurrOvr7GtppqNkpegpKamo5+ho5yYmpiYl5+hn6Wp
p6afoJqVko2NjGlbW2VqYV5cWVdVU080KyYsNUpldHyJsKiXlJidoaGhpqqelJOTjYh8emJVUFNk
f5qdn6Wpn5uRkpKPjoiGhoySk5SXj4+jj4iLhH+EjpWYlpeUmp2kp6GhpaCfo5iNjIt6a2twcnN5
ent9gYOFf4CDg4F2dHt8fGtiYmZra21vd3R9mJyFg4qGhoWGgHxycnNwdHt7fX99eXx9enx0eHp4
f3mBiZSUl5qgqMS8oZubmJqYm56XkZGSlpalrZublJeYko6LjpGMiY+XmJOWm5+en56do6aora+t
sbayr62pqqqll4+Nk6e8vrvEy8rKycXHyMnCyNPHv8XBxMXCwLy5u7i1uba1s6yko6y4uK+qrqyt
sq2ppqWaYlNdaXR8f4SAeHBoYl9cVlBLOjEsLi4vODc4Oj4+QT48QUVXiqCfnJ2dn5+eoJqRkXt7
i52hoaGmp6eoraalpqSlpaeqqp2Xko6GZ1lbWXGhr7CzuLq3u8LCvLy7xLq2ubOyrjQ1OjU1ODU1
Mjc1NTU1MzU1Nzo5OD5FREpQT1JYV1lXW1VUWVhYWFRWT05LS09TWFlgZGdoYmRmaWlqa25rZmhi
ZGRuXkI7Ojk+OTUyMS8wMC4yNTQ4Sj47PkJJdKemgG9mVHeTfX3Hn3l8hYiIjpSJiIqGhX15enl5
enh3gIuRkZKal5aXk5WUj5SSko+RkZePg4Z9dnFzc25XUFR0dHJxa3B2eX19fH2DiYqMiYWGgoF/
fYSKkZOUlpSYnJqbmpyemqO2g3d7dnh9iomGjYiIi4aBhY2MfXR0dH12cXFqXk5TWFyDeH12XXCp
jXeDhn1rZXeej4aDi5+hgXmOxYNYWWBiYWJgWVZQVjo5OTU1OTxCPkBARVBGS1lfXWFlZ2traGdf
UEtEREJGTVtbXWFiYWRiXV5dXGBcXFlVWF5qcnhzb29rdH16d3R3eHR5dnp8bV5WX2d5gHp5eHd2
dHFucm1mYl5bUlBQTUdERk45QkY+Pj5BPj5EV0xJPjw+QUE8Oj5EVFVib2ZiYmmBhXRxbnNxcGtv
bnBzdG1lWVVec3RfW1xVXmp4X1dYV0pDQkFFRkpNR0tTW2txX1ddd6p8X2FoaIN0bXBna2tpaW1n
YV5eWV5YVFdebnR2d3d3dHl2eHh7a2hoa2poZGtwcmliVVJVWVZbXl1cXFxbVVBOTlBOUFNQRz4+
Q0VQT1ZST09TUFJQVlhSUE1ZYj1DR1BNR1JQRUBAREVLTkxJT1BPUFBQUk1JUFZYXV9oaWlucnmD
jIh9gYyIiImPjIuIg4R/c21udHZ5eHp7fH18f3+AhJWXgnl6goCBdGpQMThHTWJ0bV9TWXeBjYh2
c3h9fXx9f399f4GChXRra3KGhIB9fHx/goaLiIiRmqCkqKelp6yzsaqqqa2ppKWjqqmppaCahm9o
b2pfXFxiYmJmaG9ucHFxcnd9fXNta3Bvb3R6dGtiVVRNPjEuKCcpLDI3OkNWTk1ZanuJf3ZwdIqK
iYaKiIaLiIKIk5aYoI6TkYF6eHd9fHN8dnd0aWptd3N6gpOaoJ6mqJ6Yl5OTjIJ8enl/hoiVnp6f
oJ+fpKGdmJeVj4uAfHt7c2txg4qKhYOAfYB9en2Cg4GGiIqNi4mGg4aIf3uGg3h2dHNwbnRrbnR3
d3R2dHh9enZyb21wbW9uZ2ZgUlBZZWt0dm92eHR0dHN4eYCGj5KVoaCWnZ+XmqGgo6Cgnp+sqbCw
rKeqsK+pqq2sqaefkoV9f3d0bmZgXl5rd3R9goSNj4+SlJGPj5GPkpGPjH1wZl1VQztNUFhgYmFi
ZWRhcVg+PkBHSUlVanp/gX19fH2BgIKBgomamJeYmpygnJqUk5eGdnBvX1NZcXyGoYp9goSFhnx8
Ymdrb3B3eXh9inhrW11gZWpta2tra2tpaGpwaWFcRz1FWGpzeHh5eHJnZGdmXVtfanxnYmZrcHJx
b3Bvbm1vc3N0cWtpampqa2txc3R4endtamVmYWFiaWp0cm1qbW9tdHBrZ2hwcXF3fYCBg4WDiIWG
i5GVlZujoa+dm5iUmJeSf3RoW1VQWFlgZWpvbnuMe3mBfXp9gIBmSTxBQ0VQPTdARj49QDk1MzQ4
PEBDTk9MS1dQUE9LTEtMSkdGREVHTkxNT1BQVVZWYmtmYltgYmtyd3d3fYCBfYODeXt/d4h7en2B
houSlpWTj4qFgoWWqra8wMTFxMC/yLizsbKcgm1tcG90l6Whn6WvsaCcm4+Ignx0bW9vcG9ydHZ3
f3yEfYB9dnl6eH17eYqey9GtnqSos8DBur/DxMnEycnO0M3Jv7m6uba3t7azsKy8yrWol4R9g4qI
iH+KhI6Pn66qqqyqrKqloamnjoFxW2pxpcTI5vC6b1xka258o66urbG2qqmop6eqp6Omp6enpKik
nJicn6GalZiamJuYmpyNe3lxb3d/f39uZFlTXGZcYVdZXVtXWVxZWVxbXF1cVlZifIOKjZWRkoyK
ioWGemldX2FiZmBiYmBiYGJib3t4eXh4eXJvd3hxeHxzcWtpZ2ViZGJiYFNDPkNHVWJ3iZGTnZ+g
qaOfmpaYmJiVi46Pjpygm6q8vKqywLq8vL6+u7zAwMHFwcXNzMXFx8XDvLu4tbe8t6qln5OBcW54
gIKGjJGWlpKTmJqYk5SWlJqmp6Oqs7Gwr66qs7Owpp2aoaGfnaOpqKihnp6bm5qdn6CfmKGhoKCb
mJSSjY6FYVZZYm9lYmBdWVBUTDIsLjI1UGtxeY/AppSVn52Yl56doZqVlpqYlIp9fZdyUFJ6iJGX
oZuUlJONj4+LioaBg4aLj5SKioZ9fX+Pi4uXmKCenZiYnaajoJ2mpJ2enpiWm4x0a2dtcnZ8f32C
g4OBgYB9f314c3d2aGpucnR2dnd9dnqAhoWIgn9/fHqFj3hycHNzfYOEf317e397e319ent7f4GL
lJehpqGhrKqjoaCdnp2XlpeTlZuNiJeujIaGj6CKgomEhoWDjZOdoZyamJ6fm5+hoKSsrKqqqqqn
p6OmsKeblomNnrK3vLzDwsTHy9DKy8vBvsnJx8fFxL/Uwrmztry+uLmurrKwqq6vsLCzsa6xs7Op
oZZ3aW10dn2FhoJ6amZiYF1QRT46MiswMDQ1ODg4OD1APUJWZYKdoJyYmKGssaqbmJyXg4iTm6Gc
oaqpp6GhqKqsqqGho6qnnZqPj5WBcndwfaayqrGys7m2tr/EwL+8ur63rK2pNTU1NDU0OTM3NTUz
Nzc3NTc0Oj48PkdLSVBTVlhdWVlYWVtWV1xcV1dTU1BOUllbW2FiYmJnZWZnZ2dpaWtmZ2dmZ2ZM
PTU0NDQ4NDIvLCsuMjk6PU1rUDw6RV1/k2lMR05VZWBdnoxiko6GjoqNhomMioiDgIB9fH9/e3d7
gImPj5GNlZaYk5WXmI6PlJSTnJqMfXx7dnFqZVlSUFd4cHBzdHh5dHN2d4KGhIWLiomGiYJ3bnGF
jI+OlpSVmpuYlZKXo6B8c3J0dH+MioqMiYqGhYaKiIR9fH17e3l0bmZoXlVVaZ1xZm2Gi4qDgYSR
lpqdkYmGhoaJu9SPd5ade2tiZmViZGFeXVlfRTg6MzpAPkFBREdKUFRYYWlkZWltbWZmaGJcSkND
Q0NOXV9lYl1dYmFeX1tZWVldW1dhc4OPpopteXJwfHh4eHNycXh4cWtZVlhZZ4SCfX96c3B4d3Z5
dHFtaWFUTk5PUFZHTFdNRkM7PkFAPj5BQ0dDQkJGUzs3PVtZYWFdW2JoZ3BxcXJwcHqJdG9vcnBt
bmRZUlRcYHRoYGRiX1lfZWBiZUo+RktKRkxMTFBfdFhPUHCYoY9hWWVqa2llZmJnamloaWJgX15c
WVRUUFZrd3d3dHR9jpt/eXRnZGZvcHNxcXR0d11OU11bXV5gWVlgcnBYTEpXUE9PUE1HQUFOT0xP
UE5LTlhfWFVQVFdVYXJuamBTSjUwNU5XUElHSVBUUE5OUFBQT09PUFBUW1xgYmlraW10dniEj4uB
hoyLiIiMioaBfHRqaHF4eXRxenl5fHl3gYGEiYV9io99gIF9ZUsyKSo3VnJ3YlthfYh0b3h6hYJ9
fHp4gYGAiI59bm90eXt9fX+Dgn+FhoiMjpWcpqSmqqypqrq6sKqprK2qpqisra+/qZuRdG2Ef2hm
aWhiaIF0aXN0c3Z2dHd7cmtpbWdwgHx0X1hSTk5BMyspJSMnKissMjU3QlBbZG5vc3l5e4GGhoWE
ipiIfXyDg4aJhoiBfX+OhH2GdHt9d21tb2p4g4yYp6OhnaWmoJuYlZiRg32AfXmAj5idoZ+hpKGd
nJudtamRhXp4eHpxc3GBioSCgoaEhYSEgoWJi42JiImGhpSLhIaIhH+Be3Rvc3Bva21ygn1xc3Nv
c3NzcXJycnJweIBxbmVbWWBtb3Zyb3J4dHZ2cnJ4fIiTk4+UmJWXlpqan6SdnKCboaGqsrWzta2q
rrCqrKyqpJyUgHR0c3NpYlxcZnN3fIGGi4qMj5GWlZGPnJKOj4yGhHFeXltLR09bZGZmb3Nxa21r
c2JVTU1NT2B9lIaLj5SRi4yKm5SCgY+SlJ6hoaCfnpqcnIiFenBhVV1ve4OLi4iGgoN/eWdfaHB2
fX16fX17cmtQVV9iZ2p0a29wbmRmZ4Z6XFdMSV5maW93en2AgnhxcHRuZ3BtcmhkZmpucXBvdHpw
a21vcXZxcHFramlraW1zd3Z3fHRva2poYl1hYmhrb3FwcG1qbWZnZm10e3p7fY+hi4aGiIqKj5SP
mJeVk5KglZORj4Z4a1tWUlBZYmRqbmRma3Jyb3d7irGUYkIrKjIsNDI0N0RCOzk5OT06ODk9PklL
TVBMTlNST05OUk9KR0dJSUlGSk5JR0xLT2Bram1iYmtucHR5g32Ag4aVhniBgHR0hnt6fYWGjZKS
mJiPhoKBfZSqucTFxcS/vL7EuLWws6SEd25rd3ODmJ+hqK6lo52SjIR8dHBta21xcnJ0eHl7fX15
g4mJe3t7eHd9hIvF48Kem6q7yMvEyM3Hx8XEzcrLzse+vrm2s7vF4LypssLBxMKylYqDhIqFk4N9
pKqtsK6urrOst62gnqOSg2tVWWZ0iKjB8dVpWWhzdnyep6qmuN6+oZ+mqaqpp6SooJqhqqidmpyd
pZeOkZOTkY+OiHxxcG5rbnBua2BWUE9ealRSVVldYV5dXWJiYmFlYV1fYnJ7gYSJk4+NjIN0bWZk
XmBhYmZiaGZiZWZkXWJtfH96dHd2dnx8e3l4dHR0bW5uaWhmZWRlYU5FQklVZoCPlpyhpqmhpKGk
n52bl6mlioiXzNKsp6+zt7a8wcG+v77FwLy8wsLDwsXDyMLFx8G8s7OwrbDDtpGAenRycXuEf4aJ
iIqMjJOVlZSVmJKUmJ6nqa+vsK6wrqysrrKonpWTnaGkpaehn6akn5uanZygmp2hn5ubm5iWj5SL
j4hhVFhhYmZiWVxWWVZLOjU5NTVNZ3SAhrCmj5OXmpyYnaCfmJiWlJiplYaNropfTV99j5idm5eW
j42PioSChoV/gICAhYiEeXJwcYaOlZSWmJ6gm5iYnqenpqekoJ+emJiUj4JubXNzc32FgoCCiIB8
fXl6eXZ3b2tvbnZ8eHh9fX17g5aGgo2KfX1/e3x6dnZ0dHZufYSBhoWBgn99fYl/gIKLhYaTnJ2d
npigo6SjoZ+elZKSj4+YmIaChIuEf4GFi3x5fXd8f4SJjZKYnqScl6GdoZ+hqKytqK2prKyppaev
npqUi46Tpbi7vMLCyszOy8zHwsjLzMrFxdLLxMW+vL68ura4vLGvs6+pr7Ousa6ssrKuqqehoY9y
b3R9fICEiYF0aGFdWVNPQDUvJiw1NTU3PD48PUVMUGJ/sKWVlJibnqmqoaCbmI+Ij5GdpKelpaOk
qqaqqqqpqqqln6GflJKPj46LkoaNoaSss7Oxs7q8wcG8uLzAubCtsrM1NTI1NTU1OTczNDI0NTU1
OD05QklHR0tPT01UWVlZXFlXXVxZV1hbWFdbVVNUWVlgYWVhYmJnaXBucHJta2dnbWRhXko0MTcz
MCwvLy4vMTVEQz1APj5CRUVeWVVqX11YTEdHS1iaczRgio+Pk4+JiIaFhYOChYN/fX17eHd8f4GG
jo+Rk5OamJaUlJaYl5OPk5WJenZ9eW9yVFBYU1xreHBxcm9xdHZ6gIiOjIqGgoGDhYtSO11/jZOT
l5WUlpeam5eWk4JzcnRwepePjo+JhYmKiomRi4GAf4GNg25lZWtmXFRedmh4gouKjZaMio+PlKCf
joaGiYuhu5WPgIZxZmtoZGRiXl1eW0k1NDU8QlZbVVBOUFNZX19fYmhka3BtZ2tnZ2JkU0VDQ0xZ
YF5cYGJgW2JgX2BdW1lZa31ybYKLdnBzcnl9b25ubW9ub2lgZHNoaW19f3p4fHt6eHZ5c3B2dG9q
ZFJNT01KS0xJR1BQR0NCQERAQD5ATUc8PUFdVkBBV19ZXV1fZ2lpbntva3BwcoB9b25qaGZlXVdU
UllXX25iXV1ZWV5bXmVgW01HTUtGRUpNXG2XZU5MV1lcaGVkZ2pqaGpraWZnaG9wZWBiXl9WUlNW
WHBzeXd2d3qDhH97Z2RlaGZubmtxdntrXlhTVl5ZW1tbYFlXXldMTFBQT09JPTo9Pj5HSlBcVE9S
U1ZiV1ZWa2J5qnRrjIFuXk9vgYpoYE5ER05QUEtOTk9PTlJQUlBhZmZmZWprbmlna3GEl46OjpGX
nJyWhXRtam1xbXJydHh9fXqAgoKAhoaVrY5/fX1/kYtiSzswKTNQd31qYmpza29ycneUiHt7fXt6
enqBqZxtam54e3t9fYCDhIiChYuMkZado6Opp6qsqq6vr6yqqq6sqKypqqyonpGLeYCAcWtra2tp
a2twb3N3dHR2g3t0bmtqanRzYFVUVlNVXlBANS4oIyEjJSYnKSs3S1RWWV5ma21tdIqNjo2JioaD
fH2BhH2Cin97fJ6bgnRxcnSEdm5rdoGOk52oo5ugn6Ogn5iXmJOGgX16f4uUn52YnaGkoZ6foJ+2
oY2GfHZvamhtcXmFgoGCiY6GiIaMjpORl5OSjY2SlpKOiIaBl494dHJyc29uc3R0eXR4dnZzdHR6
d3J2dHJ4fH2AendydHR3cW5ydoCFiH14d32DiYyNlqqvmJKWn5+bo6WnoZqmrq+trbGxs7Opray1
uLGonpR/fXp5d25mXWJud3p9hIiPj4+Tk5aYk4+WkY2MiouNdmltV0ZDT2Z/j3t5e3l3dG99cmhn
YF9ia4mVj46SkpSPkZK1oXp5j5eXmpucnp6doaGYlpWEaWFZW3qCfYmsw414fX9yYGBuc3Z6dHd2
eHFrYU1VYmJhaHhpZ2pqYmJkamRcW1ZgZGt3c3R2d4qDfHd6fHJwfW1hZWlrbm5vb29xfXJpZmpz
cG90c2trc3FrcHF3d3h5gYJ7eYyXcFlfZWJqbmpmeWtlYWVrc3Z5fH2Cj5SIgYWGiomKjYySmJGR
k5SOjo+OhntoWVhWUl5pYWJmbmZkaWhrZml7nKFHIyMjKi8xMzc6Vks8NzU1QUA6PUlKR1hZUE9Q
Z15QTE9NTUpKR1RTR0VFSUZGTEtSaXFzb2dveXFzenp/hIaGiZGJf4SBcXRvb31/fYaLj5SSlqSV
hoaLobC2vsTEv7i7vMO5rKq4pnxnZWduZmmCk5ihqKSklJOKgn9zcW5tcnF2d3d/gYWEf3l6f4yC
fIB9e32Djq3Nxa2lqrvLzczHysPFzczIys7Vw7++vMC8vL/Cu7q+xcfEwry2ppGKjJGNhYauxbGl
p6qsraqkqrGbko2IdGVfYmBZV1lmbmlrc4CLk66qo621t7O8sKajp66upaCgpqGbk5GRl5WChoyP
kYuOjIR8dHFycnBraWJeWVRQV26BWVBVW2BeX19fYmBiZmZiZGh3fX99goqNhoJ6cWJQVFlYW15g
YmJlZWJgYGVhYG13dHh6dHR8d3R3fX10e3hwaGtraWJhYmZiWUpFTlhwhIyUmJ6qqKevsbehnJue
m5eGgYihxLyvsba6t7vCxcPEvrzCxMC/wcTJycnDwMXCurOsqqmom5KGe3Z5jYVvfH+Bg4aNj5SO
k5OLk5eTlY+Ypqmlqqioqqiqraqvraefj4yYn6WopqWlqKGdnp+bnqCfnpyamJeYk4+Oj4yEc19X
VVdWaGJZV1VYW0pAPDg7OElwe32Dj5KSlJSWmJykpJ+epaaemJuRjpGPioBuZXeJmJiYkY+PioaL
hoV8f319e3yBfHJraW97ho+Wm5+Yn6Galpibn6OorKShoZ2bmI2IfXFvcXR0fH97fH+Ef32Ed317
dnBwb3R0iIR4en19f4GEm4Z6gX17f3p9fH16d3lxbnBzdHyGhYWDioqFhYOAgoOGiqGmm5KYnZ6d
nZ6cl5aSlY+KhouDfXt6eHlvcHJ3c29vcHmBiYOGiJKYoaSYm6Olnp6hqq+uramkp6mqqKOdnZiS
jpGgvMPHwsPFx83OysnKztDOycnLzcXFw8HN0b+ws7Wzs6+urayysbW5t7Kyr6iooZqbhXN3fYOE
hYaKiIF0YlxZUEc+NC8rMDk5OzU3OTpDT1tmcqCsmJOSnJqdnp+enJ2XlYqSmKGnpq2qqamopain
pqijn5+koZqYmpKPlY+RkpSYoayutra2vr+6wMG8ury+t7iyqjU4NTQ1Nzw6NDIxNTU1Nzw+QD5D
RkVHS0xSVl5eXVlYWVlYVllcV1ZXXVxZVFZcYV5hZmVtbWpna3JwcGtucXBta2JcTzw5QD0zLDI4
Nzk7PklCQEFFRUpoU0pNU1NQTklNTEVEXqWCQEtno4+NiomPjIuDgIaFgn18gXx7fHt3dHqGipKa
m5iYmJiYnJiYl5ujnYaBd3yDemtXWFlZXGRxb2tvcnBzdnZ5gYWLjYuGhoV8c2s5Pm+Mj5GSk5KV
m56amJSdkXNqb3ejlYWGiI+UjYaKj4yXg3t9gX19c2hpZmVffW9rhIiJjI2Oj42Lj5inoJ6KgYiN
kYiFiH+BhXF5nIVvZmliXltVUDwxMjpdfZVkSk5TVldeZmJiZmtramlta2liYmFXUEVBQ1tmZGFf
Yl5dYWFbYV1YW2VtcG1ua250dHJ0eHN0cG1uZmdlXl1hYWJiYWd0f5uReXt2eHhzdHd0b25nUExG
R0lLTElLR0xHS0dESkxFPUFBRk5Via6oXE9SWV5eYGRiYGhvcHBzb21xd4R9cXNtaGRcV1dbW1lb
WF9yeWVdXmBdYGFwa1lVVVhWVVZZYllSYlhXWVlZW2JqamZna2poZmhmamleWVxeXlZSVFZWX2dx
dHZ2c3R6enFiX2Rma2tuc3RyeHl0ZVhUWVlXWFhbWVhVWU9NUlVQRTA1Pj1ARU1MS09TT1BQUF1c
V11va2aOdnSWqp+Ge3FoYFxcW2BQTExJTE5QTU9NUFBZV2Vram1pZ2hlaWdiYmdwfZ2ooKGckoVt
ZWdpaXF0dHN4enx8gIaPn4+GfIWTgn99hImXk2FKPTMwMDVTaWBggo9vb250d3uCe3p9eXh8gYGD
e3R0eHl7eX19f4WDhYuGg4iKlZucp6qqp6yxs8C4rbGwrqeqr7OuqKGclZWJd3Rxd3h6entzbmtw
fZKBcXF2dHBua2lpb2tZWFlcXGJxYFNQRjg0LywmIyUlLDNBS1dbWVliYmRrg4Z/fX2AfXp7eXt7
e3yChXx2dHeOnXNxfWlma3KAioaNlqOen6apraqenKCzloJ/f32DjJWcnKGen56fo5+dmpqXlJF3
amtoa2tudIaFgoSKjYyLkYyOk5WUjpOUko+Pj5yPhoCKgnd2eG5tcY16cnBwcW9vcnl0cXN0cHOC
fXZ0fH2Ae3p7f3x5gnRxcXd9eHuEhYCBio2TlZeYmJiepKivrLGxpqmtr7Gyra6ysaqmp62vqqef
koSAeXdxZlxfZHB3fIGFi5GPjpKhuJuVj5KRlZKRiI+GYFtQR01egIuLhYB9g3+BfX2GenJpZWd5
jpGTmpiampSTl5eKfXmMl5uWmJqgpJ+Yo5+brJZiWVlccnyAgqiyiIOEfGtiZ290dHd6e3qBcWFV
TlJiYmhyZmVlYmZtZ2JlZmRlZm90cnl2e319f3d6eoGGe3B0cGmAemtra2tucm5ubW5xd25paXF3
bmlpaWtrbWtrcHeLjYB9kpWAbWtrYF1gYmdraWBkaW92eHt6eoGAg3+BgoSEiIiNk5GNhoaNj5OP
j46Bb11YWFVXWV9iZmdxa2RibY5wXFxTOiUpLC8sMDI0OTs+OjU6PEI+OkNAQ0VNWFZPT1B5a1BS
UExQTkdJT05NS0tDQ0VNUl9ta21zb3F0dnqBgoaJhISBj4x9fXZ0cm9xfICGiI+Rk5SRlYuGk6ez
uLm+vru8t7K2tq+trbOliG9iYVtcZGl0iJinpqCWkYuCfHlzcG5zc3J6fXt6goSDgn2Fgn2FhoOD
hpGOmM2/l6CwxM7Hzc3Kx8jIysvHxcnDvLzA08W7t7m4u7/Dyc7DvtLKnZKVlpWGgJ3RsqGpqqmq
rK+qqZiNjXx0cHFfVU9STFRZYWl9ho+VnZ+nqaqssLGnoaWnpaaoqK2tnZaNjYN9eWtvf4aBf4N9
dnFxbWprZ2hmYl1ZV1NVWVlQVFNZYmRiYl9iZGJkYWJld4J/hX19gpGFcGBURkRGUFZZXGBoZmZl
YmVgZV1cZ3R/enl5eHt7eHh4dnh0e4ZzZmVraGZkW1lbTEdNYH2MkpWYmJufsK+qqqGam5KKhoWD
ipKhsLW1t7q/v8LEvMPFw77AxcfBycXFxb6+vLu8sqyempZ7a2pqbW1ta21ven2Ag4iLjo+hlZGU
lpGMi5OprKWgoKSkoainpqmvnYaFjZGeoKShp62ej4yWmJybn5ybnpyYlY+NioSAend0YVZVVVdf
XlhZWFlWRkBBPkE9RGh7fYaXo5qTk5ebn5yfo6insaefoK+Yj5yXiYV4cYCRlJWNjI6KhoaEf398
e3x7dnlxaWZeXW6TmpOUm5yhnp2Yl5ijpqWlpKOempWYkYqFdm5zcXR3e3R3fX17e3hydnZya25v
dH2EgISAf399hIGDgn+Ce32ThHp3fH15dHNwa2tqanuUioOChYOEhoWBpKmMkp2Xk5OSlZeXmpqW
k4yJhoJ/g316dG5xc29rZWdua2ZkbXuGg4SJjI+WmJ6bpKiho6Gnqq+oqailpqGloZ2VkY6Pkpqv
tre/xMrNzsrHyMjN087KzdDJycvEysi8sba3ubKyrrKxsaqorrW2srKvp6eop5eBen2DiIiJhIqM
gnRiW1ZQTUExKS4yODk7Ojk8PlJrdnSFoaCYj5KjpaShoJ6lo6GYhpagp6qlp62wrKmqqqWmo6Gl
p6SgnJeUlpudlJOSkpqkqK68vLG2v8O6u7y4tbm609+4QkA5Ojs4PD01Nzo4Oz4+PkFARERDQkdL
T1ZZV1tXW11ZVlRbVlVVVFRYVllWVllfXmFmZWhoa2Zna21vbWpqa2tpZVtQUk1VTElMUFVQUFOC
ZUdCRVtTTExQa2hPVGtgS0lVSkdPUFA9PkaIlY2NioWIiIaEhYWGgX18fX98dnNtaHiNk5OXmpyf
m52YlJWTlpifk4+Fen10V1BQVFdZa3Npa2traHF0dHd4iY+JhoWCgXx0VTMsQnSNk4+Oj5KTmJOP
lZiScGRqdISMhIOLjY+JjYqGiomFjYJ9fHtxb2pnYW59i4mLho+RkZKTko+UmJiYmI2Gioyhj4KI
koOAcKa/j2pwal9dWFZSODI4RVhdZWZgW1tdYmFiYmRmam9ubm1udHJzeXp4UEFSZWFdbWtkYF1e
WV1bWW9ra2twdHBxcnR0fZZ/dHNwampranJyamdiZGJgaXyBg4KEgIODgXx2eHZ4d3FcS0lKTEpM
SU5NTk1QTkpMTEpERklSVFd4hFtWVFhXYGVkZGdqZ2tufXRua250fXRrcm9pZFdYW1tbYGBUXGBi
YGBfXmdra2dcV1dZXllTTktSV1JhUlxkYFxhYmlrdG5pZmlraGZnZ15gXF9hVVBQU1VeZ21yeXl4
d2hmhn9wbW9ydHt9eXh8d3p9YlJYWVZYWVhXV1xWSkdZRiwmKjM5QEBJUE1OU1VWUFBQVFRbVGuJ
iHdhYW93dHJra21pYWJgYGZYSklLS0xPUlBWWFxSWWddZ2tqaXNvYFdXWWBkb3iBfXZya2lnZWVt
cXR6e4GAenqEho2KgYCJhIF/hIaIiIaAa2JOOTIuLDRHVmWqvq13ZWdzdnd5f4B9enZ7enNxcYKN
fXt6g4WCgoOJiYaIfXqJmqGgqKmqrq+zs7O1s6+wta6wsa6loJyYl5R6cmtveHiCfYZ9cW9zfHZ2
end0cGpvamlrX1dgcmRcYm1lZmZeVlRVPjEqKSkqLDxMUlNXV1xmbWd6joiBgH18hZiJfHp2dHt/
fH14dHx9c29pZ2iCp5WAf4SRl6GhoKasrqyhnI+IhYmFf4GGlJuaoKGhoKShoZuYlZGMgHBxbW1r
bnBxgZOJf4aMlZSOk5admpaPjpWUkZONnJWIgoaDfXl0cnRpcHFram50bnFwcXFxcHl2bYGVfXR6
gXx3eHd9kYaGd3R3eX2EiouWkoaNlpSyoZiUl5+qu7avs7i2tbyzrrGzs7Guta61uK+sraGTfXx0
cGZbXmdudHd9goaLj4+Pj6WwlJKVj5GUkqOPgW1pVEZHUnSLjY2Mko2IhoaDg4OJd3SGj4+NlJqY
nJ+qmJOWl4Z5e4COmJ+Yk5OVmJ+jl5W6lllOUllpcHh9hYqAgIN7aGBiaGp0dnd5d31rW09LVWtk
YmVgYWBlYmtraGJiYnN0b3BwcnR3e3l7fHuEiX16dHB0bnBpaGtubmlrc3d3cG1uZ2RoaGpuZ2hp
Z2drbnBye4CFgpiXiH9wZmRdV1hdW19bXWBrdHJ2d318fH16eHl9gX99e4awioCBfISJhYajlnlr
XVBPUmFdYV9iZmhrYV5heGVbWVtXQDcwKCwsNzgzMjc4Nzg4QTs4RUVBQ0dNVE9QU05UUFVUUlNQ
TlBNTU5QSkVFR0dQdnFrdHNvc3p9fYKDg4WAgoOGf3d0dnZ2cW55gIKGjomPo5eem6Wys7y+xcK7
ubqzt7a2r7Cvqaehj3RiW1lfZWtyf6Osn5GNiIWEe3Nta3R3eHt8e4GCg4OBg31/fYOFko6Lg4qy
07yUl6zI2tTOzsXBw8fFxMPEv7i7vLnLxbu7trvFysPCv8PF0ryhnbKaoJqEhJinp6aqqqagpJ+a
kouFf3l4j25bU01QUFlfcoiPlZukqq6qraixyLKkpaaprK6qpqCTk5OGbmJdW2RtdnN2c3J0cm5u
bW1ramViXFlWVlJVU05OT1RdX2BmaGVgX2ZnaHOGhoKDhISAiXxfTEI8OT5uZVxbXWJhYmJfXFlX
VlZeaX2Ad3x6fH9/fXiAdnl3dGtoZmZgZGZdXmJYTFBrgoyPlZibn6GhqKeno6OakY6IhoOIk6Oz
tru/u7rFwsPDxcfFycjFxcTHzsXBwL65urKvqI5zZmJlZF9gZGJhX2R0e4CGhoiNi4ySqqSLhpGG
hpadnZ6gpaCamJiapaWPhpGPjZOYoKaxpoN0iZSYp6Obl5SWnp6Rio6GgXp0amRbVlZUVFJhd19X
WFJEPj1BQUBJYnyAhpKqoJybm56goaGpqKqvpaSuuZ6YmJqXmI98eI6cj4iLhoaGgoGGgnd8eXZ0
dHRqZltXbY+VkZSbnp2XmJiTmqCYoaWooaGempePjo6EdG1wb3B3dnZ4d3h8eHN4cnFxcXR9fHl8
f4J5eYOEg4aCgoGBiYl8goF/eHRxdnFrZWhuc4yGhYSEgX18eneSlYqPmpSOi46Yl5WVl5eVjomF
fXZyb25tcG9raW5rbW9rZmZib4CCgomMio+YoaWloZ6gqKmnqqehpKanpKGdmJeWko6Nj6CwuMDF
ycXIzcfIycTIxMLO0MjFyMXCvMC8tbO1sq2us62prbOysbexsaqopaCvm4R9gIV/hIaEhIaGfG9k
XlVJPjMvMjc1Ozs5Pj5OZniCkq2plJSYmJ+foKSqs7Ozt6mmqKGnp6SjqrOwrKeqqKWqpKClqaeS
k5eem5iWnKSfmpykrLCzurq8trazuLe2r6/KyqpDRD5APjw7Oz4+ODs7Pj4+QUBBQkZGR0lQU1NW
VllZWFlbXFdTVFlXVlRVV1lfYWFiZmBma21ra25ucHh6dHN0bWlqYlBJRkxLWF5fYWBfXV1eX1tZ
WV5bXGhvbVVVW2JQR1BmR0dKV1VARI6aj5uNhoiGiIKFiIN9f4GCfXl5eXJgYIqdn5yhm5uan6CY
m5qYo9HFhHF0e2dZVlxdXlt6eGplamtranBycW98iY2LiYaCg3pLLyYxYICMjpSblpOXlpOXlIhr
Z3B3fYCYkYiFhoyPiYWCgIONhnuCmIZraXt6e4yKgo2OjI6PlpaTj5OTlpWLhoWMiYuIhYm2o3Ko
uoxnYmVlX1lUVk05MztXXF5fZGVqentqYmRmYmZtb29xcXB0cGtvbm5gQzxBWWFxcnh/YlhibVlY
YWtyaWtqcnR0dHR0fHd6dHRxa2ZpZWJpcGloZWJldHx5gIWBfXx6d3d5d3Z0gXZXSkpLTUtHTU5N
TExKQ0RLbV9EVFZUWGZeVFNWWVhZXl9gYXKVd2tra2tubn1zbW9vZ2FbVFhma1tbXlxdXl5gYGRp
YF9iYV9fXVxgX1xXXFtTWUtEW2RbWFxkYmJpcW5iZ2VkYmRvZmJkXFZUT1RTWGdzb3p8gZRxTU5X
W299e3R0cnl8eHh2dnRdVVZZXFZXWVBNWWdcTDcsJiUwPDo+Q0dOTk9SUFNSWFVPT1RYVnKXc1lh
aG1tbW1uamZhZWBcXG1lS0ZKTkxNUlJVW1dbZV5fYGJwdnJgXFlZW1xiZ2piZGdmZWhnZmtzdHR6
en18e32GiI+LjIqIhIaKiX95dG9wdGRENTAsLDRQcqjK4KlhXGlydHyDiISGd2ptcXZ9fHt7goGB
gYGGiYqOiIh9eH+Tm6Clra6vs7ixr7a3tbW3wcC6raGcnpiUloJ2d3B5eoCGjoyCfXqAgoWOiX+A
bmVqbmpgYmt5Z2VpbmRdW11bWVVSUEM1LCssPFBJSkxSWF55bmZwfYN9gn18ho+BfX19gY1/enRx
dGpna29nbY6thHR/hZOeoaCgpKiqqaCUioSEhIaEhYSOmJ2hoaGkpJqgp6CWk4t3bXBraWd9j3Rz
fH98fY2Tj4+Skpqck5SWko2Rj42MjIaEhXt2dnBtamdmYmdrcHRuam9rcXRvcXNzeX15fH19e3l5
ent9eX15eX2FhYSIi4+RlJifnJibmJaUnq+4uLa6vLi6ubq5vLqyqrCzsqyysKqoo5SBfHxwU1Zr
cHR3fYKGi4+UkZOSkpORj5GTjY+Ni4mCaFdKR0ttiY+Rj5aRko+Ei4uNj6GBa3qqno6MlJialpWU
lpaRjHx0gI+Ym5uYm5idoZyRjY+BclZSbYh4d32DhomGfHdoXWFpam96e3RyZmFcYmVpgWlbXWFe
YGFrhIWIdmhlb3tzbW5yd3JzhYh8epWqgXR0dnZ0cm9qa2tqam93gIV6bWppZmFhZ2hpZWRlZWpq
aXR3en+Fnq6GenBqal1UU1RXWV5da3KMeW5vdn99dHJ0dnR4fH9/e319fXyCfYWGhYmFdG1eUlNY
Zl9kamdmaWRiYV9bW19ial5YVkMvLDI4NTQ5OjU1Ojg5Ozs6PENGSklKSU9TUFRVU1BTUFBQTUdM
T1BLSUlHS1Bxb25ramtrdn9/fYCFgIB9fXp3eXRwcnJuc4yThoiOl5KRmJ6wuL+8usPO1b65ubi8
uLKtrKmpqaiok3NdVlVdZ2t2l6GYkpSPhoWBeHJ0eXp5fYKBf4iIi4uIgoqOiIqEiY6NoM68mJKl
s8nSyMvOzM3NzczLw8LDwb+/u7q5u7mzs8DJwsLEwcK7sKijvqehoY99g5+go6WjoaGmo5aYmIuI
gnd5e4uVa0tMVmJ7ipKVl6Gqrqapqq+7rbKxqKiqwMehmJSKeXBmWUxLUl9paW10b2t2dGtqaGlr
ZV5ZU1BQUFBQTUpTVFxhZWloYmRiZWdleYWCgYOCgn92d2ZHQj4+R1tYWV5nZWdkZGJeW1RTUFhx
dHl7eHl8fHNxdH13dHRybnN6c2lpZVlXV0tJZHh9i5ibm5igtayeoKShnZeNko+JeX2Toaq2vL++
xMjFyMC+yMjKysjIxcnRyMHBubq1qJh9ZltUVVJVUlJQU1JWXnl8gIKJiomJi42Wj4mMkoR/jJGP
lJWXnpeanZegm459iY+Lj4+TlZuYgn2Ck5iRlZeakY+bmI6JhYKCdm9kXVdQUE9NT1hhVlJJPjw+
QD1AQ0NUcX2Iqqqhm5WhoZ+gpamosLKvp6SooaOgm5iYlYiGhZKRkYaGiIJ9fYB7eXR0dHNwdG5i
XFx0ho+amJqdn56fnZuYlpWttqGhn52enZuSj4l7bnJ0cXJ9fXp3dHh0dHx9dG5wfX19g4GEhIGF
hn2BhoV9g4aFg318gIJ9enRua2ZpaXGFi4uLiYWBhHx4dHd9iYmVi4aKjouNko+Sl46EeHh4bWho
amJxemtqa2VgZmdhZGJqen1/ioaJkZidoKOgnp6hpKysqKiqpqShpJiVlZOVjYmPm7jCvL7Jy8rF
wcXFyc7LzM3JydHOxcXEvLu3s7q5s7Oxra2qrrKytbKoqq+qoZ6smICAhomJiYiGhYN7cmdbU0xC
PDo4Rjw6OD5KWXaKnJ2pwZ2KlZWXn6G1t7rIt6mzs7W3qKekp6eqsa+qra2npqeppqGloJiXmJuY
m6ChnJucoaexrq+2traysLGwraivsLGwpkdHQkNGRT49Oz5CQ0BAQERDQkdFRklJTFBQUFdYWV1Z
WFZVWVhVVlVWVVZUVFliYGB5g3Fra2lxdG1ud3t7c3Z5f3xwXExLVVZfYGBpZmVoZmhkaWtuc29y
b2RiXlNVVk9QSUpNVU9PT1BVco+RloqFjoSCho2NiX99fHt8fX12amJykZyhn5iYn6Gdm5ufnqGz
zZt7c3RmXlxZVlVZV1liaGJiYmhqa21ucn2nk4KDhH99entdTFdgd4aKjY6Wl5OVkaeSc2FnYWF4
gIWNi4uLho2Fg4SChIJ9d3hyaHB9f4GDgoiLjZGVl5iVlamckZOWlo6MiYqJhISNr7mEa5aWb3Nq
ZGVgW1xcTTk5SVRbYWJlZ2hqcG5lYmVrbXF4d3N5dHdxdHB0cF9TQUZUYmZdW2BZVllUVV1ubW1x
bW9ycHSBfXh4e4J3cW9rZmRhZ2dqaGdoZWJzfXx9goN9f3t9gH16eXp/b2BbXE9NUE1NUE5PTUZM
S0I+PkxUVFZmXFVXVldXVFVeYWJrdKGphWVkZ2poam9qZ2ppYVtWXF5haG9vaWRfYl9dX15gZHJu
ZWdkZGJkZ2ZfWFVWYllhcmpxYWBdX2Brc25lZmRkZ3FxYGFfUlBPT2FzdHFucG99emJKU1VeaWtt
cnJzeH18eHRtZ1ZWWVhlYldTT0lAPDg0NCwjIyo9SkJDSUxNUFZMT1RWUFJSU1Vqd31kYGdtcnBq
a3BvampnZF9iaG1bTkxNSlBQUFZmYmRlYmJman2EgHdvZ11YWVxkZGVlaWRnampmbW1xdHh2e3+A
gISGg4mWnYN9gpahfHZ0Z15XV1BDNTApL016uOLSpn1iZ3B0gYiTnIBtZ2ttdH96f3x8gH2BhIuN
ko+Ihn92fYyaoaapp6q7wbWzt7y5uLOzsq6mqqmfmJ+fjX15eHp9gYmKjIyRlKCbl5iOhHx4gnRt
amZkZGBhamtmZWViYmJcWFZVVlA8LysvQ0lFTFJUX2Jia3h4eHuEgoWAhoiJgoCGkoZ/eXRwcGtu
bmd3hXp3eYGGj5iTlpiao7Gun4uLhoSEg4WEhI+Wmp2cnZ+fo6WfnZiXjXJoYGJrbWlra2dpaG13
hYyLmqaSi5KYlZWWkZGNkpOMhoWEgHlua2hmZlxZXF1raWRnaGhucHlxeHx8hn2AgXx7fIB/f3+E
f4GEi4uJhIaPjo6Sj5GSlZihnZ+osbK1srO8vLmztby7vL++vrvBv7ezsKqgkYaEgHhhYG12fHt8
ho2TlZGVmpeWl5iUkoqSl5WOko54Z1BDWIqSj42Tk5iXkY+Sj4yIiX13gKSfk5OwoZaTlZielYyP
gXyAipSVnJybm6GqlYqKfX2BYU9Zamt2fYWGhYZ9clZQVmVqb3x9dHBnYmhhX2BgYF5gYlxdYYCT
j5+ehnh4eXFzdHd2bmlwdnp6e317eoODc3R5c3Nqb3p4d3hzeXp9fXFiZmBdYF1eZGVkaG10e32B
goWGiIOAeHJpbnBXTUdMUFlwfHZxcXR2e3t9eXNxcXF8e3RwdHZ0e4OBeoCBhYF6cm1hV1dYXmJg
YmVramRdVV5qZGhpZmJiXEs5OTQ0OTU5Ojk3ODg4Ojo6T0tHR0lQT1BUU05OU1dQT1VSVV1VU0tK
TEpNTGFtaWtra2trcHZ8hH16enuAgn19e3dub3B0j5iUj5KSlZSYqby/uL/Av8TFwLy3tra3s7C1
s7CppKGahWtcX2FqcYCfl5SYlY+PiYF3eHN3fH1/goSKio2PiIiGhY+toIZ9ipG51aGJj56tztrN
xMnNyN7dyMDFw8G7u7y8vLa1sLG2wMrFwMO7trOqqqihpKOgmIiKlpigoKCenp+enZWTjYaKhH2O
rMOhUEdWaYaPkZSYoa+6sKqsrq+vr62qqaqvrLHFmHFub25UREBBTFliaWlpbnNxamhka2hiXFxb
V1VTUFJQUlRbXWRoaWZmZGJkZml8jISAgIJ/enZ9eEc+PUdSVlZZYnxvYmBiXFtUUExHR2WklnNm
ZGtra2ttb3Bud4aTk4uSg3JrZF5ZVExldoGGjp2qlpuko6amnKChmJidhnFvdoKXqba6v8G/wcXC
vMTFxcjKyMXHxMO8vL+3r6qggWtcU05OS0dAPT4+Q1Brn4qGgYODhYmFhomGgYGGhoOIipGSjJWV
l5idmqqbiH1/f32YlImGiImGg4uSnI+Rko+UlJSPj41/dGtmZFxXU1BTU05BPT08Pj5BQ0RQTkdF
RUdefZelm6GgnaexsqqqrLCzrrCwqqekqKeko52elZOYhoWGiYSFg319enp5dHR0cnJ2bmJgX3uM
kZGXqaOgnJ2dnJaXlKGtp56foZybnJiUjYl9eG9ub3p9enl0dHp0eI57cXJ6f4F/hoaGgomNi4aF
hoWMsZeEen1/mop6cmt0amZqfY6OkYyMj4V8dnR0eHqAhY2IiYqOio2Mk5GVj313cm1nYmFgZGty
a2ViYWBhX2BiX2JpdH2Di4uPmJugo6Ghn6GmrbKuqqapoaCdlpGSl5WPhYWTsbvBxMvSxcLEwLzI
ysfIx8nKydnTwsnAsri8uLm1u7ysqKyqra6urqympqablqqWg4iLjoyJg4KCfX97aVlUTkpFOTdC
PT4+S2B4jpihp6qpo5+uo5icrMXKvLCtraqwt7OzrqWwqKSpqq+qs62oqaanpq2dmpOWlpiYmJ2e
naGdnp2oqq2us66vqK2qqKyqpqSlRURCQkE+Ojs6OT1AQjw9QENGQkVHR0xZV1JSWVhXWVZWVVNS
UFBSVVJUVVVYXV5cZ2ViaGpma29ycXNydHp8e32GnrGofEtUW21kYWRqcW1ubmpyeHR3eHp8dmJg
bWVeVUZBQkVHVWJ0p3xrgJeIhYWPjYuKhoSDfXt9f3qYhm5kZoOfp6SenZ2coKGdnZ2dnLGtmImC
XVRbXlxbWVhZW3aBZ2JmZmdnaG1oa3uFhouBdm1rZllZXV5efIWPlY+SlJimuYRZU1RSVGt/i4mM
jImFhomJi4WCgYOAfXRzfIWBgIODhYyPjZORlJiVlJKWk5GPjYaEhYqGho2as5FnamlpbW5nZF5Z
WVhSOztQV2BlaGloaGhtcXBpaHN2dHRycXd8gYZ6c3Zyb2FJO0dkb15ZVFRdW1dVWGJoaW9tbnR0
doV8eXl4e3Zycm9qampqam5pZmprZXKEgYCXl4F7gX98d3h7d3poYF5dTUtNTVJTT05KR01dW09L
VFtYVFBWWVdZWFRZZl9idJaOwKpuXmZrbm1rZWJfW15wb11dW21wcHBvdHRxbWtwbWpramVkZmho
ZmdlaHliXFxrZV9gZ290enR0lIV2cGpqaWprdoViTFBXWWJyb3B5dm9wbndlX1xVWWJnZWtvcXh3
dHJ0c25mXVxZWV5gU04+PDk6NTU4KiMjKDQ4OkBFTE5QTFBSU1BOT1BUa4lpV11obW5yb2pqaWtu
a2ViYmFfYWdTSUxQUFJPVlhZXmBgYmltc3d0a29xaV1bW2lkYmRkZGZla216dG50d3R0c3qCfX+C
hYKBgoKFi498dnNiVFVZXFhKNS41S4qtsaGnqnBhZXSBiHxxZmZmaXmBeHZ5gHt9hoKGj5eSjYaG
f3dxiZigo6Wqr7a3sbe/t7Cvw7u8s6ajpaCYl5aVhYOAfXqAho2Li46Rm5WYnZ6ViYiGfHh3cWlm
Zmpva2toZWRiYl5bXVtXXVc+MCssMDc+TldbXWBweXp/fYF9iYSEho2Gf4CGgn2BhX9ta2lmZHuA
eHt/hIWPl5OTj5uhnaCVioSIiIaIhoWEjZKWlpygnJygnqCeo5uTdGJeZ2lrcG9tZ15dVV1/io+R
lY+Oj5STk5WSjomKi4uJhISPfHJraGJdUkZLVVtfYGJma3Fqa2VteX19fYmOgH17fH98f4SIjYqJ
joqLjoyIi5GVl5aamq2qqbeusbu/v76+vLy7try8t7a7vMDFx8W3qpuMiY2RintudHl7gYWJj5KS
k5GOkZWUlJGRk5yapaeTiYaGdmVti46RkpaUj5KynZOKi5OBeHqGj5GPlJiWlpeSj5eWkZ6IcXyD
kZqdoaCslo6KhX+Ce3doV1Jfa3J3e4aAfHRqUkdNYGl0hnNrZ2FkZ2lnZ2RkYlxbXGRug4yTmpyd
m5uWiHdvdHd0cnSAhIJ/fISRioWKlpiDc2tzd3Z3eHd3dHB2dHJ4ZV9ZXWZlcWpwf4KIjJGNioaM
jn13c25yeWhPS1JZU2JtcnRxc3R0cnRvbXRybnd2cGpucnR0cnZ6e3mAgn16eXNgU1tgYF1eX2Bk
YllZYGJoa2dqaGZnYFlPRkVBPT07Ojo3NzUxMzlGQ0ZLTU5HUlBWUFBQUlBQU1NYaldNTE1KR0dH
XYp0aWVnZmtwdImjg3R6eHR0dHZ0b2tnZ3SGlZaXkpGUmKG1vLi5vru/u766vrm3vLm1ubCqrKyp
oZqOhGZbXWt0eoiRj5KPjYqFgXhydHl4fIODhoaMpKGUjI6OlNnXjIGgzNG6mI+XobfS18jAxc3J
ztfQxcK+w8DEuLO+s62oqa+6w768vLmwqqqsqqekpJ+YiqWdl5iWmpidoJiXmJePjYuIgYWGkYhe
WWR0j5ablpqlr7qusKyusa+vraemqaqmqaqXgXl/emJOQ0VFSlVkZmhweGphZGJxZmFhXF1bVFNU
WFVUVFxZX2VmZGFiZGJnZ3yPhnt9fYOGhXhZTE1PWWBmZ2FpZ2JiXl1ZT1BMPj1DasyzXktTYWVr
cHeCiY2brLizra2hkoZ5cmZcTltzfYaMkpign5ygwbOdmJiYm7qCZmh0i5eotbvHxb+/vsLExcXM
yMHIx8fFv7y8tbOyoZiBa1lQTlJORDU0LzVEUHSkg42IgH+Eg4SIioJ/eXqChomGiY+OlJKPkpSa
lYWDfX2BhpWPiI+Gi4qOkY+Rj4+Wl5aVkpSTkYZzYFdYV1lWUFJPSjgsKiw0Ojo7QktHRklHTVhy
kpedpZ6Wo6moqK+vs7OwtbOuqq6qp6enoZ+YmJ15dIWEgnx8fHt3dHNtdndtcW9rZ2Rmi5GMj5aj
nZqYnJuVl5WWnZyjoaOhnZ2blZiWjop5cG9ya3R4e3pzeHR3cGpxiIx9fX+CgIGFiIyLhYWEhYyj
joODf3+DgHtzcIlqYW+flo6IioyRiX97hn9ucnuDiIuJhoaGjo2KgISAeHRyZ2JkYl9kYmVlZWRm
ZGBgX2FbV2RydoGGiY6Rk5ado6GhoKGpsqiqqqispqWakZSPjo+FhI2brLrCxcjHxcS+v8TJw8PJ
ysfHy9TIyLy4srO1srO8uaqsqqeqr62moZ2hoZiKgoORi4aOhoOBgYKFhYFqVVNUTD41SkA7Pk9r
fYmTmJqbnZuhqs6zmJejurmyuLiysq+vsK+wsbiloamquKimrbCooJ6ampWWmpiYnZ+gnp6hoKGg
n5+lr66qoaOkqKShoaGgn59FRUA+REdQPjg4PUxHQT0+Q0VGSUlJS09MUFVXWVZQUlRTVVJSUE9Z
VlVTV1xfX2BlZmVmaGdmaWlxeHt8d3h7homYubx8SlBeYWFkZmZtcHR0d3Z7fXh6fYKVfGJbX1RL
R0ZFR1tuj6eggXiYn32BhoWGhoWCgn2BgHx2d31xa3Brg52eoJ6enp+fm5ycnJucqaaCipdfTlBU
WVxZW1ZXVlxmYmBgZWJmZWRpboiXe2pdXWJZWV1bWFlthoqMjoyJjYyGdGtVU1RWaXd8fYKAiYuI
hYSEgHyEhYZ8eYGEgYiAg42Pk5OTj5qTkZaXl5SPko6JhIaEhIWDhIJ0Z2hnbW9uaGJgYGBZV1RK
QE9ZYWVkZmhqb2lrb3JybnF4dHByeHt3end6f3d0aWBPRnNxVlRUVlRVU1ZhZ2hrbmhrcnFxdnp9
fY+EfXZvcHFqaGlmaXBycW1na4CNioiEhH94fYF9f4B5cGViYFZLT1BQWVtUUE1OT0tHS09cW11Z
VVtZXGp3X1xteI2vvtzIeVVZYmllaGdrd313ZGJfWWu50IBfZW90dm5tb3Bxa2tlZGprcX9wcXRu
cG5pX2JgYmRlaXR0d3t9gXh9dGtoa21uaExLVmJqdndwbXNydHR0dHFkWVtfYmpvcXNxd3R2d3dy
cmtcWVxdXVM+PD08Ojg1Pj46LygsNTxAQUJKRkxOTlNTU1VXWV2De1hYX2ZrcG9zbW5ra3JraGdn
ZV9lZVBMTEpLUFdWVllfYmlqa3BueHlvcHJzcmVcZmZmaWdoaG1ranNqb3Rxc3p9gH2AfYCCgYiL
gI6DdnNuaFxVWWBZYFQ6LCw7fa55VWF0dHBrhIFoWFtiYl1meX14fH19fX+CjIyUlpaRioaCenCC
lZ+hpq+vs7a1tsK5tbOzr66xraShnJ6bmJeJhYqKhIWGj5KUlo+VnJ2hnZiVjop9eHFtb29lZm5t
bW1qZ2VlYl1fXFtZU0QyKiksLDVDWVlWanN4f319gHt9gYSEhoKGhYKEgXp9k3RkYmd5in13en1/
ipGWk5GWj5OVpMiqiISIgoaGiIiYkpSWmpuho6CbmJ2ampR4cmtweHZ3c290ZFVLV3SGk5aRk5KU
j5iVkpKPj5GRjo2MhI6Dg4BlYFhEMi8wPEtVW1tZXl5hYmRud3t7hImGfYODg4SDhI+Tj46NjpuX
iIuNj5KUlJigpaahtr68vr7BwLy/v8C8ure5vLy4ubu8vMjHl4mSlZORmJd9c3qBiI6KjJKVjI6U
kpKUlJianp+bmpiUjIyGg4KKiIqTqqCbnJePjpOOhoCDg4uRlJWYlpONmp+Yk5OLhHpuc4GIjpi2
nJWKg4OFiIN9gXFdUmJqcnZ9fHt5cV5EO0BWXmVramdlZmVlZmlva2RhW1RXZHKGmJicn6OmpaOe
l4t6d4GIl5SYl5uno5+hoaChpJiJeXeCg3RzdHR3d3dxbXB5XU9fm21ca4WmoJOTko2Oj5GPmI98
cmtmZFtTU1VeYmtyb21ydHRta21ranNrcoRtaGlub3F0e3d3fX+AhIB9gHhnW19gXV5gXVlcWFhe
Zmdla3BtaHJ2a2lnYV1ZT0U+NDg3MjU+Ozk9QENJR0pQUE9QVlNXTVNSUFZUWFdTTUlGR0lSfW9l
Yl1dYXRyfYt2dHlzcHN4cnlzam5ra4aYl5SVlp+jqbe8vLq+xcK+w8XCvLi8xb6ztrixuLysoY+D
al5ia3eBkY+PjY2LiImCeXt7fYaSj4iLiIiJhoqJio+Sra2Pqby8uJOMkrqtpLK/ycTExdfSzMXO
ybe3t62wrsKwpKSkpq+3vLmzs6+xtbGpqqOgmo+MnJqbmp2XmqCbl5yYoaeMgYR8enmShGFidoWL
lpualpuprrC3s7GyrK+tra2pp5+WoJuLhIl7bm5SR0tUS0lUXYCwdFtcXV5kYGReWFlcWFNVV1VU
V11fZmhnYV5cYGVqgHx3dHR6fX+TmHRgXl5iaHmRbV5kZGJfXVlPQj5BPUFbkahhR09ZZHKFkZ2l
tru6vLOppqSmo5WMf29ORV1zgYmMj5afoamqpZ+hmJqcinFocneEoLO+ubzBw8W8vLzBvsPKxcC/
vsDAxcK8tq+mm3lkVVZYV09ELygvPE1ZYnSWjnp4fYyFe3p9ioF0eHR9iIqOkZGPjo+RkZKMhoyJ
fX+EhoiIi4iGjI6Sl5iYnpuVm5iPkZGPkYh/X1NTUlhSUE9JMykiISAsOTtFR0pKUFJQV2aAlp2e
n6ShpKWur7WwsLe6ta6usrKzraanp6qTf2Jrg4V/e3R5eXJvbm5wamtra2tiXF1viI+PkpWamp6X
mJudj4yOmKGdnJ2gn5ucm5eXlotxa293dnR3eHd0eIB0bXB4fXt/g5KCe3+Gi4yIjY+IhoiFhIWJ
iICEfW5tcmJhc5WWkpKPjpiShoaIfHl0dnmFhoaEfYKGg3x6d3hzdHp0bXB0cXFrYVlgaGtkZ2Zk
ZGtSUGJ0goiIiZGRk5Wdn6Gjo6avs62orKmppKCYlZaPi4mOg46ksrrBxcO/wcDBxcTEw8PExczL
y8K6trC1s7iysLOvrailp6qmo6inn6Gdj4iJi4yGiYqGg4KEe3+AdF5OTlA+NztFPktba4KMlZug
nZ2fnZ2hqZybpq+wr7C4uLezurezr7Gqrq2opqWqqqmoxaiTko+MjpKXm5uhrqaspaGmoJ+dmKGt
raamoaShn6GhnZyfm0JAQEBCQDo3PEA3PllNPkFFRkdHR0xMTlBSWVZSU1ZZVVZTUlRUUFNTUlNZ
dHJqZ2BiZmlpa29tbm9ydnx7enp6f4KPgVBLUF1fYWZrbnJxcXR2f4aDhH19fYt0YFlQS0dHRkdQ
V22Kqa2MjrGNe4mLiYaGg4aBfHx6e3t0cm5rc3qNm6Gdn52Xm5qXmJeSlZumj31pWFVYVlZZWFZX
V1JUWW95ZGFeX2FiYmRtcGhdW1teXFlbWV5ZWWaMhoSGioyGipFmUlJgX2BlcXd7eoWTjoR/iIOA
fIGFmoSCi4SAfYSFiYmPj4+WrKCSkpGSk4qMi4aFiYiOgHp6d4BrX2JnZmVkYmJdVVNZVUVDS1Re
ZWhoa29qb3B2eXd4kYV6dnp7fX99gYB8f3xya2FWfXpZU1BQUlNQTVllaGJocXFxcnR4f399eoCG
f3RvaWhrbXJvcmtqZmhpe4+EiYmDhI+RmIV9e5p/Yl5hYVBSUlBQT1BOTU9OS0ZJWF9ea2BZYGJh
dH9qaHyWktD36bp6e32Ed2lbZ4CPiXZrbm+Eyv35oWJ0c25zeXZ0c250bmtvbWhqaW90d3N0d3Z5
a2VlZ2txgH19eXZ0dHt5dG9uc318YUdSfHhqb25yd315eYKCd2JgYGFrcHJxb250cXeChn1wXlJX
WVlZUkA9Ozc+PkVHQEFDOig3PUBER0pNTVBQUlBSUlBQXHNyX1deZ250bmtrb21rbmplZGJdXmFh
Uk5PTE1QTldWW19ma2ptbXR4en10cXF3ZV5cXWJna29wb3BqaG5xe3Frc3p9fIF9fHyCgHqDkYBw
amRiW1xYYmJpXkU1MjBCW0lFSV5zdmpiW1hVWFdWVV9zfXt8fX99hIWMkpWXlYyOiIN7doOWmJuj
qrGzsrOzs62urbK3sq2sqaegn5yhmIuJg4aOjIySoJ2gmJiYoKOlnZaXloqFeHFvbmtnbnN0bm1r
Z2RnYl9ZWVtZSjUoLCcmKjNDTFd3e3JyeHx/eYGBgIWGjIWCgoF9fX2DgWZma32FeHR9gYKGjo6S
jIyLi4q44/KweX2EhIaEgoSKj5aYm52do5ycnJufmHlwdHd6dnNyc312Yk9QZXmGjo+Rj4+Vj4yO
jIqOjYuMjIWAfHiMoG1ZUjsvLCw0PERES1BUUFBVW2lwdIGFi4+Whn19fYCKkZGPkpGPko+KiIqT
l5qfmJ6opqOnusPBwcHDxcW8ubu7ubq8vLe3uMG+uaqelJabk5SNiH1/hYuYiYaNiYuRkZOPj5Kx
sp6YoJ6cmpiYkpGPk5GOjZWamJaTmJyMi4+IfX2AjJSUkpGSlJiYmJGWlIiJe3B2gIqNlZOPjIaG
hIaGf3qSgmtcVV5udnl2fXRoVUQ1M0lWXWJkYmRkYmZqamhpZmVZVllmfY6TmqGpp6epo52hoY+G
iJqnn6Cko6yura2vpKGlpZ2yp4x0cnh0c3NydnZwbnJfVFheXm2Bobikl4+RlZaWlpueoZeFeXdx
a2ludHZ9jnhpaHBxd4Jya2tpa2lrdGhkbW5wdHR0eH18fYGBiZGLg313bmJeV1dXVlRUWVliYmVm
am54enx5fHl3cWtoZ1VCNTUzNTk3OTs9QUZKTExQT0pOUFRWU1NQU1NQU0pMTEdHTkpQYGFiX15w
ZmVma29ycnJxb25wa2Vkenlne4+VlI+Xo6OptrW1urq4usLFvL/CurvCv7i4tbG+27OokX1kYGVv
fIGGjYqIhYmKiYmCe3x9ns2WgYCDgIWGjo+KipGSkpGfo66elJKYoZ+hoaestsLFydfQyMvDvrm5
rKajpKWhpK28s6qwuLmysLPT1qqcnpycmI6Ij5ybnJebnZiUmpiTjoqEg4J9eHRvdn19g4iTlJWe
o6+qp621rqmqra6ko6qzoI6PiIaNgHp4c2ZnX2RPQEBHV2teZmViW1lcZl5cXVlZWFZTU1lZXmJo
Z2RiYllZZ29kb3Rzb3Z/ho+LfXl0dGprcWtiYV1dXl9YVEw+OTs+QURNUkxQWGmKjJqlsbe8wLq4
uLWtr7CnnpeNfVlCTGFwfIWRnKGjpaCdm5iWlpJ7a2lueoSdr7u8v8K+v7+6v8PFw8PDw8LCxcG6
wsG4saSPd2dWVlBQUlAuIjROWFldZZKPfHx9gIuDeXZ9d3B3eYaIg4CChYWIi4yOi4mImol3en+F
hISDhoqNk5GUmJ2onZiboZ+hmJWSmpJkVVRZVVhSUEY1KRoaHyU3Qk1MUFJXWFdZYniPoaOem6Wq
rKqtsLW7tbW3uLi2s8rFrqGhpZqIXldoc3hzdHJyc3Bta2tpamtkXF9ZU2J6j4uOkZOYmJeVk4+M
lKibn5ibnqCgoKSbnKmXjHtwbnR8fX+AgH2XwIRiYmt4fYSFm4Z6f4aMjoqJiIaIiYKGhIaCgX97
cmtoZGRxj5iSlZeXkZaRhIJ8gHx8eIKDg3x5fX18enuAfX9/iIaBho6CendlVlZham1obWlqd11F
VnZ/gIOOkpSUlZedpq2hn6isr7Oqp6ehnpqal5OMhouBfY+mt7vAxL++wsLFxcDCwMDFxcvFw8G6
tbq6sq+wrqywqqiqqqedn6OhnY+IhYWEgoaEg4aGgIOEe310XkdDPjUxNz5JX3SGio6VmJ6goaCe
nqGhnp+prqqzt7i4vLu3s62srrKyqqqho6GlpafLoY2Oj5KVm5icoKGhpa6YnKCaoaGdmJ2jo6Ol
oJ6blpablJOUQkJBQTw6NTo+OTw+Oz5ERUdKSk1OTFBVVFNQUFBSVFdXUE1QU09SVlZbYWJdTHOM
a15mZGZoa2lzdnmAfXl7fH12cmpTUF1QVGdoa29ucX2PfX2DiIKCgX1/jZ9oV1BJSU1GSVxmUE9Z
a299hnx9g4aEiYmaiHuBhIB5dHR0dHqDjJaboKCdmp2bm5ualpSXoI+GcVVVWVlZW1NUVFRXU1RS
VVVbZGRfYmJha3RzaWVeXFliZGBhXllZWGiEj4uEg42Ki29ZanRtboBvcHZ9gYKFjZKVgJePf3d7
i4+PgX1/homMjpKTk5KRlJOblo+PkY6Kf4SFfXx5e3drX1tgaWtkZGJbWVhWU09OUElHVVtiaW5w
cHBxcHR2enuChoWDgYKAhYaDgX96eH1ya2FQUEtOUE5PTk5VXGdrZmlpbW1zeHp3dnuGf3h3eHJw
am5ucGtucHRqaG1tgIqLjISKl4mEhYV9fXBua2hobVBLS01PT05LR0dNTk9fYl9iZ2JdaWtbWFhd
X4K18vfSlW2NraiRgmdncHFraWVoi9f6/tFnWWpzdHZ0dHdydnN2cWpoZWRrcnR0eHhxeHdwcWtq
dnJ2eXt3g3h3dnePeXF2cHhiUHR0a25vbXBydnh9gHlrYV9iZWtrc3NtbnFycXp9fW9eWFVcV1lU
RTs8Q09UTkdBRVBJOTA7QUFJSklNT09QVFJWVE9SWVdVWF9nanRxb2ptbWtpa2liZ2ZnaGlSSklM
UlRZW15hYmZna293dnR2endva3JtX11eYGZvbmttcHR0cndwaW12dHp5f4F9f4J7gX13d3JrYGJv
ZF9cZoiqazo5OkNJQkRDSVJUV1VVU1NZWVdQW3R/fH18fYaLipWdnZyXlI6Ign92ho6cpKqpqrKt
rLKqrLGwqaqsr62qp6CfnpyTj4qMjI2MjZSkrpyTl6Gks6yYlpuVkox8a2t9cGpobXJ0bmtnZmln
ZV1fYF5YQzAlISUoKjFGTlxocHRwdHp9fYSGhYWIiYWGhoF8f4KGb2p8e4V2cnl8f4aJk4+PjIiJ
hIaf3fGceH2DgYyEe4OIkZKRnZ2bmJWXnqeNd3d6eXh0dHNubW5iUExceIiSk5KTj5GUko2NioyN
iouFf4OBfW1ka2FVRDsyMz5VSkJER0xOTU9QXm50eYB8jaqag3qCiZGSlZGTlI6OiY2OjJOVmJ6k
oaWhoaWxwcXDwsHBxb6+vsG6u7/Dvry/w7q8saCYmp+el5GEfYJ8j7CMfIGLjY2OipSUjZafoZ2c
nJSUj5KSj4yRmpWPkZWanpuglIqGg4R/fYSKj5GVmJqSlJaVjo2YhXx7b259iYiKioaJi4OGjIV8
f3tyaFZGV29ubW99cldGOy8qT1BPVl1iamJmZ2lnZ2hmZV1QYnCGkZKboaalpaGqrKSdnpian6ah
n6GmqKeqqKqmpaazsd3+8Y92iXJucXJ0cGlqaWZXTVBhe5i2v6OWmJidmpugpamqraWlinx9f4J/
f4+PdGpraHJwbW5raF5NQVNlbXRqam5vc3p7eXh6fYGSnJuWkomEdGtnXFdSUlRWW19kZGhqbnl9
goKGhX+AfXZ2bVtSRjo0ODtAPjw8Pj1GS0pNUFJVU1RSUkxOUFJTT01HRkJAQEROZV1eX2ReYGZl
aWdlZ2traGViYGRnYVtgfZKRj46Wm6G5vLe4vLrDxby/v7/Bur6/vLmzray+qpiRimhcaHN/f4aJ
hoWGhoaGg3tucnePsJKEg4OGhouPi4qGhoqSj4+drZWMkZeVnaShn6Shoay5zdbRycTKzbCjo6Oh
o6GgsuC2paqws7azs8C/qaWho5yPhYWOkZaYmJycnKCmk4+NiIWAfXx2dHF7f3t9hI6VlZSYpKaq
qa2xrbC1pqeloaCYiIKGhoSGfXR0cHFrbVNCPj5FS1BcWFRbW11iZG9mWVRWWVZWWWdkZmViZWBb
XFlhcGFmbXJzeYaSk42PiIOEfXp0Z2JkYF5kYFlXTkE7PEJGRkVHUFxvgI6To7O5v8K+vLe7t7Wx
rKyqoJqLa0c+TVlnd4KOmJ+gnp6cmpKXgXFpcHZ5lKCetbe5vru8xMS/vLvBv8C+vMLCwcHdv62w
poZzZFhXVFlQPCUlQ1JVVl9kaHFyd395fIB9dnBtcXN0hoN7f4iKhIaEhYWFhIp0anZ4fYZ9g4yT
kpGXlZeanp2dm5yhoZ6cl5iNfGpZVk9QXFlLQjAoHxoaHiw5UFlYWWJiXV9mdoyanp2eo6eusbPB
xbO3uLO7ubO2uLWuqqSgobVuTEpZdH1wbmltcGpqZ2RnaGZiX1hVYXiDiI+UjY2PmpySjY+XrpyX
o6ChoaSdmp+koZOIenR3eHh7fYGGg4+Wc2hoanR4fYOGhYWEhIuRjY2OiYaGhYuUhn17eHxrc2Rf
Z32Um5aYmJWPlpOJg4GCe3p3ent8e3t/e3R6fH+Kk5ymnpOVlIuAfG1ZTFhkcG90amRpYVBSa3uB
jI6Mj5WUlJefqaelubOpsKymoaWooZyelYyDfXN0g5eqsbO8xcLBvsHDwL66wsnIyMG+t7e3ube3
s7Czraqwqqqqqqehm5WVj4SGg4aEho+LiIOAgYOEhHlTNTE0NTU4Q1ZugIWEjZuhoZ6boaOjoJ2e
pKeorrO2t767tra1s7Cur7WqpKGbmJean5uNj5iSlqGYkZaXpaqln5+gm52gm5aTl5+foaGYlJud
lY+PjY1BQkFEOzc5ODU0OT5CQUBBRUdKR0dLTk1PUFBSUk1PUlBPTFBQTFBedFhHO0NZUlJQWV9i
aGhiZ3SAg3t6eHR4cW5rXks+R1NHVXabdG9wc3Z5gYaLiYiDfX+Os4ViSUlGRkRFTUlGTE1SYHd8
gYaJhYWGi4aEg4F9gXZva3J/hIaPlZifoJ+bnZqXmpyanZqagIBpVVRXVllXU1RWVlJQV1RUTUtM
VmBgbXh7enx9eHh9fXh9ZGBfcWdrd4OMiYaOjY+Tj4+SmJeVkZGKgoCIg318goJ9fX+LiJqdhX98
gIaMi42RkY+SlZuSkZOVjo+NhoGDgIaBfHR0bV1QYWZkYmhnYVlWUlJTUk9iYVBgXmBqcHJybnB3
d3qcwpaChoqEf4B/g4CAgnx9gYSfxW9BQUlOTUlMTk5ZXmVrcG1vcXZ0dHl9gH96eXd3cm5vcHFz
eXRwb2tuZGJ3hYaChIWPj4aEioZ9cGpoZHN3Zk9MS09MTktJT1hrfWtpZ1xZXmlrfY5uWVlxlL/f
2Z5nYmpvbnSIkXxoaXdqZoPQ/f76mFxgbnR4dnx4d3Z3eXNzcXBmaHBvcHF2fX17eXN3e29nanN2
fX2CfXZ0dHl8d3lkWVJSZm5vbW5zcHBweYGAeG9pYGJqc3Nwc3Jvb3R4gYNwYl9gXltmaVdERk1T
VlRNSkY+QT1EUFBTUENGTFBgXl9eXVxcU1ZYXVtfYGZucmtpZWdraWpqbWVlZ2traVJHUFhfXl5f
YmlmaG90dnJyc3J4eXJycG1iXWJma2dnaGtrb3h5gndtaG5ub3F3fXh6f3h3e3dwa2dZXmZmZGJn
fbieUEBFRkNFREBBSVdWUlNPUk9SVFZZand9en2Af4mVm5qcnJiTjY2IhXqAj5uhp6mqra6tqqys
paenqKelqaejo6GqsJeKjo6PlJGPjI+YmJacn6GboKCYkpSRiHp2cnZra29wcHR3b2hpbmlkXlth
WFZOQCslIiUpLjdHWWVra3F0dHt9g5SKhaGPgoaIgnx5f4iBYmJwgnt2dHZ8gIuLj4+MjYWBgYak
5cF8dn2BgnZ0e3+FjZaWm5qdo6Skm4p/gn15eXhya3BucGlgVFt2iYyPlJGPlpiXko+JiYqNhouK
f395ZltVVEtGRkY+PllLPkFHPj5DR0xUYnB3e32OloN8g4CNkpSLi5GNk46Oi4mGiJiXl6OboKSl
qrbCw8HBxcTCxMW/vLvBwby6wr6/vLqxppycmK2lkYZ/e3iBg4KGiJiOiYqLiIyTm5+enJuYmpSS
lY+TlZSXlo+PmJuaoJ+PjIuDf4CEho2SkZKYk5eYlpWRj42GenRobXqPho+GhomKiIWCf3t6d3Zp
T0VHa3dfWVxUS0Q1JRkfLzxLVVxfXmVlZ2dlZmhkW09fcYaTl5+npaanqKqsqqqqpqSjp6eqqKio
qqilp6GmqaaorsfJlIWIbmh8dm5rZ2hoaF5QVH2jo668qp6lqKOgo6WorrKyp6eomoaCioaBiol8
cm1paWZkamlYU003UmJlc3FrcW5ucHN0dnuBjpidnJybmJeRfW9vYldSUlVYW2BiaG5tfICBiIuO
ioiGhoqNem9taVBCSUVDRT49QkdJRkxQVlNOTlBPUE9NTE1HRkNFR0VHUlVubmpoZmJgZGhoaGdq
aWpiZGZiZGBZW11mj4yPk5icobe1srO/vru+urzBvLy6t7i3t7CuqaimnpGCZ2ZweYOEiIB9en+E
hoaAZGVweX2GiIuFhouKiYmJj46IhYGEgoWPk5OYlJqgmJ6gqKCYnKizwri4r7i7rKmpqaWhnZ6m
ubOpsrGxsLK3ramkpKiqmJKFhJaYmJqcoaajoZyYkY2Ghn15fXlxdHiBg4qLk5iYmpidnq+3rq+v
r6mps5WKjpWTiomFhIaDfXl0b21iWVNMRkBKUGBSU1dXWVxZXV9kZF5ZWFVYVl5iYF9dW1lYU1ZY
WFtfaHSEjZeYlpiPj5WOjIZ/cHRqYmBdWVBMQDw+PkJHRU9Za4GMkZyss7O2v7+5vr6ytraxs6qh
loNyTDc4Pk9of4WTmJ2YmJWTlpp5c3N4d32Fj5OWrMjJwsHCwb6/xcG5wb68ubq/xMywqaOUfWtf
VlRQT0c5KixKVVxdX2Ribmt0c3N2gHduamltcHJ2eoGDgoSBgoCBgYGCdFNUXXJ3goyNj4+SmKea
m5qdoKazp6OhpJ6fmI18bl1cVVBSTEdBNSkjICAaIDBCUFdiaGdlZGdwhY+UmJ2jqKyysru7u8HF
wLe2ubeyssu8qaGhp21HQElYa3RwbWlnZ2tlZWVmaWVZWFVfd3t9jLCVhoSIjZKNj5GNipGboZ6a
naGeo6ejlIZ6c3Z8e4B9gIKAgYB8b25uc3h6eXd9io+NjIqOjIiIhYGGkp+Ge3d7fGhhWVlmkZ+Y
l5iamJWSlZOXiYKEg3x6fICAent4fYKIk5yjpaGkoJiPhoJ9bmJMTmF0mIprZWVoZ15mfImJhomO
kZWVmKCjpKaupqiopqaho6Wgnp6akoN5d3tzdIqos7rDwMG5vMPEwMLAxcTKzL+ztbm8vrCws6+t
r62qqKiqoZiXkomLioaGjJOMj4+LhoaChIaBc0QoKS80OEFZa3R/jI6VnqGjpKSdnaampaCkrrOz
s7a+wMK8vriytbm2u7axo42Mj4+Oj5WNjYyVqJqXnJuhn5ygoaSan6GhmJWTlZaTkYmKl5qUjouK
iUtLPjw4ODc1Mzk5Nz5ER0dLSUZMTEpMUE9QUk1OTkxQUlJOSU9UZWFPPkA+PkxZVFBSTlJUWFVQ
b7yWcnB6e21qZGJZTzgjISk1XI93bm9reISJho6GhYaGl490dF5EQkpHTVtWU01OU2Jlhn2AgIaB
gYKJhoaAfIOAa2BieYOFiZGVlpicn6GenJiWmp6hkn9eVVZYXlldWVxYWFJSU1VTVYZnRUdQYmtv
dnuDiYiIhH18hIh0ZWiDfHiAioqMkZKSlZWUk5GRkY+SkpSTnaaKgoF/gIaJhpKTj4mAfH2EgoaN
j5GTlpWVj5GOj5WXjoSGgH99fXt9c3KLXD4+TFllYmRgWFRQT09QVlBOS0ZQX2ludHF4e3p9fYCG
k5qapYiLioaBj5uJgnx0hKHv0E01PklLV1ZHT11kZmZpa3ByfHx4eHZ5gIClnnZyb3J3eHh4dHRw
amdoZm2CiKCXhoWIhoqXnI5wYmhnaGtqWUpMTExLVGRwb2t0eXuEfHd0ZVloaF9WhMeKZHyPdmtn
aWtwbnBwaF9kYmJphNz+/tlpWWJteHt7gHt4eHJ0enRzdGRka3N0d3l3eX19fXx3am9vb3N7hIB6
eHd5fXl7eWBdZoSBbWhqa21xb3R3fIWGeGtoa3N0dnFzeXR0d3R4ioBmaVlYaXpmXlxXUlNXWVdQ
TEZBREZHTVlpUkdTZWJfXmBfW1tcWVtgZWRlZmlrb3Brb2tvamZqbmpoamttVkdVYG9ram5wcG5y
cnd0dHFzd319d3N2a1xbYGJpa25wb3FvdHhwa2Jma2drb313dHl3d3h0a2liXVtdYmlmZ2qNyJ5W
PEI+PkA+QEJJVFRVU1RQUFZYVllccn2GgX2Ej5ifpqGgmpaSjoqGgoaOmJ6lqaysrKWmp6mjpaim
oZ+knqGjoamulIyKj5ONjo+Nj5aalpqbnaOspZaTl5aJf3RvbWlnbXJzdnJtcm9mYmVkaWheWFNS
NyUjICMjMD5PZXZxcG5xdnt8gX+Ci4mGgoKEgoCCgoVlV2JxcGtydHqAgoaGjYqJiI2LiI2WiX2C
iIR4dGtqeoOLjY6UmKGmoZiGfX99e399eHZ0cW1ucGhbXnGIjYaLipSRj5ONjIqKiISFhoSBoY9f
U1BNR0ZJTEA+Pj0+QkZEQ0FBR0xha3mAe3yAhoOPj5OYlpOSjJOUmIiIiZKTkZWdoKamoaatvMXF
xMrFx8jHwsHCvMHCv7vDxL7CvLOppqqmnpqWiX9/moR4gIWChIOLioaIi5igmpqbmJubmpSOk5KR
mJuaj4yUlZKRmpOJhoKCgHuBjJGUlY+Ok5OSko2LjpSAZ2dudIKFiouGiYyGhoGBg315dGhXRURK
TklLR0M+RUcnFhYiNUVOVGViZWpmZ2hkYllNUGJ9jJeepKCfoaaqrbGwra+ooaGmrKysrKSpqamo
p6empKSkpJualo98b3BvbXByaWliZFxZfaGlo7avpqOhpaqsr6+ur62npKWglouKiouJioZ/bmdn
ZWRqYl1XSzVZYmZrbmlmZGpvcHJ0d4SPlpygoJyfnJaRhHprZVlTUFNTWGBiZ2p9i4uRj4+NiIiM
jpeLfXRycF9PPkBDRkNGRERFRktOTk1MTUxLR05MSkpJT0tERExfZmtydG52cmhoZ2ZrZWdva2po
ZmRkXF1bWVhpa3uRl6SqsbW1ubq8xba8vMDEw766sLOxra6wsqqjl4prZnN/f4GGiYJ9f4WKenhX
S2V4f4CDg4qRhoiGhoSGjomChYSFhIiMj5SYl5iYmJakpJaYnqyxr7Cvt6yvraqqqaCdn5+5zqqq
rrO7s6qvraeqpZ+PgYKOoZaaoamvqqmzrrCojYKJkX12dHBueIOJpJ2bprefnaChpKeqrbGurZ2I
f4SEi4+PioaFhomAdG1zamFgXFVLQ1lPRktSVlZXWFlbYmptZmJYUlRVW1lbWVxXV1hTVWheWGJo
eoiTmJihmpWUlY6JhX97d2RZXVlVV1BHOjk+QkdHT1yPnKqkn6awtr7CwLy6u7e2t7Wyr6CTiXNT
NywqM0lne4uPlpqWlKCSenJ0eHh9f4GIkpWh2dHEu7rAwcXFv7y/vrmztru/vrOtoY90X1NSU1RQ
UDkuNE5YW1tZYWltZ2hpam1tZ2JiYm18dHJ3f4GAgIGCfXx9f3hbQT5LaX2DjZGTrKCWm5+eo6Oj
prGqo6GhoJuYlop7aFlQRklHSkE+NTQnHxoeIjJNXV9hZWplaGd7kZedn6assbKyu8K8vr6/ury7
uLOzua2mqqSDYVhHPkFEVmZra2lmbWZiZGtrYmBfW12AfH2Jm4mKio6OkY+PkoqGlZiYnaCsoJic
nZyWj4h8fHt6fHt8e3yAgHtycGt0cnh8fYGOkouGiI6Pi4WDiIaGiIR9e25mYldXWWaLnaGdm5KY
nZaNk7mYgoWNg3l6e3t7f4KEj5idpKyuqaqmo5WJg393bltPWW2tpG9dXWZiX2VueYuPkYmMk5Sa
naaspaGopqSko6GjoaSqoZiNi4B3YlVgeZuvrrC7xcG+v8DIy8jBwsTFxcC+tra3tbCzr6+xsbGt
rrCum4+Jho+Lk4qGioyJjoyIg4aFgYp7QTUwLDM3R4SJdnyGjJejp6GhoKOjoaGkp6eqrrK6ubq7
urm8uLvAu7W6vLOhiYaJkZOLk4+Ukp2WnpyXnp+amp2hoaGjqLeYlZKMiYODfXSUi4aIiIaIOzg4
NTlANTAyNTU3PUpHQ0lHR0JER0dLSUpPTk9MS09QTE9MV2JOPDU6Pj46PFJTUk5STU9LTk1ox6Zp
YWpubWtqYlJOQigYHi5HUGB9gWZreXx9hI2WjouMkYF4VkU+RU1ZTUdQUFBXeGVmb3p/hIWEhoKE
g4CGjZhgU2mBioqPj5OYn5ycl5ecm5uanZ6GZ1ZUV1tYU1dQVmdkVlRTT05NUktGUmVrc3uCiI6P
iI+JhYKEhYaUhoCEiYyVlJeYlZeYl5aSkY+PkY+TkZSamJWbnI6OiYaNk4uFf3x7goaIi4qGjaih
kYqKjo+Ji4mGgIKBf3hyeXhtUkVCQkNBS3x0a19UTUpMTk5PU1BMSlBbaHh8eXd7e3t/ho2Mi4uO
jIyTjIaJkYiBhYN3j7+Ea0dFTk1QYlhZXGViZWducXN0dHN7eHZ9d3p6d3BtcHFycXN4f4aMaWVi
anp9g4KLhoqRjIaEj3dpcWlqZmJgWE5ZWHNvdHBrdIV/go1/doCDZVNSV2a24J1VX2hna3Fyb2tt
aWtpYF1YXWV/3/7fd15ocHqKfXt7enp9fHh0dHNvbm9wbnd3eXmDfHyVlXRqa2ttc3d8gIB6fYB4
eX17and0c21tb29vcXNxc3p3d3lza2tua3F0d3Jwdnd0cXZ9goFbU1JVV2JdUlBUV1ldYFlTTFVf
a0tHWUtUYmRiYGJkYV9hXllTWV5kaGltcHFzcG1oa25qampoa3FwdHJlYm9qbXFtcXt0cHNydHRy
cnB0fYF/fHJvYlheYmhqbW1ramtzc21mZWReXmFma2tucG1ra2VhXVlZZGJia2lrgnt0W1JMTEZF
QUFEREdKSktKUFBUV1VQUlZpf397f46bnJqfpZycnpaMiop/gIuboaWqqqmlpKahn6OkoZ6cnqGe
pKealZaTlJWYuJiGg4+TlpigoJ6anJuenp2amIl5b2pqa2tucHR0dHRycGtlZmJoZlxTUEs+NSwp
KiMlL0Ria21obnR3dn2BhIF9gIGFg4GEgX+DhWRYZ25waWtwdnx5hImIi4uPjYmEhoWDg4WBgXNo
XF9od3yGi4yWnpuWmpWDgX19e317d3d2cm1ta15idICJj46Jio+Tk4+OjouJi4aIioaGdllUUFBK
RENHQUBJRURBQT5ARUFATFlreH99goJ9houWm5qYlZGPjouViHaBl6ybn6Skp6GmqbO/w8TIx8TF
xcLFwsXBxMnFw8nDxMO+wLiyt6qppp2GgYaSiX19eXuAhoOCgICIpKehoKGcm5iWkpGWj5GUlJGP
lJKUk4+Pi4qDgXp9d32Kj4+Rj46Wm5iVp5KPjHlyaW53hI2KhoiJi4uGgoCCgXZ0cVtLTVBQTUdB
Ozs4MCIVERcsRE1NXWJla2hkYWhiTEVOYXiGjZOfoaenpKmusrWztq+qqq2xsK2tsaikraqop6qo
qqmopqSYmIt9bWtra3JvZ2ZnZl54prO1rLayqKyws7Gytq+qvLKqpqCkmoyLi4iJi4Z2a2doZmRi
Zl9SR0pZZXFyb25udHRycXJ2hpSXmJignaGfo5+bj4R3ZF9SUlVZW19ma4WPjY6SlJOMj5GSkoyJ
hnpvZllBPUA+QT5BQ0NCRUdJTUdHS0pQWU5LS0VJS0dQXGdycnZ5eHdxc2doZmZiaHBlZWRlX2Fh
V1ZXVVhfa5uYoaqws7K2tbi+vL67v7i2tbWzs7GsqqquqZiWiG1ocn+IiISDgoJ7e3dmWEdLa4CJ
i4+MjZ6PoZSCiIiJlomCgX+Cio2RlpKUlZeYlZisu5iWrreur7OysrGsqqetqKOen6Gor7bOtq2s
p6isr6+hmI54dIGXlJihqq2wtrWsssmfi4SBeHZxcXmDnKyqo6eoqaalqaWorayvrqeunHx3fYiG
jI+MiIWOiIF9enB4cWRfYVJHSUpNUFBZW1dWXVxia2pla2FTUlJWWVdYU1hWTk1QVldeYW+Cjpea
naqgnZaXlpeOiIaBaWBeXWJbUkc+PD4+RkZYfIuSnKSgpK+5wLy3vLy+uri3uba1pZWFdFw7KCAo
O1VufYiNjY2PjX13dnR6hISDhYWIlJ+4xb64t8C+vsC+wLy8vry6trazuaaRfGhVTUtOUk1JNSw7
TFNdYWBhXmBiYmJqanRmYF9fan95cm94eXp9fXZ4eXZwZ0czM0dneoaNj5KloZuYoaGdoKemp6Sq
p6Gho56akoZtVExGQ0JDQUBAPDIpIxodKkFhYGFmaGlqYneqmJKVnamztrnAvLvAvru5uLKxsrOy
rKmfmHZiYE41OztBTmhtZ2ppa25ubm5oXl1gX2pydnqAiIaMiYmKjI2JiY+YpqGcttCfkZSdnpiL
ioOChH99fH9/fIWAe3FwbnRyd3iCjJ6zj4GGiIiKioaEfXyAgntwa2tiVlRobXqYs6OYlZiVko+X
pJOFk519enx6fIGAgoqeqaqmraqopaqhlY+LgXp0ZlhTYHR7amJgYV1iYGJui5qMhoqMjo+Yn6Sp
o5+jpqeqp6SqqaqpmI2FfG9VS1Zpf4uYrru7vMG+u8XFvMDEv7u/u7y3uruzsbGtsbW2sKmoqq2f
hXl9houWj4qLiYaSko2KhIKGhnhLSVU9NTRKe4N7g4iTmp6hoZ2ho6WmpqGjqq6xs7m8usHJu7i+
vLu/v8G4sKSPioSIjouLipGNj46Sl5GUmpiamp6hpLKloI+RkpSOhYF3Z3J8goOLjIY+Ozg3Nz1S
Rzo1ODxETEdOR0RERkdGSUNNTlBPT01NTkxOS0tMRUE8OT4+PD1FVlVPT0lMT05KTFh0YFZdZmJl
ZmVkRzo4JhYaKEVQU19laHCPhXqBiYaVpIp9dnNrU1h5W01KTk9HSktHW3l8mqqJf4SFhoB8hXxp
WVNWa3+Eho+Rlp6joJ6enJiWlZKSjmZPU1ZWVlVVV1ZVVFNQUFNNSUNBQU1gb3iAiImMjo2Oj4+M
jY6Mj5WPlJKTkZihmJual5WXmJGNjY+Tk5aVk5GXl5WRm5uRj6GXjouOhoKGiImMjo6TkYyPj4mM
jo+Ng4GBgXx9c3R4dFA+PkBCPkBVUk1ZXFVOT1BMTVBVVFJOT1tmbnRyeXx7fXqFiYaMj5GNi4yI
i4mPlI+PgXR4cWVWSk1PUmFnYGJkYmhmZWhra3N2dHZ3dnl3dHRyaWhycnFyeHl9a2Rka2JpfYOJ
iYaslH+LmISAamtxb2tpZGRdU09ea2tucnd8gH2BiqqbhH94XVNct9zRtqF5anJ3fYB4cHh5dG9r
XldbYoPbvGldZ293obyJdHZ7fH+Benl7enlxbm9wcXR2eX2Dgn99f3FxdnRzd4GEe31/hH94dHRo
a2hmaWtydHBxdHh0dnR4d3x0b3Bwa21ubm9zdHF2eHd6d2BVVVhYTktSVVRWWVlbW1lYUExUV0FB
TF5gXF5hcohnXVxcWWBia3Bxb3N9gHNxdG1rbm1wdHN6ent6eW9kcGtuc3RycnZycnN8dHF2dnZ4
e4mYi3BdVl9na25zenRwbnZ0bWdfXmJhXVleX2FiZGFlX1NQUlZgaGVna2aCfVtQV05HRERDRUFE
RkFEUFlOS1NcV1VbXF9qcnp6jJ+dnaChn52YmJSKioV6iqGpp62tqKChpJ+dnp2blp6gnaGkoI+N
j4yRj4+YkoyOkp2SkpeeoZ6bo6Cbm5qfkYFxb2dma4Z7cm1qdHBxb2lnZWphWFBUU0pDPjc0KSYr
N3l8i2tnanN0eHx7fX98eX+AgH99eX16ZVZhbmJlaWtpbnN3eoF/gYWGhoKBgoSBfHt9dFxTU1lk
bnJ9iI+Ri4KChYiFhoJ9e3t8dG9zbWt0a2ZufYqGgIWLiZGTjYqIhomLhoKBgnt4YFBQUE1NSkZD
Pj5APUBCQT48PEFHV2Vte318gIOJjJidmJWVj42Ni4p7a2mCkpijs6egpKmpsb/HxcXDycjExcrJ
x8XFwsTHwcfHxby/ubazrq68qYF6gICAg399e399e316fZOlnZ2cmJWTlZOSk5GNiYSOiI+PjZKP
lpKIgYuEhXt4hZaNiIqNjo+YmJidj4J8dHNnaHKAhqiehoCGiYuGgIJ9eHNvWU1TVVhQTUY6OzUs
HhERGSs8QkxUXmRnZmFhYldHQ01keomOl5qenqOnqayus7WzsK6uqqSqrqqmoaSorKqopqqtraqn
pKCfnY94aGVpa2prbmtobYqos7uws7ixr7Gxs7a1rq+zs7K1sK2poZWOjJGhjH93cWpnYWRnZFlh
RlhoanBzcHR5c3R0b3yLj5ial5ucpqSfoZ+dj4B0a1ZTU1ZVW2V7d4mLjJGTkpKRj4yIhYaAdHFr
YlNCNz4+PkBNPjpAQUJHSUdJR1BPR0VCPj5CS1xhaG9zeH19enujhmtmYGZnYmBlYmJhZWJeWVZQ
UFNbgY6bp7G4s6+2u7m1vL+5ubeytbWzr66ws7GjnayOZWhwf4WGiYaEg318cltTWWmDnJSTjo2S
jIqUi4OIioqGhoR/fX2GjZSRk5aWko+SlJudk6G/taetrK2wu7Owt7OmrKOenKGmsLitqq6vqqSp
rJSIiHNud3uJmqytqq+2tqysrKqcfXRzcXB3d4+ytqq4qKGlpqqsqqqqr6ysqaCXfXR/j4mJi4yO
i4uDeXR0c2trcWJcWVJSV1leYWdlV1VZWWFnYmRvZFlXU1NUUk5QVlNLQkZNVFllc4qTlpalqp6d
npiWlZSOjI+LcGdocGhcUktHR0lFSVl/goaSnqGhsLe8w768vru8t7i2s66hmIl6ZUEsHiI0VnZ5
fYKEgX18d3qAgICEhImNj5Wan6G3wLy1s7e1vMC5uLrAu7m3s6mtnoxuWU5JR0xUTToxOEVSW11g
YmdoZ2RiX2Vgal5dWV9kbXNwdnR3dHZ3d3p7cWtiRzc3UJeKiIyVm5iemJ2lp6Cfnpqnsa+npaOl
oaOWjoVfR0dHS0VDSVVAOjIrJyIjNVVgYmhnZWdncZeTm5+gqrK5urq7u7q6t7e5tra1s6yhmJGG
emtYPjU6OTxOaHNwbXFybm5wbmpiYmJqXGdudHd/gIOEiImGg4qPm6ChmJimsJ2bm5+YkoqAe3p9
fXx9fXyAgnyCcmpocnFzfI+Ym6aVjYiFg4J8fHt5fXt0b2t2gG1fWWtwf7WznJeYnJiYnp6akpGP
j4aDfX1/gImTnqqsqqenrKqsqqmklYmEf3lzZlNXYmpnYGBdXWBiYmqAlIiFi5ORjZacn6GkqKem
qKisqqeopKGflouEdlVMVWFtdIajra62wMHAw8jJxb+6vLu5t7m6sK6srayus7uxp6SlpI14fISG
hoaJi4yLi4aMjIiCgYWRfV9gkpFXQVVncHR7j5SboaSnp6Sno6Ogpa61sbC6vL+8wMC7vL/Cxb+7
v761oIyPk4aEhIV9eYWPjY+Sk5WXnpucnZ2boZyOj5KSi4aGf2tlbXR7g4SKiDo3Ozg0Oz5ETU1H
NzpQV1JGQ0NCRElHSkVJS01PUE1KS0ZGS0dEPlJZSkc9NDRDUE9TTk1LSkpHTU5LTFJUZFtOTU5H
cHFiIxYiOkpXZGVifY6DfYGDhZTFmnt4eXGAgnlrVUlQSktOTE9id32Bg4OBhIOGiYt0mIFSS1h6
hISJkZqfoaObnJ6enJibloyNgmZSUFZTUlBVUF9XTU5OT0tHQlBJWG54fX2JjI+RlJaUk5ecmJeP
lI+Pk5aXm5idn52YlZGUlpOVkpWSkZSTj5aYl5WYmJyYmJWRioaFg4KFhoqNkYyIjKaVioaGhoSI
gXp5d3h3dG9WPkE8O0BDREVBSVBUU1BQUlBPTlBVVk5TUl9vd3yAfH2GfYaJhYaOkYyOj46PjImT
lJGDdnZvYU5LTl1iYmhmZ2Voamdpa250cnJ2d3d5eXd3dGtmaYB3cXN0hn1zZWVlYISNi4qLhIiG
ho6YmJWUgXRva3JuZmViW29ub3N2eHl6goSEiZGNjZSXn2uCsI6ToYWAhoR9hYqGf3+Ce3NnVllf
X3l0aGpuc3aYrIVyd4CDgYOUiYmEenx0c3Jucnl7gH2Af3x6cHFxcnJ2eHaBfYKBgoiAfXl6fHZq
ZG93c29wdHR2eX2DfHN0cXFwcXd0dHJyd3Zyc3J3e11QU1ZMTFBUWWVcWVVZXVxVR0BCQ0ldXl1i
ZGdrhm9eXWBhaWttdnl6gIJ8enhzeHducnd9fH18dnZ0cGBiaG13eW9ucHZ0cnd8dnh7e3x8gYuO
fHBlaW5ta3Jwb250cWptb2VdWWFZWF9TR0VHTE5hWFJSXWtrYmFkZHKAdlZQUEtGREVHR0VKTlBu
i3FYYo6EcGphVltre3h9kZeVmJiYl5udnJWPjYWGnaajqKWppZ6cl5ebmJaVmJaPlJePi4uNjoyG
hoWDgISKjJKWmJqcnp+fnZ6lqq+tlXl0bmdpa2tqd3Zua3F0b25nZmBdVU9SUE5HQ0Q8NC8wRVth
ZGlwdHB2d3x6e4GFhYGBf3d0bWVXUlxqYV1hZGhrbXB3dHiBhoJ6iIGBf3h4eXR0a1lNT05ZYm19
f3uCf32GjYqKhoOCfXx5d3dzbnZxZ3R9goCRm4mLnpuRk42KiYmJlKF/d3NcVVRSSUpWTkdFRUVD
QEJAPUI+QEZTXm9/f398f4mMlZqdmJaYlI+PjpdtYoOWoZ+cnaeoqK6zxcrJx8fIxcPIysXEyMvI
x8jDwMnIysW8s7Gsqq2ovI93fX17dnh8gXt5dnl2fI+Vl5udnJuUlY+FgH14enl9ipKRlJqchYWa
f3R3cneMioaMjo+Lj46WjIaDfX9zZ2Jnb3uFjoiBhIOAhYmGg3x0cnFiVFBOTE5NSTg3LCgjIB4a
IS44Pk1VX2VhXllVSUVKUmJ0iYuts52anaeqr6+ws7q4qaatqaqsrqypraqoqqeqsaywqKm2qJyc
loJrZWJqhY97d3t/j6evtri2u7ezs7azs7GzsrW7t7i2srWuqZ6Vj42MhoBzamhmZHiTalM3R19p
a3Jrbnl0dHh2fYqWmJiXm6Chnp2cl5iTiYF0WUdMVFZUWFlgdIqPkpqSj4+RkY6GgoF4cWlhU0dD
PT47Oz09PkdFRENHR0dGSU1GQkA9Q0RMYG1xcHN/ho6Lgo+EcGdoYmJiYWJlZGJkYl5YVVRSR05i
hJOepaqwtrW7tbW1sbq1sq+ys7Gzr62uqqGamINnbnyEjouNjIOBfX1uWGKGmqCfnJeWqp+SkYyG
hoGAgoCAfXp6f4mMko+NjpKRj5iUi5KhoK+xu7e4rKqqr66urrGuoJ+cnKOloZ+hqaimmI2OhoBr
YV5ndImoo6ius7OztrWup497cnJ6gXl9lKWqsL6uubGtr7CpsLGtqqmppZyKenh5fYWDhoaDgXt6
dHRwamhma3BnZGtwcnJ6dHNdU1BTXV5fXWBdWWJWTk1PS0tOS0dARkdQXXB5ho+UmqSelZWemJSY
lpOOgnppanBxcGtqa250bk1FTm2BiZGbnaGqsbzBwL68t7q7urWypp2YjntqUD0sKTpeb292eXp/
eHN3eIGEiI2Ij42PlZecoKyzs7CqrLC1s7K1t7a2sqysoJiMcGBPR0ZKUFdOQDxHXGJiaWtrb5d7
YmJgYF9iYmFZW11oa3B0cXJwdHBrcXBuZ1M5LzlThpKMj5aXmJ+cnqGto6GhoKXJuqWkpKOjo56U
hnRXTE9URj5DQD48PDUyLy86T15kYWJiZ2dqanePm6aws7a5t7a3tba3tbe2s7OxqaGVjIN9bVtB
MzExOE9rdnNvcnNydHFwZF9bWFtZYWRrdHZ6fH2BhIaJi5SfnpyjpaGmpZ2Yn5SEf3l7gIKAgH2B
hn9/gHxwaWhqa3mPoZ6YmJaRi5KGhHp4d3R3fXRwcoOYiXFkZW6GoZqYmJuhn56hoaGemJKSioWA
e4CCkaGhqq2qrKqurqmkp6GYlIR9fW5pTktVYGZgXmRhXlxdZmpxdHiEj4+Sko+bo6Shoamvramn
qKqopKipoKSbaFZTWGRqcoiXpKyyusS7t7q+vLy4t7OwsLi5sbCtqq+vqq6loJiMeHN5fIOJjI2I
jY6PnqCPi4yGjJeDYmSBiGZbbm5wf4OPl6WoqKWopKOopJ+hqrKzsrnAurm6urm4vMfHyMDCt66m
iJGTgn2AenRwb3qKjY6XlpKgnZqWnJqVmpWPko2NmJKIbWtubnN9ho2IPTk1N0Jqb0cyLDdEZGBK
RkRGQklJSUxPTk5OTEtOTU1LSktPVGJQRT5JS0VLUEJQVFNMTUxQTU9PUExHTVBOS1NMR0lWUjUZ
ESNHU1lWXmBiZm9weYSGjY6SkYp6dHhudGtZUEtQTUxSV3R7hoiFhIKCfYCMeV5TVllTUGuPqZKS
mJ6jp6ahn5+cmJqUko2GfWFQUlRPUk9PTExNS0dLRlJJQUdmdHyGj5WVko+YoZ6doJualI+Rlpue
n5yamJ+gn5iUlJKVk4+TkpWWmJaXlJWYm5eWm5yhnJaXkYqDhoyMj5GOi4aLjImGkouDgIGIfXp2
dGZKQ0ZGRD5AREM9PkNGV2dZU1BSVVVQUlBQU1ZZXGpzeHl/i4+Kio2RkY+VmJaWkY+RkpSYk4V9
dnFpU1Blb21pb3Fvb3BubW9wbm5zcHJ2e46Sc2twb3ZveG9tcHaBeW5iZHB8iIKBhYWCgoiLp6SV
k46Bf3Rub3NraWh3eHt4eXl3fIGChImJi4+RkpqnpZ+ShJapi4SDiIaEjIyFhoJ8eWZbWV9gYGZo
ZmhtdoGEe3p7gIJ8f4yJkomBgIV2cXF7fHx8gYJ9goB0cHR4fXt5gI6Mf4GDho+egHZ4iJJwc3p7
d3R0dnZ7f32BfYR4c3d2fYx4cXN0dHR4cXN/allPSVBnVVVVWVZbXlxkYldHPj5GUGRgXmFkYGFk
aWRgYGZrb3d5eoGDf3p3fYSDg4F3dnd3enl0dnRpYmJncHR2b3JxdoVycnd4eXx5f3+BhYaJhHp4
enZ0d3Rxd3l3bmlmZ1lYWVldWU9HPkJDQ0dOVmJvbW1pYmFiYWdoaU9MV3pZRkZHS1BSVnKPgG5w
gX99f2pdYHFyd3+Ej5WTl56hnZecm5eWk4qEmKytoaGjnZ+amJWOl5eMgIKGjIyMk5KJg4SFhoGD
hoaKjZOXn56ptaahpKaqo6GThnRraWJpb3Jwa3BxbWtqgnlgXlhVUFBSUFBMTlBPVj4yQVdhZGdp
b3N0dHd2doiGfX97cWpnYlVLUFVWWV1bXGJna21zd319d2Zqf4mDd3Nwa2ZiWVRHR0VMVmp3fX+F
hImNioqGg4WCgX17e3l4dGtwcXqEhISJjYSfqZiXk5ORkpe34JtzjGtbWVdMSUpHRUVEQkE+Q0RC
Pj0+R09fc4F9e3uGiZKVnZugnJqWlJSJdGVphpicoKOoqqaqrrnEysjExcjIysnOzsjHxcjLyszL
x8XIycK8saWpr7PJmnd/gXx/gntxb29ub21ri5aXnJ2YmJWPhX14dHSFhHh9j5WRiIGAioB0dHN0
d4aJg4mNjIiEiY6NhHt7fW5iXmhyd3l3fH+GhIaEgoCBf3t2cmBQT05QTU5MQC8nKSopKCIfJjhC
SVBTWFdSVFRTUl5haGtzeY6gnp2joaOsraqwvLWpp6qqqq2op6mmqKqsqqmnqq2uqqSgnZaWhWtl
Ym+Gj4yJiY+ksbW+wsi2srOzs7mzv7y4ubuzuriwwruxrKSesaiLiHtya2pnYmddVT03U2Zyb3Fx
dHlxa3F3hpSdmJeYnKCdm6CgmpKOhoBbR0pQVllZV15pi5iep5+SiomMiIiMiHltamJYTkI6PDo6
OTw9QENCQEJGQUBDWVg9PTpESlxnbnR3fYyMpY6Ef394cmtqc2diYWZrZ19dXV1ZWVJHSVR0jJqg
pqq3vLq5uLa1sqyqqq2zr6qqpqimnpeOeGZxf4SGiIaIiYF/fGtkfZuenZ2fnZ2nmpKTj5qPgX99
fX19fXp5f4OKj5OWkY2PlpiLipadqq+2sLKsqqmqqKqsrqann5iVm5ycnaGXlJiGb2VnZGBfYmZr
haSdpqy1u7mztrmtl3hxioZtbYGcrrmwrrGzs7Gwtbqyqq2wsa6poZ2AdHNyeoKChYaEfXpycnBr
aGJrbW9wcHmAd3R4eGtdUFNbYmFeXV5cWVBMSkQ8OTc1MzEwN0lfc4SPk5KYt7OdmpeamJKVj4aA
dnSBdHN0dHmDla6YWz5PcoWMkZeboKm4vr/Dv8G7u7m/y7Oon5yYgHNrYE0+R2Jzc25xdnZ4ent9
gIWLjYyPj5iYnKGkpqWmoaGnqqWoqq2trq+nnp2Wi3diWEdJT05KW2JNUFxpampta2Rqe3Jqa29q
Z2trZV5dW11kaXBva2tvc29xcGtkRDhAR1Z0s62hpaShnaGen5+hpaWfoa+qp6impqmhmI+KhnFd
UE1GQ0NEPkQ9PDs1NUBSZ2hmZGhqYl1fZXuToam2vLuzt7m4s7e6t7O1qqmlnI6BdnJpYEMyLC85
VaePcHF0dnlxaWllYVhSUF1gZWlwdHRze4CBhY6YnqGkp6SnqKWloZ+qk29rdIGTiICBg4aJiIh6
eXJtZmlujqGcm5yXk5SVj4aEhXZzcXh3d4SLjZebkoN7cYKMkZiYmJ6kra2yvLOnnJeTiH98fYSa
pKmqqKassKqvrqylppaPi4B5c2JKRklNVlteYGBgXV5gX2BpcnqAj5WSj5aan6Wop6eqr6msrKeq
srWvrLuMdGJfYGhvcX2Sqa2uuLyzsba/wrq4t7a5s7KvrqyuqqekpaCdkYZ2bXh6fImIi4aJkY6V
ro+Ki4ynmHloaHOAaWd5eHiAiZKanaGkqKmppaWloaWvs7a4v7y7u77DvL/ExcLAvMC7u7qIe319
e3t6cW1pdIyMjZaalZiYmKqnl5ORj4yLjoaGgHJramttbnp4gnlAOkI9PkJDREVPWVNNUE5KSkdG
RklKRU9dT1JQTExQT0xHRklQTklGRkpWXk9VWVZNUFVQUFhWTk1KRkxMTUxNT0lLUE1COhoUIUVW
XF1eYmFveXl9g4qLiY+zsXh0eYaVeWlSTFRrYVVfjJODfYOFfX2Dl4ZkXlNQU1NQVG+UlZehoaGl
qKahoZ2dnpeXlot5a1hQT1BTU1RNSUpLRkZFRUE8RnGAho6NjY+WnaOkpaWhpJ6XlZicnJ2bm6Gd
mpidoJublpWYl52YmJeUlpeYl5WTmJSbnJibp5yJhoaOj4iKjImGg4mKhn9/e317eoqCdGFLRkNC
TEZEREE+PkBER0dTWVdMUFBUU1JQUE5QTVBcYnN3eXyAgoaPjo+TlJSbnJiVlZ+Xl5eRhHRza1VL
YHtxcXFvcnNzdHFxdHl3dnR2e3hzcHN0eHRraGd5iGtpi5F0YF1hcH+DgoGGhImGlaqhm5KPj4uE
e3h0kn1nYnR4c3l7e4OLhIaGiIqTk4+Plqqkl5WPjZGPi4WBhoaGiISGiIV9a1tbWF1iampwhnl5
d3Z0eYB9ioR9fX2AgpaJg4GBgYaKg4uFgX+BkX1vcXJ3dHd7e32AhoB9i4yAfX99enR9f3p5e3h8
fXyEhoGPwo9paW1tcXRydHZ0dG5xcYBqUExQTFBQVVhbWFxgXGBeXFA+OT1OWWFhX2FiZGdlaW5z
Z21/fX18gX19fHt7fY6Nl55ybXNzeXRvampnZmt6bm5xdHd0cm98ioV9f4GEhoSGiIyGg4F7fX19
gHpzd3FraWRiX1dVWFdgVk9HOTAyO0Ncb3R3amVkYl1eW11mVlJVfY1WQkFNXWdzjZuRg4WSiHhz
al9daXZ3dnqFipugn6Gho7esmpKYmo2Ckr+hm56hoZ6VjIKFgnR3e4F9gIiRoYR5d3+GioWBiI2P
lZqbpaijo7Osp6SlnpaOgG5ucHBucHFta3F0bmlrZV1hXmJbVFBXV1NTUFZvVzk1UFxiYmltd3lz
dHR0gH93d3FpZmBbUEdOVltSVVhZWWBkaHCAiXFmZ3KKlntxbWhqfXBZTkU+PkdQaXl6fIKGlZeM
jIyGgIF/enp6eXh6a3mSeXJ6gZebiYaUoaCdmpaUmNP+y39eWWBdW1RLR0pFR0dFREFDQkJCQEFE
TVlqfXl8fIaLm6aho5ycnJeWl4xxW22SnaOhpKGmrrWwsrvEy9DRzszLyc7RyczMy87NztDLy8zJ
xMGxqq2uqqSYgXl/fX19dHJtb2tmaWuIlJOSmKOSiIB8dnZ2e4aVj5uGgHJtcXJ3dHBrcXF5iY2G
gYWJhoaKhoyCfHh2a1tZYmlwd3l8eXx/fH99f4ONfXRrUlBMTU1MSkc8MCssLDRHNy4zPkBDSktQ
UFZgYmZrZmlte3h4jJqgpaSgqK+wr7GyrKqqrbCpqKippaWqqqymqaqtqKehoZqclo+UhGFqhJSL
iIyKlK/BwsfQ1by1u7a/v7vCwrGvs7e3try8vLnOuKavno+OjIJ0aGViXV1WQjdQhYFva3Ohj3Fy
fX+OmpKWm6GgnJ6doZyYjoaGj3NOU1VYW1dVfZWSlZqcmpyVhoSGg4iGf3JrYFddUDk1OTc1NDg8
SjU5Oz0+PkNFQT47O01TZ3FzdH2Ei42GioWDgIB6dneAa2JhYmdqZGJhX1ltaE1HR1+BlKGor7e6
s7KvrbGsrayqraynrKaknZqTiHlgXnF6g4aGioaEhoB2anqPmqCko6aln6ipoKSXubiIdnR5eHd3
enR0fYyWi46PjY2bs5SGhY6er6yqt6yusainp6esqqmloZiOlI+PiIB2Zl5MQURSV1xdYG10e4yz
tbK3s6yysq6sgnJ0b2tzj6Cmqq6trK2xubOvtra1qqqqqaiflHtydHSBhYqEhIiGhH1zcGtnaGtt
cHF3d3x9e3l/inlnVlVYWFleXFlUUFJNRUA9NCsoIyMxR1d0io+VmJ2dnp6cmpeVi46IfHhvbnxz
c3h7f4OVo3pGOlBue4KIkZabpa67v7qzury7wb+2uK6hmI+GgXRtZmJla3BydH15cXJxdnqGiJqT
jpSdpqqnpaalo6CgoZ+ho5+eo5+go6GXjYN0ZFNXUExMUFBfcWhraGltbWppaW5wb3J3cmtnaWlq
ZWJgXE5SYmtoa21uanJzb1xEPFdlW3iqqaOvppugo6Sjp6Oho6GjoKShpaWlp6GYjo2Yg25YSkJC
RUQ+PT1BRD08RFtoXGJpbWtua2Via3qSpK62srW1s66sqq6ys7Osp6CTgHlzb2pYPjAvOURUj4Zr
cIV9dnNvfWtgWVlZYGJna25qbW+BhIaNl6CgpKCmrqmpp6igo6mTa2d2hpOOi4yIjYuNkYp8cGJp
a3qYoZ2empqam4+NhYOMb3J0fICMkY+TlZSSj42Fho6KjpGbp7m/vLzIs6mmnZSIgH19jZ+qqKmn
qq2sqaimrKiloZ+Sg31zVkpHSURQW1xiXmJhYVlZXV9rcnSJn56Yk5WWnJ+os6qprK6vs7i1ta2n
o5+Rhnhra2tyfYiPn7C1tbGzr87Dtbe4s66ys7WuqqqqqaOhnZaJd2txeHuAiYmFhYuGiImLjY6I
iZaKcmVpcnRydIGAf4CEj5aenqGpqKaqqqajrLKxuLy8vMHCwMXBwcHExcHFwL67nXZ5e3p3dpd2
a2ZncImPjY+eoJqXtqWPio+PjoOLhXRqZGZrcW5ufWhiWTw+PEBEQ0JJRkpQUEpQTkdHTExLS0dP
TFVWTEZKWV1TSk5HSk1QSklJR0lMTU1rX1VOVFJQT05OSklMTU1OZXqGZllWWWdfQSUpSlVfYVte
bn94eHyCgomOl5qShX2IhXdiXlNdU01UYWd9hIaEgoB/gH2lhl5bXWBfT0dPVoCapKSpqKqqqaqt
paShnJaUi3ttYFRWVk5KTE1GQ0ZGQDw5NShEeYJ/g4yYk52loaWloKGln52cm5+hoaSmpZ+YmJuY
lZuemo+Plpibl5aSlpSUmJ2YlJSXlZiTko+PjI+PiYB/gYSEhoN/hIOEhXRubmhUQ0JGQkFGRkNA
Pjs6PE1YTU1QVlZQTUxPTk5QT1hTS1Bidnt7hoaPjoyTl5iYmJucm5yblpeYnph9cWtoT0prfHl7
e3d4dnZ5end3fH2EfX16dHBvaWtijX1uX2hvgm1mZ2FeX19icn2DhZKLg4iepZ6Wl5GPioKBfX2S
iWhvgX18fYGGmI+IjJKRkZWqp5uPl52Rj5eWlpePioaGhoOCjoiIhn10c11da3yEgYGEf4B8fZGe
k313dnh6fX19fX+Pl4qFioyKjIqJj4x5a2tydHR7ent9fYGYi39/hYiEf4KCcoB9e3t8fX98fYGC
fYzMtnZlam5vcXN2dHR0cXNteG5XTUtOSk9XVlhUWVldXFxlVEU+PmF0Z2FhX2JgYWJgcH1tanR9
en2Fgn2AhXx9gYSBe3p8eXRuaWhiYmFlZnBwbW5ye319fYKMin19gISDgH+BhoiIg317enp9fXh9
f3FoYmFeWVhcV1NTTEo6NDE0VXSDfXBrZ1xZWVRXV1hbUFBNU0tLUFlrdn2BiX+BhoWNj3pwZFxp
dHF3fXt9hI+Ul5ubnZuVoKObjX15hIqJipOhpo95cGZncnx9fYOEgH+CgHx9goWDg4+ymJKan6Wm
qqWnqaqmqqObm5qRe3R0dHBwdnNzcG50b2tycX+Na1hVYFtZWFhXUlJZPCxAUFxkaWtrbXN0dnZz
c3ZyamRgYVhHR0lKU1lQUlRZVVtmaXNwZGlwcn+Ld3BqZmdmZGFfVEU+PkxreIB9iIWWmo2LioiG
hIWBfXd2eHxrWVZib3p9gYyNmJufl5ecm5eUt/LFhmVdYGBWVk5JRkdJRUNCREVEPjw9PjxHT2d4
fXp8iJezs6efnJ+eoJeWjW1heY+YpLmpo6anurqyur/FzM3Ozs7LytHQy8vRzsjOzM3JycfEwLKs
rK6uqZ2LfH1/fXyDe3Fvcmppa3SNj4+RmI+AcnuEiYqTnZ+jmnpmYGZqa2tra212b3GAj4aBgoJ/
g4OIhnx3dG1iV1hdaGtqa3BxcnR4dnl5gI92YE5HR05OTktERkEwLCopMDwzNDpBPj1AREdNYnR8
ent4c3R4e4KGmJ+cn6apqrCvqq6usLCvqrCsqqqnqaaqrKmuqq2oqaWempuWj4ZuX3CGj46PlJ23
x8vHxcTXxbq5u7i8uLe3u7m6uru8wcC+vMi+uLOsqZiOjox3Z2RmYV9QRlBfYmpvcXN0b3N/fJSv
nZiYlJucnZebmJePhYiPg1hZWVhfYnaPlpKXnJuWmJ+RhoaIjYl/cmtbVlBBMzI0MjEvMzMuIB8n
Mj1AODo4OTc9SVBmb3F3gImKjI2GgoR9fYB9cmlnYmJkYF5hYGJcVlxZU0tJTm+Gmqawqqyxqqqm
o6SopKGhoaSjnp+dj5F7ZVlcZG95e4CJjIiGf2twj5ian6GhoaGepKyfoZedn4mCe3Z2dHl/gH2F
iIyJiImPjI2GhIKDhZ+qqbK4sKyhp6OnqqqyqaCfm4uGhX17eVU9NS8uNEpbZmdvcXh4jrevp62w
rrKzr6qFd3Frb32draisqqq2t7W1tbexuLOwrqyprKacmHx0fYaSrqapsq6jkYWAc210b3R0dHR/
i4mCfXyAg3dUTlVWV1ZWWFRTV1BHQj43LigmJzA+VW6GkpSYoZicoJ+YmJKPi4R/d21nb3F2eHt9
gISEaEQ+TmZ8iYuPlZuqr7bBwby/xce8urm3r6ehm5KKhX10dHBzcWtpa2lqampyfYyUnZWSlZ2k
qa2nn56hn52emJWSmJqamI+LiIV6a19TTU5MUFdWVV1iamtpaWptbm5ubnF0cXR5d3RucXBra2Zk
R0JQXGhvcW5wa3B4YUxETlBdf5ehoKOkoaGgoKGlpKehn52lp6Gho5+emJWSkZOJfGpcUkdDQUBC
PkE+QEVPa4xrZW1udHRrZGdncIahrbaxsa6sr7Kvrayzt8CploZ8dnNoYU43Li5QbWFpaGdveHR0
dGZpYGJbWF5iZ2Zqa2hiX2BggZWVoZ6kqKmqqqqppKOeoZNua32Pm5+WlZaboJ2hnJN4amdofZie
npqemJyblLWTe3JvdHmBhI+NjZSXko+RlI2FgYOOlqi5x8u7trmzrqafnJiFe4Cwr6mhpKOsraqt
rKqsqaqjlYuBenBUSkNCRVtnZWBiYV5cWVVTWWJncoaUioqOlJuUl7PUsKGqrrOvsrGxqqqxpZiT
j3hrcnJ2goqmr6ypp6WqsbK3uLWysLOuqqmpqKqloZuXinlmYmtzfIOIioqKioiGhYiGi4aAho1/
e3l5b256eoSGi42SlJedoZ+eoaihoaSssre3t7m7wL68xcTDxcXHyMq/u7yNc3Rzc3B2f3FlaGBh
c42PlZ6hpKWonJaUjIaEgnhvZ2ZqamtrampkUEVEPj49PkFBRURKT0tKTVNPTlBLUExKR0tTWzwq
KzFMV1ZXU1RPUlNQUFNbVFRSVFdZYmVtbllOT0pLS0lLUGeL05hTUld5hWRZU1VNVVhcYWl3d3h7
f4OIi4ycqq6Vi4SCeFlbT0xSZ2BzhoaUjYWAf3Rxc298amFgWVlQT0dSjKWfnaCmqKanrKqnn5+a
mJKKfHBeXF5cWFBMRURARU9OQz1JZHeGgYiPko+Wtqyhoamqp6efoaWlp6CgoaWmp6Sem5qbnJeV
mJiYlZSbnJaXlZqYlpWXmpaWmJqUjZ6UiYB7fX99gn2FfX+ChX90cW9ZR0JER0VHRUNCRENBQT5D
RUtOTE1TUlNSTU1SUFBTTk5NUF9rdHx9io6PlJaVmp6hoJiampiYkZabkXt0cGtTUm99fZWPf4CC
gICAfXyBfHx9grOPb29ZSlJkZ21vaWprZmhqXlJBPlh3e3d/hoORrbWdmJiblI+BgYKGqqqYiYyI
gX2DhISEhYiOk4+OlqCdkpOfmJiTkZKUmJynoIiDhISEioqNi31xdIGFiYuOhoaIjYyOjpSViH16
eXh3fH1/jI2KjImKkY+KjI2Jk39oZW92eHd2fYJ9d319gYaDhoN7eXyLiHp8gIGAfX2AgYiGioZ9
hH1vbm56gXRuaGppbWuNjVlJRUlLUlNUVVRdV1ldXllqSTlAUG1hVlldXmJlYmJpbm1tdnd5goZ9
fXt8g4WChIN5cnF4eG5iWVJVa2pmbm1zfYSXlp6RhoaFg4WBhYaIiYWJjomFf318e318gXdqZ2Rf
WVlVVFVWUFBHQTowKzVieIV2aGJiXVlYVVBQVGtURkNGR01Yan2FgoF/fYCJlImFfXhwZml0dHd7
d3R4d3x9fYOKk5abl5OJe29vdHyAgISFem5vZ2p9ioaGjomBfXyEhnx8eXx8j8KymqGkqJ+nqKyq
qqSkoZ+gnpSPhnxva253eXFub29wcG9obm9oZWZmX2FcXWBdWVRDMSw6U19kZWtvcXKRjXJpcHFn
XVBQST48RkRDSU1UX1tbVFlYVFdeZmtqam5wbmtpbWtmZV1VT0dGUGV4f4CDiZiakYuIhoaGg4N9
fXt8fGZTTFZpcnR9ho+hpJyclJeYl5SWrIx2aWBeXl1WTEdHQ0ZJRERGQ0REPkA7PkdSYnOCioyX
nbOxo6Ckp6empJqPdn2PmJyhpaipqaqwsLKzvMnMzs7S0c3FzM7LyMrSzs3OyszQycXFuK+trrGu
pI2YhXmBgIx9cnSAeXJveICMjY2EfG9yhpOanqeqpp+flHxnZmJlaWlub25ydHiFf3l6goKGgn18
eX2PeFhMWGBiamVob29rb29xcnRya19TSUJPX2RPRkZCODEsKikuMDEzOjw9QkJDTFdrhYOFhomG
fYCCg4ygo5ueo6qwrKeopqiup6iqraelp6mqqqyoo6apqqyopJyXmpKIhGZfdImOj5KfsrzIx8TF
zNfKt7O5w8K+tba6v8LFv8DIxcTQwby8vMDJpouYoYBoYl5iZGBYVVZdYWVmZmpydI18mKqgnaeb
l5uXnJyXl4uBg41zW1VYZHaKjomNjJebnZ2eoZOEiIqMjYFyaGRZSTgzMTEzMzMvJhoXFh4mLzQw
MTE+OTpCT2txc3uBj46MhoWGhoN7fX14dHd8aGJnYmZiYVtXWWFiU05QXHqRnqeno6GenZ6YmJia
lpGNlZKPjpiId25fVVNdYGJpb3Z7hoqCb32UmJWXnJ2dpKahpqagk5GRioqDe3Juc3uChY+Yi4aK
iImEhomIgn9/hqCtt6ynqKymo6itqrKmnp+Yg3Nta2ddQywhHSUzS15na3F7fX2BjZinsrOzt7G6
qbOmd25vd5SmrK6uqbCxt7a4t7e1s6+xrKyzo6ChjXyWpKmysrG4xLGmpqyPiYF7eXZ/gYOSspeD
gH2LglxFS1JhWVVWVVNQTUxHQT00KScvNUZZeZOYnZ6hnZqkoaOYlpSRi4J2a25rdHJ3fYB/e3Ru
b0RFXnSGio2OmJ+quby8u7m+wbmzs7Oup52bm4+Ngnt8eHZ5cWRufGdkZ3SFj5iYlZWcpailnZqe
oJ+cnaOXjo6Pj4+Pg312bmVYTktNTVNWXF9dX2dtbm5tcHJycXN3dnZ2eH19d4GegnFwa2JQQUJM
WXd0cGtpbXRvYFBHSVmAm6app6WkoZ6hoJydoaGjoKCfpKajn56Yj4qMi42GeW5gUE5HRUdCRUVJ
UGFveG9vc3hycHNxbmt0fY2stritqqapqq6trKqyv6eTfHRzb2dYQDMyPVZia2FgZmhmZ294Z2Jh
YFtZaW5raGRiZWpcSlN2jZufn6W4r6eprK2oqKehj3R5lK2opqipqqWsra+tpYZycHKPoZ6fnZ2X
mpaPoJGAdnd4fYOKj5ebmpuVj5Wcl4aBho6gu9XNwrW4wbmvqaqkk4B7hKGssK6pqKqnqq6qqqyv
o5yWjol6allPSkdFUH1wZnR3Zl9gWVBXX2iIoZuPkpGfloiRpLCmpayuv7qzs7CxsbGtpKOhkneF
jX2Fn8G3sK2tqqyxrayurrO6s6iqp6GlqqiglIZyZmRocnl/i4qYj42Gio+LhoqPi46Kj5SYqrB6
am90gpeXjYqPlpWYnZ2doJuYnaeys7Wwuby8uri7yc3FxcXJybq2s4Rra29xcXJxbmdiZGFrhpWa
nqGmrc6xlop6endiW15iYWlramRhYFZHRUo8QT5AQ0RFRE5OTE1PTU1NS0xMTUxOT05LNSYoQUtK
SVBQW1hTUFRPT1BTVWBiamppa2hiX2BpVUFDR05VYmJmYFxhYWVqZWFfWEtSXF9hdq6IcnR7jI+U
kZWUk4+Ni4uGblVKTFBthpWkm4+Ni4Z/fHaGfGtrdG5mYmRVU1aGp6iooKOqqqyprqqnpp+Yko+A
aVhZX2FdVU5OVllfa3B5eIWEgouNjoqUlZesqKako6OlqaSkpaOgn6GlpKGenKCYl5yfm5iXl5eY
mJuYk5acmpWUlpWTmJabmI6Li6+VZHF5fICNk4WFhYaDfXh3UENDQUJDRERHREpHRUBCRENGS0xK
TFJQUE5MU1BNT05OTk5OVmd0eoKJmJiWmJSYnaGgnZedn5eam6Ckhnlug2FVcHqBiI6PhoCEhoKD
gn+Eg4CAgH97b1ZQVFRWVl5iaWptaWpcRjc6YXR7gIGBhIbDy6Wjp56YlJ+qn5ykoZaTlJOSnK6K
e4WLjI+RkZGTmJ+nl56bj46Pk4+SlJiTjoSGi4aJhouUjoqMi46KjY2PjZKTjY+OkZGOj4uEfHqA
f4aLj46Mj4+Oj4mNj46Gg29rhIJ4d3N5fH19f3x/hX99e3d/koyGgn+BgoCBgH+FhZSKdnuGeXNr
a3J0dHRybmpubXdqWVBHTFZqXFNVW1teXFlZUEU5Nzk+UFtXWF1dXVxiZml2c3BzeYSBfYaGf32B
hoGCjKZ5cHN0m4xVRz5MXWRlcoKNj5KYm5eWpJyKg4KDhoaFhoiGiIh7fIF9hIh9fGZeX15bWVZZ
WFVTT0c9MSolNWBoaGRlZGFbV1NYVlNQW0xBQ0xNVGl5f4GCfYOCi46xmIOAfHZoZWt7gnpxdHZy
dHR4e4aNi5iThnp6amJqb3R2d21ra2BkeIKLlIqGiouFgIqgfHF2fX2Ckp2urKWqr6aptrawqqWk
o56jqa6nhXBrb3FycXp0cG92cWtqZmZlYmRkb2hlYWRhXFU8KyxEVWJkZmhvc3qEdGpvbV9ZUEIz
MzxGR1lUQ0ZWVU1MTFNUWFxia21yb21wa2loZ21uXlVSVE5efXl7fIOJlJWXkYuNioWBg4B8d3Ju
ZVBLR1Bga3+CmJ2dnZ2dm5iYk5SLhn1rYl1cXFlWT0pCQkVHR0NDQkFCQ0FDSlBihKG3sp2fr7qv
qKWhn6GknK6to6CcoKSkpKetuLKxsa+8wMvQy87R0tLQzs7QzszOzdLOzc7OycW6qq+yraqjjpuI
e3mAgHx4eHR0cm90cX2OiHRnaoCLlJ2prKqhoKCfoKN9Z2pudnN4g3Z0dHR9e3yAj4h/d3NxcHNY
Sk5TVlNZW2FkXmBuf25ra2RmXlBEQUJbVkdDREI1LiwrKi4yOURAPj49OkNPZHSEio6MiY6Oj4+O
j5ihoZ6epaqoqamhp6qnoaevqaqmpKasqqajrKqqpqWmnpiTkoh5Z3OIiouVmKW8xcPHzsXDyce7
vL6/wbu3t7y8wcPAwbq5wse+vMK/vrOqn5KOhnFmYWRteHNlZWFgXmBbZG1vbWqCoKqhn5qamJaW
mJSShYF9eVxQV2B3lImMk5STmJicoJ6enoiGhoSGf3RqYllMOy8zNy8vNSwjHx8lKS4yNTIyMzc1
Nz5MZ3N9fYWasY9/g4aEg4CAfHdxcoZvYWFoaV5bXlxbYV5STlBUZYiVlZqUkY+OjIuKjYuLjYaE
gIB/dHBiW1VST1BSVFlhYml0dGt2jZeVmJiYnpycoaGhnqCYko2LiYJ4bm96e4OKjYuJkYqOj4iF
gH+Be3iCm6m7qqWhn6iqqqeqp6Sjn5N3bWJhXGJbLBoYIkNcbXRydnh0dHSGlqmyuc7Bs7O1uKqL
e3d6mqmtqbGsqrC4u7O4u7i1uLKxubyqoZihnaSvs7W1vLy2sq6yrKikrJyFfX18g4yhnImJgoN5
eVdMUF5ZU1JWVlJQTUdJR0MzLDRKW2mAlJiXm5uYn5+fm5SJjoqEgHNraWtzdHeCf32CcGdXPkFZ
eICGipKWoKy1s7m7x7yzsrCurKyppqOdlpSPi4F/goN8ZmhrXmBgbZ2hj4yKlp+op6Sjo6Cfm5qc
npeTlZSJiX1gXV1UUk5HR0pXYnF0fYFtZ3Nyb2tweHZ2d3h4eHl9g4aGhp6ejXlpZl1da2BZaXZq
aWdlbXR0ZVhVZ4icp6qsp6mloZ6tqpyYnKCkp6Cal52hn5iTlo+MlY6DenBlV0xKQ0BDSVVgZ2pr
cXh7fXl2eHJ3d3t7irWzrrGwrq6pqqemrrCjmot3dHBva1k7NTtFUlt0Z19hZGZiZWJfX1xYVlll
a2RgYmBgYE5JZ4GOlZqftbusraysqaScm5iGc3qesKqosrizrLCzscOznX9uc5KanJ2YmJihnZWN
g3p2e3qEiYmSm5qYnJiWmpaLioqLk7nN1MK7vMK8r62qqqGRe3h6nK6pqqqlp6qmqq2xr6epnZOU
j4BuZF9YXlhmjYWCiouBeXNdXFtwiZien6Gcl5yLgoWMmp2ls7azs7m4uraxsrGqqKGcg4mRgYqt
wrWwr7OxsrCvsK6vs6msp5ufpp6empGEc2JdYGh/fX+GipiPhoSGiYyGiJaSj5GXnqOkrIhwaW2F
tZ2EgYyVlZWcm6Slm5ijr7WwsLOzuri+vsHHy8PHyMLCxMC6fWFmdnd2cHBxam1rZ3SFn6iqpqm2
17ealHNdWFJSVVxgYGRiYl5YUEZWVV1bTkRETEtHSlBUT1BYV1VOTlBPTk5QU01ALyw0T1VTTExL
T1BSUlJWXWFzeXp7gH90aGBhaGtWS0pNTlhcYGVra2lrcGtpZ2FphGpYVWFmcHh8fIKJjJKWkY+U
lZuxkoOGjXNZb5Wem5iVkaaciYF/f3ttaGhra2VhZVtZWZy7qqemqqenqqysp6aloJeSjYJvWFZd
YGVmZ213f3Fof4uPmI+NmpiPjIyMk6e3rqafn6etoKGkn56hp6eqpamhnJybmpycmJeXmJiYlpaW
lZyemJqXm5ubmJiWj5OIjpRTUHiTi4qLj46Ii4l/iWVBPkZFQ0dKRkNEQ0JCQD5BQUVFS09QUlBQ
U1JPTE1OTVJPVU1LXG6BqpyVm5ecoZ+an6ajpaahn5qXm5R9cXNrTWJ9g4uUj4aIhYSJiIaAgoSF
iX94dnl2bldNTlVXVllfbm1nVkA8VGh0d4WLgYOIlpShoZ6YlpWos6qdpaChoJiYmJiXmpOKiYuK
io2Wj4+NjY+SlZiUk5GXmJWPkpeShYSLiI6Uqp2KjJOUlpKRjpSRj5KUk5KPlpaWl5WVj4iIi5iY
kYyNj42Ok5ialIt8amJqbm9zdnN3eHp7eXt8fXl6dHqSinh8hYmJhYaEhYaGgH19f3dza2ttam90
a2ltaWZndGpXTkZGUFJUU1VUVldYV1ZFOTU0OD5QUFRUWFlZZHlnYGZocHuEg319hoaGhoWGioyD
enRucYXO0YMxKT5cZGt8i5KWlpiXlpymuKaJg4OIi42MjIuJi4iFgnp3fIB9dmVhW1ZVWXKCVkxD
PTIuKSkoNUphZWJcVVlcVlRTUFJWVUA+RlVqeoKBgYF/gH+aln1/g4aGgW5hZnN8d3l0bn9/c3J0
gZKIf3hzc3NkV1leYV9bU0xTYXeGhoiLjo2RjouFhn1uYnSDhoaRnqyqqaqwqqrF1qyhpqqon5yn
rYp3bnBvdHRvdnZ0d5KXbWVlaGptbnFoZmZpZmhnYks0KzNHX2JmaGpucGtqaWJhW1hONSUjODU5
XGJEOj5CRUVNVFZhZmptbnN0cG5ta2tpcnhfV1RkW1tyeIB/hJKXlJGNjIuNjIWCg4Z8eHFpVERB
R0tcdJahoZ+fnp2XmpePjI2IfWtiXllWVnptSUNGRkZGRkdFRUdHR0lYboSMn5yamqeopcHOqpeY
np6ampSjoJ+po6Cmrq6ws7a1tr7Ay9DOzs7Q0c3Mzs7O0tTR1trUzcnLybWusbKxrqqOfX19gH2D
hnx3eHR0enp2dHtyXV10hpWan6etqqGlpKOjnot8dHJ9gYZ9cnF0eXp5en98eXd0a2RnVklDRU5Q
Uk5OS0tHTFt7aWd7ZllUU1JQREBHR0E9NTRJOiwrLDU6RUBGTUNETF9tfYCAiJGUlIyKi4uUpqyh
n5ygoaWqpqSgoaqtraqmpaqqpqGnpqqqp6qqoZ6dl5OJgoB3en+DiYybsLe3usLDvLnDwL68vrez
ucHEw768vL+8vsG8vL7BvLu5rqeknIyCeWhna4GEf3Rta2pnZmBeX2hhZWmAmqSqpqGhprGhkoZ9
enddT1lndIWGi4yPj5ianp2en5ykk4SBhoR9cGtiV0k4KCs8OjU6PDc7QEtTSkI6PTs4Pjk7TFJx
eHuAhIubjoyMhn+DhYN9end3c2trZ21uZFxcXFhbXldSVFNXeIuNhoWGioaJhH19f3l6cXNva2ti
W1ROR0lKSUlKUFVYVlhbZIKcoJuVmJaWmpuaoaSfm5yclJKGf3hyfJuJgoWMn5qdk4uLiomBf3x5
eHqRpaemp6WlqKekpKyqo5iUfG9qaWJYWU4xKSYrRGBrbnF4dHh5g5WlsrO817ytsq+urLOSd3qO
mJymr6yvuLivsre8vLW3uLezt6ablKCora6zvL67wL+ysrO1sLC3p6Oahn2DhoaPjJSEhX2KakZL
UFRVVFZXVVNMTlBJUFdPUmhqcICPjpaYlpWVkpqUk4+MhYGAcXF7cnBxd3p2e4l4Zk85PE9mcISS
k5eXo6qus7C3ubyzsK2trK6qpZ6dmJWPi4aNjH1kYV5ZXGJwpKOSkpeXnKSopaahoZ+coKGdmJeY
npKKeVlQUE9OTFBXXGl0gIaLjHlycnp3dHRwe3x9e396f4GDjImEgIB6d3FrZnGSa2Rpa2lqa3Ft
co19Zmh9l6alrKynp6qmsbCel6ChmpqepKGenqS/nZepk4SLiYaFfXRnWEtHR0dNVWhrbm52eXx6
fXt3dHN2dHqLmJugsLGlo6WnqKmqo5yUg3Z0cmtiTUJCSlRZXWRkXnBoZWJiYmJdaGRUWF5oal1W
VlxXSUpqf4uWn6e2qqiur6eloaCglHZqeZ+uta2qs7G1t7fFycWzj3BthJqkoJufoaGemI+GhoSB
hY+NjZOamJyho5eXlo+bko6ct8HBu7e8vLmxrqymno93aXSarKqqqaimraqprqqopaidl5OMfXh0
amRpaXSCiIqTiomUj29haYSYnZ6dnpOSkoyIhIiMjqGvqq+zt7i4uLCvsaimrKGOf3d6j6+6ta6y
sLOys6+uraqmoZ+alZ6el5iRcWJcYGdra3B0eX2GhoaGiIWFhYOEkZSSmKShnZeemo95bnKcjm18
ipOUj5aYmJaPkpiqrqyus7i3u7u4vsXIycXLx8G+xK19bmhrdJV8cXBtbnSBi5ifpKmqrrWzrKWd
e1NKTk9XW15hYWFiXExFQ1BVR0dHR0RLTU9OUE9OVFhVU1BST05OUFtiTmJPMj1NSktMT1JQUFJT
XnyEfHp/g4mGgoWDeGddX1xNS01gcWdlZ2trbW1qbXJrXmJucmZZWGR2gHt9hI6OkpSWmJiTlZaO
iqCbj3uKlZygnp+YmpGGjIV7eIFxaXFxbmtnYllZjrannqetrLOvqKWln6GenJqRhmtTUFlmbW1z
eIOIjI2FjZWUj5GSkZKTkY+SnqqppaGjpqWno6Ojoaijpaeen6Cgo5uYm52YlZiYnKCelpqcmJeb
mJuYlpybnJeTj4qCX2l7mpiom5OSjIiMjYmJa0c8RUVGRkZHRFNKQ0RAPj5EQEJHSU5QUFBOTU5P
S0xOT1lmUE1TZHiBlaGbnJego6OjpqahoZyfnp2dioN6fYFianqgxZaAhIKKiIyNhYiIiomCf4J9
dHNzdIFrbVBQUlZXVldYYltycHaCgo+EjY+LlaOfoZ+Xmru4rqWkqKWgoaCfn5qflI6FipSVkZKP
lJOPj5KVl5WSlZSSj4+WlY2DhY2IhpSbmpeWmJeSkpaVj5GTkpabnJiXl5eUlZWUkpWYlpOPkpGS
lpido5SPj4ZwaXFwa3B4eHp6e3p9eX9/f459bnqDfX2DhISGhYmMhYWEgZOGe2tma25wbmtqam5p
aG56aVxTTE5YW1teX1xTVFdYUD0zMDI0N0dOUFNUV1lbXl9ibXZ5fIN/goaDhIaFiIWLiYB9dHSO
0f73eSgnO1hweIOPlZicnZyfnqCsppaRkY6Nk5afo6Cbl4mCg319ent8aVdTVlRUV1JNRT40Kykn
IiIlOltlXFlZXVtXVVBQSk9KQExYaHZ3e318goiChoaGj4iBhomSgmtmendzbXNwcW9ma252e4B7
dGpcT01QUFBVVVBQU12CjIJ9gYaKiYqGjImNhmtZan99lqGdp6qssrCqrK6vqqelqqWmnqGWgnFr
b3BtbnJzbmtujYZuZ2dra2txinRua21wc2tmZj4rKTxbaWZma2pya2dnamBgVD4fERUaIykxNTM1
PUFCTFZXV1tgaW1ubnx4a2lnbW9lXl5ZVVVXWGl0eHuFkpeUkZGPjIyGiYqCfYB9jHZMPkFBPU5w
jp+dn5ucnpePjo+LiYJ/aGJeWFtPUFJLRkZDR0xORkE+Rk1HUmd2fYaVnaeswK6gs76sp6qtrqig
o5ahqqqhoaaqrq21s7O3u8LExcvOzc7Jzc7O0dHU1NHc5NXIyM3Jt6qutbOzrZF9gX+BgIu6kXFy
d317c3Ryb2tcZoGYoKGkqq6sp6mop6SloJiNfX2Jm5p6b3d0fXdpcHdyb2liYl9VT0JAUGVtWFBE
PTlAUFtffIhtZ2JnVkdHR0pGPjgzMiwqLCwwNTk8PkJQR0Nhc3R7gYiKk6Cgk5KUj46XqrWgl5qd
n6Gjo6amqqmnpaWmqqahoaamrKenqa2qnpqVkoZ/gH2BhoqIj6SytbO4wr67xcO8u77Bvr65vL7A
xcO+vrjAwcG+vLy8u7i3raWgjomEa2p7hZSJf4F6dG1vgGZUVFtmfYicrbOzt7/B18qxjoZ7bmdi
ZnR9hIaKj5OXlpaYmJ2empeLg4OGf31zZ19WRDUvMDQ8OTo9QUVMUlZXUlVXTUREQT5KUGh6fX+E
goWIhIOGfYKGhIJ9dHRycGtpbWlmYV5gYmRbV1dYUk5bcoaCgYSAfXh3eHRya2tvZ2hgXFVQS0lH
R0tKSUZMUFBUV1ZchK2jlJGUl5SVm52YnZ+fmJSVlYuChH19iYiLkpacpaWPjY6PjYiGf31/gJal
oaCkpqOorKOjo6CnnINwa2dpYV1YWUw+PT5XaG5rbnd6f4aRn6+7vru2t7i2s7Oyqpt9e4+boaSq
ra6ys7O8vLvAv8C8zcyyqJ2TlqCnsbq7ur+8urrAv7Wws7CwsJ6RhYmGhoaLi4h/goVwT0ZNVFZT
VVhUUFRWVFR9wIBbZW90gYqSmJOPko+Nj4yRk4Z9endwcWtrcXR5eXR2d3hxakQzPlRleY+Tlp2n
raqvsK21s7CqqrGurqqlpqGcmJaTj4uJgmtgWFVTWWeElI+RkZSdoaSuqqSjoZ6dm5qenZWRjYh4
W09VYFlSVWdyfIKIiouOiHN0e3Z4eXd5gH19hYOCg4GIi4aDe316dHBzd3NkZmtrbm1ra3B0inl0
ipeYnJ+gqq6/vJqampiYmpqVmJeYmJWUk5qNjIuLlJOGhoR/eHBiVk5JTE9cbXN0d3l7eXp5fHh6
fYOChImPmJylprCqpqSjpaCYl5F/d3Z0b1I+SlBZX2BiYmJma2dlaWRibWlnW1VUUllbWFBUU0tB
T2uBi5Wdn6Geo6Wjnp6bnqOSYGF8nK+yrrG1s7K2tcK7raidjHiIn6GdnJugpJ+Xj46MhoWJiY2O
lJ2cnJybnJiXkpyUla26v7y7u7zDvLCupKGei21mdJelpKWmqqmqqKqqqqSel5Kfno19eHRvd3p5
gYWJj5GPkpKPiYabmJWbmpiclpuVj4WDfYKNmKewraqzs7Gxr7Gvqqqvo4FzdoCasru2s7Owta+z
r62np6ignZ2dm5uRg3FhXltfZ2Voam94gIGChomGiIaEjI6LkZiYpaGdmp6hmoh5c4Nrb32Ej5Sd
kYqJiYOPl6asrq6vrqqqs77BwcPKy8XEvLq8poB5bmZtgnRua256iY+VnqWqqrO5uLGspqCPaFBM
T1NVWFVXXWBVRzk8S1RDR0dHS0dLUF92YFBQWVhVVVZWVFJXXltQU0cyR05HR05LT1RQV199i4iF
hoiOjI+MiISBfHlnYk1CRVxfYGlrbW9tdnNwbmtoZoNxXlZPXXR0cXiEiImPmJWWl5aYlJGNoYF2
hpSVmJufmpiXm5aIiJiBdnNraH9xZGJhW1ZrlaClqaeoraeoqKqno52WlJSDcFVSZnR9goSFhoiN
kZSWmJiTkpWRjpWXmpKUoaSkoZ6jn6Cep6ejpaqmqaShpKOdnZidn56cnZqXmpuWl5WYmJeXlJed
nZuWlJODf4SRkpOdn56Yk5iUjIqPjYZ2XXJYQ0FBQkFGRkNDQz4+Pj5CREVHUH1eTElMR05MTElM
T09HSVlkc3mIlJyem5ieoaOjoaWlpaGcnJiPgXxrZmpyfYyPi42Oj46Pj4qGioqFg4qDhYR/end3
fHt/a2FWTlRWW1dqcXJ0dH2DgoCMhoiRoKGquqrO07OnqqWlp6ijn5yko6Csu5SJjZyclY+VlI2R
lZWUlJWWmJeWnKa4l4GDg4qUnpucnJuak5GWlZaYmJqYmJ6YmpuYm5qcnp6dm6qqkYiSj5aal5WV
lZOMiYBoZmtycXR2dHZ2dnZ6eIJ8cWdof4WDf3+EgIqUhoKFjYWCg5OCa2drbnFxc3Fqa29tbXhw
Z1NUX2ZeXF9pZFlQUlBAOTU0NDQyLDdHUFVUU1VVYmRnb3d9e3uBgICGjImLjIyKgoyJfcX9/u9Z
Hic5UGuBiIyTmJuYnJybnaChoJugoaCooJ+hsJ2YkYh/f3+biH2CaFNWVFVUUExHOzMrJSIhISE1
X2ddX19dWVZVVlJSUEI9Um5yd3l5e4GChIaJhoOJiYmAgIOIfGtzbmlobWtnaGhka3Bua2hbVEpH
SUpOUl5eX2ZxboGEgIWEhYaFhoiIi4Z/c1lfdH+Rm6CqsbGzs7Cmp62tpKenrKefnJGBdHN0c3Jr
bW9tbWttbm1maW9uaXBzcXRzcHN0dmtyZDkrMUFfaGppbnNmYl9bWVY8JhgLDRMcISYqLDE1RFBU
c25nYF9ob2+L1M13Yl9iYV5fXVdWWFRWa3h7fYaPmJeVko+Ni4qJhoSBenuGeEc1NC81TXKWo6Gf
np+dmJiaj46Jf4hxXl5iXE9HSUdMTk5OT1lMQUJGS1NpeHx9hI+YqbC1tq+ztrGpoaa3rK2xs7Kq
oaSlp6mpqbK3ubm7u7zEw8XIy87KytDKyMnMzdPTysfExcS+srq8sq6qmoZ8fYGIfYB9eHl4dHd2
dnRyZVtti5qlpKiqqqinpaeuqqqonYuCfYqUkX95dHJwb29xc3F4fX14fW9pVlhrd312aV5QRENu
rnd2homBcGFVUEpLS0dCOzg1NDEsKywzNTxHPkdHQlRqeXl8ho6RpbeYj46SkpOgs7Waj5eYk4aY
oKiuqqqnpKiqqKOjqKqppKOmqqajmJOLhYCCe3iCiIyYsLKus7m5ur7FvrvCury8ubvBw8W+urzB
v8C+ury+wb+5t7OuqJiOhnNwdnqBl4uGhoaDgoB6cmReX3Kjqru+v8C/xcre0cC6vrOGb2twgISD
iIyMj5OYl5iclpOVoZ+Ae4J8e3dvZF1KNzU5QEBCQ0VHUFBVWVtbXWJkYVZPS0RFUG6BhoiAgYCC
goJ9e398fH15gn94b218fWpiZWhfXFxcWE1OTE5Xbnp8eXZxbnBrYl5fXF5bXV9WSUVGPkVER1dP
S09PUFZSVVuCr6OSkZeampqbo5+coKCYl5aUjoaJlZiXk5iYko2Yl5KckYmJiI2Lhnx9hp6empud
pJygpqOno6GJdG5qZWJgXFxZVUlFR1Zma29ze4GGiZivu7+/vLu7urWzsKqnn4R3fYaaoaOqsbKz
t7m7vLrBxbzExLOln56cpK2zuLa4tri8vr+4sLW5v7mvo52YjIKGiIiFg319eHxbTU5VXFlZW1lW
WGBiYXKsjWpud3eAho6PjIaGiYmIiJKGhH+CcWdxcXh2eH2Ei399g4GIYDczSl9rdoGJoN3csKOq
t7Kys7GqqLG3sqqgnZubl5SSkYZ8cVlUVVVeZniSk5GWmpufpqqppqChn56cnJyYmpSMiXtcWVth
ZGZ3cHR7f4aSi4mco3l5dHl8fX18gIKFgoaOjoyKobGNe3h7e3Rzc3Z0cnNra3Jxa3R0b3eNk5eh
m6GkpdLFmJWamJaTkZWXlo2Ni4iIhoWKi4yPiYaCg319eGtlWFBSWGJtdHp/f3l/gHt6fYGGjIqG
kZiLj5SYoKGlo6qamJaMgH10c3NhT01SWWVlZmZiZWdoampnZmJuamBbUlJMSUc+PEE8OD5ddHyG
l6GhnJyho6GfmpWPi2tcZIChs7Kvs7m3s7Cwtrmyr6eajo2fqqahoJ2alpWYlJSRjYuPlZGVqqeX
k52coJaPj5eptba8v7u7v8O8tamjpJuDa2Rohp+loaanp6qsr6mloZqWk5WUhoB/end6gYqJio6P
mJqTjI+Ul6GYmpaYmpiWmpOPk6eRfZi1wdXXyaqnsLO2sKqpqrKsgXF4jaezs7Ozub+4sbCxsa2q
qaGuuJWLlI+CZVRZXF9ka2pqbXN0eH2Fg4OGhoaJj5OYm6CjpqWkoJacnYJ2a1duhYuVyN+moIZ7
e4+Ro6ipqq6xs7WyuLa+wMPLw8G+uLijjIqKenFvb2pteISOl6Cks7m1s7e1tbWypqSpc0VBSU9Y
V1BSUEU6NUBUWU9MTUdHTlZZUlJUWVlWWFdYVVdSUlRVUFNQTj5HSUdES05LTlJbdISDhY6Mj5GV
lI+MjImJg4JhRkJSXWhocHRveXZ0c3FxdG1pamdreE5SbXJ2gqmYiZGVlJSWlpefr4x6Z4aVkZWY
nJ+bmJqWlI+LiIB7cG1vcG1oYmBdWIaypKisqqWpqq2qqaWfoJiOiXxgRlNlcHqAhYiOj5ihmJeb
mJiXkpOTkpOVlZuwo5udpaGhoK+gn6SjpqqpqKWkpKShoZ2amJ+koJ+Ym5udnpuXmJqdmpual5SS
i5KYio2OmJiYmpuYmJKRqZiIhoxpcFg+O0BEQT5BQkFBPTtBQ0NFQkRMUEpQUFBOTUpHS01SUExM
UGFudoShqZyYm6ClpKejpKShpKSgjoKDgnBoanB7f4aMjIqJhpORio2LhomKiIaDgoJ9gIJ7d3Zy
dHNrWVJ0hXR2c3h8eH+BhIaMlKOuraiju+DOsa6qqqqtpaajpKCkqrqulIyPlZGUko+Rj4+Pj5OX
mJWXm5iVpNahhH+FioufoJyYmJiYnJecm5qXl5idn5qcmJSenJiYmp+hp6yakpSTm5aXlJqUj42M
gm1rcHBxcG50c3RzcXN4f4RrW194goCGe32AhoqIg4mKg5qToIZqZmdpanRwbmtra2t2hm5VZ2Jc
XFVZXF5heIFSMjE4NTIyLDAyLC9fXk1LW2VlZHJ2eHx6gYaFhoiKj46JhoJ/dH2SmsLabzU8RU9Y
a3uGk5iYm5+bnKClqaejnqawpKGdo6ahpKGbn4p8eIJ9dH1xVVBQT01TS0A0LiUjIR4fISk9YmFW
WVlYV1tWUFJGPTxPamt/f3qAg4mNhouPjIuGhoiDhIx9bWVkYWFhYVxgYWFgYmJkYVJHRkBCRlBW
X2BlbW5zf3x0en2DiImNioaPjIaDaF9rg4+YoaqvraqyvLjDs6apqaWlp6Wakoh2c4OPc2tuaWtr
aWltbnFvcnNzdHd3dHh2dnNxc3JqQzg1PVZyc2lkcmtiV1ZPPSYaDgcNGRwXGhwfJzQ+RlBZX2Fh
ZGt7hcz+73tQU11ZWWJiXVlWU1RleHd7iJORlpKUko2IhoaCgX99fXd5U0FAPkNVi6edmp2anp2Y
l5KPi4iCe2ZcVFRTUEtKVllcXFlbT0JHR0tWaW93e4SJj5WhqrXLwrGjo6eqpqWloaahm5igpqeo
rK6vube1s7O3ur/ExcTHzszMzcXFxcPJ09/b0sO5s7Cxs7a3srGpi3p9hYmFg32Be312d3p5eHNp
ZH2YpKWmp6+trKaoqaqnpqmgloSChouMhHt0cXR0d42Ujo2PjIaEfHNrcnB0gXRvc3RpYWVvdIB8
eW1zaV5YUFBQTUdHQj01LysqLzc9Nz04Oz5KYXN7fYGJj5SYmJ2empGYl5yknpWclpSGgY2hp6al
o6Okpqino6alqKelpqikpaWcj4uIiJiDgYSJhpKksLW3urm6ucDHwLq5vsG/wsLFv7++vMDCvLu6
u7y6wbyzr6qqnYiBcm9ze319f4SMiYyKg397eXhqfLnFury/xcvOzMfFw8nAurOcdHSAg4aOiJGS
lpuem5yYl5idi3t5e3h4cmtnZEY6O0FBRUlGTFNTU1lZXV5cYGRkZGZhVE5NaoSCf4B/gH15en17
f4GAhI+Pj5aPdnR0amhpZGJlX1lZUFBPUFBWX2puamdmXllZWVJQUFBQTj49TT47PkBESUlJTVBQ
TVBUWXKWnpKMj5iamJyeo5+doZ6YkpWTkpicm5ulnpiYl5eVlZWRk5GUqpaGhoKCkqGcmpaUlZ6e
nKGjj3ZwcGhlZGJdYl9ZUE9QXmp0e31/gIOUqra4ubW8vry2uK+qrqqkl3x0cYWWpaOmr7Ozt77D
xcC7u7y4tbKkmqGhpa63vr/EwL68vL66ury8uraloaenkoiPiYaBfXl6f3Rvb2ZiYGBiYGFhYmZm
YmpvdHd8d32Df4GFgoSBgoGAg4N9eW9oanF9hImPio+YkYmFgXR3XTk+Vlllc4Sjvraytbivs7DB
taqtraqzrqCen5eUjo+RhnhxYFtbWV5gcYaNk5WYnqGlqKimoKGqoZucnpyalpOPdmVtc2ZoZWt0
m4+FhIaNjKOdeX98eHuDhIqGjYmJiI2Pi5G+36V6eojJlnBqbnJ9eXBpcHR0gXRyf4aPlZadnqSm
qaGdnJubl5qdlpaPj4iCgIaGk4KBjI6IhX+EhH15dG1iYG5hYmtxdHp/fHt/fXyDiouWlo+XnpeP
j5WUmJ2hlo+UnYt7eXJualdiXllhZW1xaGZlZWJiZmZkYWZrX1VPTUpFNS8wNTIzQVlpd4GSnZud
nZicm5iRjYZwWFhunqqqr7O6s7XAw7qztbWysKahlY+hpZ2goJeXm5WYlo+PkZOTmp+moKOfm52s
m4+TmrC8vMDAysi4tbO1s6qhmHxfXGR/mpycpKaoqK2qpqejlZKRj5qPgX2BfX2Kj46RmKGfpKid
nZSWlIqOmJuYnJ2upI+SmJKXqsT3/v76u56osbW+sKyvp6aBeIaSqLm5u8C+vLq2sbK30rmeoZ6b
jI+PjHtbVV5hYmRobmtra3J3e32Dg4CAiImLnaWYn6mlp6aemJuShoBrXm+BiJW6zZqThHx4eoag
oKOpra2vrbO5urq8wMLAw7u2pIuGjpKNfWpkZ2t4jJOep7Owtbm+wL+5ur+1rKaEWUdHR0xOTkQ8
NTIwOlZbVVZSUFZTU09YVFxeVlRWWFlZXFlZXW1ZTExMWU1HRkxJREdPWW2Cho2Pjo6SkZSRkZaL
iouKhnxpYmBra3JybXGLgHNydHJ2bWtoYV45KyxJZXR4e42Yk5inm5WYkaSnhniFkpGRlpifoJuV
l6WbkZGMg313dHR2Z2llW1hedpijpKempqSts6qjn5ySi4iAeV1FTl9zfX+FjI+OmK6co6iXj4+P
kpSXlZyOjZicoKaqnpeftqagn6WosMi4paGhqKien56foZ6fnZyYl5ucmpiWnKGfn52enJOKiImO
nMWhlqCYm5ibmpKRko+KgmtdVlNFPj5GR0A7PkFAQVRJQD5AQ0dMT0tKSUtJTkpLSUZFRERKUGJ/
uKqYmJqboJ+eoaeppqmnp6iIgn1vbm1nbnqDhoiNj4+Oj4uNkY+JiYqGhIWLhoCDfX19f3d5dnFv
dnxxa2tycnh8iIqFjomMj5ihoKzx98qqqq+vr66tqqimp6aqqaWYkZSXlZWUmJOPlJaUlZaUlJiY
mJihxKCDgoWNlbq6ppiYmJ6fnpycnaOjoZ2enZ6bnp6hm5uamqGnoZuemp6fn5iVk5GVkY6DcmVk
aW1rb3Fyb3R3d3d9fWdfX3yBgISBhoN/hYuNioaLgX+YsnlZWGVqamtnamppaXaYa05QWF5bXl5f
XWFhVzowLzMyNDMzNzgwIiMmMj5VcmpwdH12dn2BgX+FiYuLjYuLhYR7bmp5iGhPQkJHU1lte4mS
mJaYmJqYoKSjn6aprKGso5+eqamhn6annIJ9eXl6dnZgVlBSVFBGNCwoIx4gHxoZIzVMUFRYW1tb
XW9YTkA0NVBtdnl7goWGhYiOiY+RhoiFhYaGf3+AcGBZXVtUVVlXWVxZW11UQj4+PkNMUlZhZ2Zr
cnd9eXR8gHyDhomGhouNiYWNa2iCkqCgqqqvsrW4s9LKo5qgqaOemJeNiHx6fX18d3Nxa2JnaHBr
amt4inhydnd6d3p0dHh4c3FYUldUYXF4aGlrZGJgWEY1KB4RDhEXGRkaFx4iLD5ES1BUWWdxdnKI
7P7QYlJbZGFeXFxcXVZSUFRqcXuEjY+Vl5OblIuGgXuAhIGEfWRTUFdYX2h6kpqamp6dm5GUlI6L
iopqX1RPTU5MS09gYmJiYmJcTUdLVmlyeoCAfIWRn7HIvLOzsamprKmmpKCgoaWhm5+kn6Copqy6
vsG8u76/wMTFx9DJw8LEwcHCwMfc8u/Hs7O3ubm4v7Oxs66UgIOEhYyRjJeKenRyc3Jta2uRjY+X
n6qtqa2sqqaqqqqsqamghYGGjImOgXdzcnqAjZeUjoqLiYF9fH18c2toa3J2dGtpanSDdnJ0eYJy
YVNQUkxOS0dHREY8NzIuMj48Ozk5PU1ha295hYmPmJKTlpeRkZGPkpWVjn97fIGFoM6xmqq2paWh
o6GlqKiqpqWjqqeqpJ2VlIx4dnx9g4KKj5imr7W3usLCvL/EvLq7v7+8vL+8urrDxMDAvLy7vry5
vLavqKWchnprbXR6gX2GhIiNjIaGiYmCf3iRtr6+xcPIzsrFx8XCy8u/uresjXx9gIWPlJaUkZiY
lZWSlZWEeXp9e3Rva2hZMkRPU1JQUlJWVFhbXWJiYmVmaWpqaGVmaGJbanN8f3p7eHZ4hnt9fISN
jo2Yn459dGtoZWRnaWVeWVxWUlBOSk1HTlxfWVlVUE5PTUdERD4vKS9QPDI1My41QUpJSkxNUlVZ
Zoufl5SPkZGVlpiamJegoZ6gpKycn6ChoaOhnZqSk5KYmJaTkpOXkrrNjXqPnJuVkY6Ulpqgn410
bW9pZmZmaWdeW11VUFRgbXJ7fImIi4yns7e1u7y5ury4s7GvpZ6PdG50cXB/nKmus7/Av7y7xcG8
v8O6tbipoJ+osLa6u7zCwby+wMHBwb64tbKqp7qdgICFf4B7fH2oloJ7f3lzb25lZWVoaGpvbnBy
dHl/f4CAe3t6e32CfXp6enduYmJzhomRlZeYl5SPjIN9f2hPOj5NWGV5mK2vqay2wrazs7Gvqqqq
rK2moJ6alpSWmI+Ee3lfWFtlYmJmfZOSlJaaoayqqqamp6GjoaGcn52WlIt3ZWp2Z2pwg3eWjoaF
hIiKkYN4dn2Af3+AiI+JhIyLj4+LjJOqnoF/nvbgw5ZyYWtzc3F0dHZ9hnR9io+Vmqqhm5yhnaCc
m5qjnpyUj46KkX18g52KfYSKi4iJiISDgnl3cmRrc2Zka3J2d3d7fHqAhIqMj5WSk5aVl5uVlJOX
k4+KiYmWdmhwXFRZXmRiXmVvcW5qaWtrbXlta2tpZ2diYFlQRj0sKy4vMzdCXW14hZOXm5qblZeU
k4+Ig2hTU3qzqaets7u+vL7AtrKzuLGppaObj4+koJyam56foKSYkpiXmpiXmpuco6CckpaWk5OY
qrW+v8Xi07etqbKuo5iGaFhQZHmGiZWYnKSmqqWcl5WTj46OiYmKhoN9fY2Ul6CeoKitrqGXl6+f
iYyUmJqcmp2VmKGTlKquteLv38mknqatra6qpKCfjHeDlp2ytry7vLy1t7+zr7XXuKGhmpeOiIV7
Z11ZW1xicWtoamZmaHN7fXx6eZGNhImTmJ+hrKqlpaGclpOJhnlrcn2GipKXjYuCfHx5fZ+poZuh
p6mtqrW3ubzCvMPEwaCNjo+SlZSLe29paHaTn6Oqsba7uLa/v7m7ubOurJFpSUFESUQ9NTMsKzRd
XVtVVVBOT1BOU1JbXVhTU1ZYW11ZWFxfYlNPTVJYVUdUSkdQU1lodoGNioqNkZSXlpaSkY+PjJGI
cnR0eH2BiIGGhpKGdnh5eHJzbm5fTi4jL1Vxa2tyfYaLkbiojIyNioR/l5KKjZGUlJeYmpygoJOS
mKSKgXlraWtlZl9eXGJqkqSho6Oprqq7rqGcmpeJfG1XQTpMYm12gH2Fio2TnZedn5yVkpGPj4+S
kY6MiouXnZqUl5eVnZigqKqqqaeuraqloZ+en6ObnKGdn6Cal5ydmJqdnZ2dm52hm4+Fho+et5uW
mJ2WkpWVkpuYioiFd2FWYltARFxMQkE9QD5CVklAQ0dFRkxNT0xKS0pJTElGR0dEQEVLfayflZyf
oKCfoaOhoaaooJqhj4iEeHh0a254fHt/hoaMjI+Nk7Cyno6GioaGg4GOkYGCfX1/enh6cnF2fHRr
bXF0eXp6goaOkpWfm5isyu7y5Lyur62ssK2pp6qqqqiooZ+YmJaSk5aVlJWUj5eTl52blpeYmJ2X
i4SFhpSVqaqhnZ+fpaCenaChoaShnpyeoZ+dmpyfpJ6bnqCsybedoKGYlJiYmJOSkol0XmBramhp
am5wcXN2doVrWVhgfYB6fYWBhoqFhX+AhIZ9f4ymiHeCZ2JlaGttZ2VnbWdfV1xiYmRiXlxZXV5X
OzEvLzI0NDxPQDkwJicnKDpTYGlxdHl7fH19g4KIiY2Tl4uEgHtybmtkYlxKREZQYXKCiY+TlpWa
nqCkpaahoammpaOhqbe3rJ6gqKWYhn15eXdzc2lVT1BQTU46KSInKSglKSsjMURQVltdW1hueFxX
QC84V3CAf3p9hoaAhIiIjpqVjISDhoF8gIJ6aVdST0pKTEtJT1VSSUE8PD5BRU9WXF9iZmlvcHp3
fIGChIGCg4OFiYyGhqmJYHuToaWnramqtbqzrayoqaWcnqCgmo+JgoGEg4R9enBpaWhla2tqcn2G
gHl0eoGIfXl5enZydGhnaGVqbmtxcHloXV1VSTovJhwVExYaGRoVFx0sO0VFTlJXZG5ucXzIy3dZ
WGBgamVXVFdXUlBTVFVhaHuPlJiVj56SjIiCg4SAgIWVbVZWcGphaXOCnJ+amJiYlZKNiYaAb2Rc
U05NUExeXWJlZ29qYmBZT1lteX19dneEi5amtbytqqesr6+qpqGmpqahnZ+dnJ6bnaGnqLLI28W8
uL6/vMPDwcPAvMC5ubm8wuj+8MGnqK62x/j8yKqtsaeJgYmgj4iKj4h7dHR0cW1ra2+GmqinqKy2
sa6sqq6urK2urJaEfYGOio+Tcm50e4aSkY6Tko+LiIJ9enR0bWpoa29yc21udIN9eXh6e3JgV1ZQ
U05QUEdEREdOTDhHRUI7OTw+S1lpe32KjpSXlJeampSVlJGUk4+CfIGNmKGwyMuyoaCeoKCfnaOj
pKinp6GjqaihoJiPjHhwdICJhYiMl6ayvsC5uLzJw7+7v8O+vsPKxLy6v8TDwsK8vMK+uba3tbGw
sp+AbmZtc3R9gImKjIqKiIqOkpGMjKWzvsTDx87QzcjHyNHKxcPBv762i3l/hoyOkZiXlZiUlZWU
lIF0dHR5dnRxYT5FcV1UUlNWVFlfW2BkYmVraW1ybm5tamhpZ1xZa3x4dnBvdHN0dHyDjIyOkZiS
i41/eG5xdHR4bmddW1lQTEZDPjw5RFRZVVBKR0RCQD1BMSYjJicnLCwrKyw3TU9KSUtMUFNdc5iU
jo6PkpOXnJyXmJibmJilsqqhpKajp6agmpaWk5iYj5OVj46Ps7OGiJihkYmKj42PjZeEYltibm5p
ZGdkYmZgWVNVXHd3e32Fi4aJi6axvL68wMC7t7KzsailoIx0amdbU154kai71sG8vr+5v7u+v7zA
t6yqpbOzubm8wrrBwbvCwr+7v7y3sa6sppGDf317enuDiY6PioyJiYyDenp3cnRvcnd4dHF2fYWD
hYB8eXZ0c3R6fHhqZ2RZaZORj5GWl5WYlIuIioV8ZllDPUddi6Chp6+ysrOxtbe8t7u7raqqp6im
pJiTkpOminhrX1ZZYYB0ZWJ0jpKWmJqhqqqsqqShpaSfnZ2fmJWUk39iYmJna21wcXCRvI6DgoN7
dHd7eHl/hoqFjY+LiYqOjpGNiYmGgoSG2/7+3X9XYWpzc3R0dHp4eoKGj5q3oZOYrKiclpublJif
mI+GgnyEeXd3iYOFgIaEgoGBfX19fHh0ZmBfYWRpb3R0enx7fIKKk42JjpKSl5WUl5eUj4uGhoZ/
d3RZTktHTFRgaGZraWtta2ppa2ZpfXNrYmJiZWBZU1BHQzMxLzo1PkdgbXyEjpSSj5SNi4iLiYJw
WU5SapipqrK3tre4uLm/trOyr7GurqGdmJ2aoJ+cm5iYoaaYmqqcj5OanKGfmpeXmo6Ij5Gkr7C1
usS7t66yuM6qqnxSSVVyhomJj5ifp6agmJOPiYqFg4SGiYWDhoiKjZSfp6ioraaqrKOhr6GPj5qY
lpyYlpidpqOoraqyuLi2sKqqqKaurqimnpiJjqCgnrC6v8C7urvCuLK1w8SnoaCclYyDfXJhaGBi
a2Vxa2hqZ2ZndoSGenNyiY6PkY+YsKimpKeloZ6Xm5OKfW1tfYiJjpGTjYV/e3d4k6WhnKGlpqWp
rbW6vLu+yLKgkpGNkpWVlI6mqHdfbpahqa2xt7m8u7y7vLi3tbOtoHlYPjc4NTMvLjAvM0tMWE5P
TllkVk5QVlVXWVlZWVlcW1heYVxWVkxHTk5GSlJHR0xOYm54g4qTkpSSm5yXk5eUk5KPi4J/iIiI
j5ORlJORkouEfHR2c3RybWFSLyMpOVlqbW9yf4yPl5OSj5GMe2RZfY+Pj5GRlZyamJiPj42LiYJ6
c3RuZmZlXllXXGucpKGopaaqqqSnoZ6ai4JvVUM+QE5icHR9hIiNkpGSnZidmJaTlJeRj5SUi4aG
goKanYuOlpiYnJ2hqaaqtbCqqqGhoaCjn6ChoKGkoZ+bnZ2foJianJucn6SWiYWMjJSbnpiYnpuY
mJaRkY6Mi4aGaVNSUEI6Pjs9PjxBQz46PDxCR0ZHT1dPRkRKTklKTE1ERkJFUISlnp2coJ6hm6Ch
o6qpoJ+ho5qJgHh3c3Jye4uDiI6tkYWBi52bncK5mqWUhoiGj45/e3l/gYF9fX2Le31/dG90dn13
fYSGiJWvwdDFqpO29fXw0rOprLKssa6trbCto6eno6GcloZ/hYiGg4iJj52VkpKTmJeSk5GFgIGG
iZWuqp6gpa6koZ2jqKWjoaGho6ShnqGlpaOhpKGjpKq3rqGjoaCen5qanqGoiW5dYmhnZWhnZ2pr
bXF0dl9YW2Jpe319gYGDg4WEg3+CgoSFloJ0iZJ8ZmRna3FucGllZW9xYFlZXV1dXl5ZV1hKNzE4
NDE1Ojs5PD0+RjQqMFBgaG52en+AgYGDhoqPj5GOip2he3BramlkYFdHSVBoe4mLiZGUlZeanJ6f
pqGeoaGnpqOowKqho5+cmKGTf3p7e3tzZlNMS09KPjInIygsKiwuODM1RlJZX2BcWVtVSkY0MzxZ
a3h5g4OEg4SGioiKl5SPjouGhIOBe3RrcWlSR0NDR15eYVtPQjw7Oj5ETlRcYWRpcHBzgoB8fH99
goaIjIiJjYZ/e25rhpWdpKisr7K1vLWtqKqkn5+fm5aTjoqKhoCGlpOJe2ZhYmJha2ptbZWlf3F6
gH1/fXh0cW9taW+OeGlkZ2htb3F6cF1OSz47NSslIh0YFxgeKzE9SWFTTlRZXmJzeXJraWRgYl1g
ZlxST1BNT01HRk9la4GKi4qNj5KNhoaJgXt5haNtVVdfZmt0gIizo5OUl4+PkY2EfXFpZGBTSkpE
R1hibWlpZ2tnZGFZZ3J3eoF8faqclK2uqKiwtbGwrqypqKelqKikoaatqqyenaGptbu7usHDxcPD
w8XDwb7Bv7y6vLy8wMPBubm6t7PT/vnAqLCzvqiEgo6Ojo2KhnxudHBra3BmbYmdpbizrKqxrK2o
rK+qsq6fhn2CiIiGi450anOCj5OTkZWPj5KIgoCCgntxaW10cnJucXF0f3+LhHp3b15cXFlWU1BQ
T0tNTlRXU2BWUE5HOzhGV2J4goiYm5SUl5qXk5ORlZqVj4+Wm52jqri8vL6+sJ+cm6CfoaGeoaGq
pqOlqKGdl42Id25weoKEg4aMk6fDu7W3ubq8zsrLxby81cu8vLzEyL6+ury+urq5vLyzrqqzpoRl
XmtwdnmAhoaJjo2Lho+JiZWuube6wcfN0s7NysjJzczOy8TAu7qoiICGj5WYkpWTjo6NjouRfW9x
dHR5cnJzZoadaFVSWVtcXl9iZmVmaG1vd3JzdHNuaWhpaF1de3x4dnh0cnqBiI6TlZiflo+JhoJ2
dnZ9fYZ8fWpWUFBNSUNCOzg+RllVRz4+Pj47QUMzKyoqKi4vMDIyMDU9SUlHR05QUldgcomSj4+T
lZqblZSao6Ojra2qqKyvrKamqqSfm5WVk5SXl5ONj5GSj5Sco5WOj4uKio6Rm4xfUk9XZ2ppZmhm
eWZXVllpnIF4goaMiYmPqLy8u7rCv7q3sq+xqqacknRiXlZKTGmNrci7sbu+wcG/xMC/vrmzs62h
oLC5vLzBxLy8vsLKyMC8vry5sbCtmIuCeHyDioyMjY6Ul4+Pk4+TkYmAgX+DgH13c3R7fICBfHt9
d3Jxb3R0Xk1HUFlvg5SblpOWm5abkoyGg3huYEpFVneaoZ6prq2ztruwrLezs7KqqKyooaOgl5OP
kop2a19bXVtbYmJeYnCCkpGWmqWtrq2mpaWno6OfnZyYm5iUinJmampqb3FucpiqhXR2d3d4eXl/
goR/hpiKhoqjj4uOiomKjYWGgn+MqsmYaWBpd312eXd2dG9zg4uPkaSjmJWqrJqanJaWlpSVkoqC
eXN0eHN7fX+FhoiJioKDg3x6enlhXWJiaGtxcXp9fX1/gIuclI+Pj5KVmJSXloqJhoF7e39lUEI1
MDlUX2Rqbm5vcm9vcXBvcW5ram5rZ2hqaWJeVk5HOTM0NTk+SmBufIKGk5KPj4qPhoiFel9OR05i
i6SqqrO4uLa1vMq+tbCzsLCtpaGfjouVl5iYm5qbnZuaoZiYmp2hn52clpWPiIiLj52pqrG5t7a6
t62xuKGjd1ZSaX+GjY6MlKGloaGViYB6cmt0gIWKlYqIgYaVnaGpsbCmqq+qraahmJWUm5iPjZSY
lZWXprGys7Kwt7iyrq2trKqhm6CXj5GgpqGkvMXEwcC/t7a/trXEuamknpqNhoBzZV5wYFhZZGpp
ZmZkZ2hxjIZrXGd9io2PlZ6uoJufpaWgnp+coY+IeXd9houGhoqIgHx0fXmAj6CgoKCjqa+vt7Gu
sbWymIyPkZeYmI+UmKegcl5mi7KzsLa3uLzAw8G/vLy1sKy6kmc6KigrMDM0NTMzPD1ZTU9QUFhS
Uk9ZW2ZlW1lcX19gYXxrW1NUWFBNVUdPWUNCR1JqeIGGj46RmpiTjI+TlZaVj42LhoGAhouRmJiY
mpScmI2Dendzcm5vc3hCJSM5TmFrb2+Ko4iEqZiMj4h8XE1yio2NkpSanZKVk4+VkYmGhHd2j3de
Xl9dXFxZZY+hpKChqKmqqaOYlZKIdlVDPT5CQ11qeH+EhpjHnoaGipOYn5qVlY+TlJeVkY7DoXtq
Zml5jJienqSprbW5t7O6urCmoaGjpaOfoZ+am5qanKGbmJyenJ2gnZGNjY6UlZiYm5iampqYnpiT
lpGIiJF7XFNQRz4+Q0VCPjo+PDk8QEJCTVlZVlVOTEtHSk1SSkRAPlSKn5qTmpugoaGgpaWkn56f
nq2nk416dnZtcnh9hoiLjo2Pj46Vo5+WmpiVnZ6WjrPor3d5hIiBeoGAf31/eoJ0cHBzc3h9g4iW
qqWl1enp2+336/LLs7atsbm4rrC+vLCyraekoJuYjYGBhoKFiomLj52gnZyYl5eVjYiDhoiLs8So
naCnqqGhp6ejoaimpKGlqqmop6akoaGhoaWmpKWmoaGhoaGjn6CfsamNd15gaWpmYmJiZmtrdHt2
XlJYV1x3fH+AhoOChYCEhomKi6R9cHx/fXRuaWliZmhnZl9bW1dZW19eYmFdWVtbXU01MTU1NTU1
PDs8PUBDRT4ySmJlbnR9f4OBgIWGiIuLjYmEjoZ5cGtma2tiZFlGV3x/iYqPkZKYmJygnJ+jo6Gd
oaWqqaajpZ+lo6CenZqIf3p7eHBkVExPTEEyMCslKiYlKSkpLjg6R19yaV1ZVzshFhouRV5zfH9/
f4WBg4yOjYqRlpaLiIOFjYFxaHh9jFRHZ1hKXF9iWVJJPj47Pk5XWVxhZmhwb3SgoYZ5f4CCgoGF
hIaKhIZ6cIWunpilrK2xs7bAt7KqqqWlpaCYlY+PjYuNi4qMj41/ZWBocmZwc253iYl8fI6JfYOB
eHJzcXFuc3Z0a21wcnJxdJKJZFhUTkdFPjIsMCgnLDI9OTlAR0xQUlNZXGRnaWdiYWRhWV1YV1lW
U09QVk1ER1Jrf4mKm42JiYWJjISKeniIimZqa2hrdICSlpubtp+fnIWAhYGAd2pnZVZDRE1VW19i
ZWhoZmdweWhxhYJ4dHN0eYmft66jo7CzqayxsKqtqaepp6mnoaepqaGcnqeys7W8urq+xL+8wcO/
w8LCxcO4s7G5vLu1s7CwtrbMvKyqqqqqp5KPj5GMiYmFc21taWlrZmt6jZqjpKevs7ayrq6xsK+w
p5SEdnmJkYyNiYR2fY+emKahlpaUj4yEjoB7fXZvb3J0d3RvcX2BhImCe3hvYlxfYFlUU1JQUE9Q
Z5RwYlhUVk5FN0ZQYnR9iIyPkYyXmpeVk4+XoKCeoKaoqq+5uLvBwLavr7idk5eenqmjnZ6gnKCd
mpeVj42EenF2fX2GhoaPnq62uLi2vMS/ucDAwMXbyry6wcDCwb/Bv7i5ubezt6+qp6STeFhKXG93
d4OGgomLiYiDiomGkr/NwLe8wszQzcnHx8rNzsjFyse8uLOWhIyPj5SYkY+Tj4+KjIuDbm52d397
eXFwf4xmV1VeYmRlYmZrbW5rb29ucm9ydHRwa2ttalxXYnxze3N2gY6Pj52nqsuujoaKjoJ/gH99
fXt9cmBdVUpCQDw+Q0dJS05EOjg4NTc+R1NMPDQyMDMwMzEyMzE9R0dKSUxPU1xia3+Pk4+PlJKT
n6melqq3ta2wsrKsqqygoaqqlI6Uj5GUj5GPlY6Rmpydn5iRjIuLjo+NgGBOQ0dOWWlvaGJkXVZW
WWeDf4CWjpGLiI6ksba6vr/DvraztrOopJ6UeG1gWUdEaqOppqSvs7y+vsTHxcTBvLm4sq6jqbK3
vsLCyMe/vs3Iwb+8wby7s6yflYl/gYaWloyMkZGSlpeUmJ2bnY+Ig4SSeXJ0eHuYjHx6enh0cGtq
ZVdLSUpPW3qKlJqYmpeamJOUjI+JgHRpW2R7jZaeoaiqr7G1taqqsa6tr6ipoaGqpZiXlol3d31e
T1BYW1tZXWBgXmmEnJqap6mwqaqvqqijoaCkoZ6Ymo2RdGlqZWhtbXNub3FucnZyc3d7gISCgIKO
p5SNhZyOjIuJjIuKiIaGgH17fHRycWtxc3x5d3Ryc3iBiIyRoKmWlZicnJibnaCalI+Rkn1xa3Jx
cXR4fIiFgnp8fX19e3l0c2JhaXRwa3J3eI+KmI+Gj52VkZSTlJSUmpaNhoaAe3RvaEs6MywyRllm
aW1ycHd0cnJ0bmtvcG1ramtrcGtrcGtgWE5DQEI+Q0lNXXF9g4yRi42LhoWIg4FwVElJV2iYqKmy
rbO1t7i5uLa2ua2vt6yls6aOgoiPk5OUm5ian56bmJ+bmp6hoaCXkoyGiIaJkp2mrbO3tsCwpaiq
pIRnU1h4iI+Pjo+SlJKNhXdvaWRdWGWBiYaGiIN8g5ehrKq1v62qsKyqo6SfnJyYlZaamJiWnKGv
sLWztbW2sLOxraqnoaWempSUmqGhpLXs2b+3t8C8trm4s7KxraGYlI2BdFlTVFlZXWJiYmVmZ2Rn
cGloYVxrlKGfnJejnq2hnqShoKWknJOmlIR6eX2ChoWFhIF3c2t7fXR9iZWcn6SnqbGwqrOumIuE
iJKUl5eRlJKTkYVxa3B/pbC4u7q+u7e7ycfAuLixramagFY0Ki4zMzU1Pjw4NUdPUFRTT0pMUFhY
YmBbXlxbWV1nZ2V4XmB9cmuBmHFJPkREWZanhoWKkZWWmJeTkpWYm5STkY2Fi4yVkpSYm56fnZab
m415eHhxbndtYldFLzVSZXFte6B5cHSBio+RiXlZRGqdpYqInZiYm5iSko2XlYp/fHdoZ19ZV2Jh
XmFnhpuhn6ajoaWkpZqPiYt4VE47OzxET2R7gYKGipGNhouPn5aKkZaOjo+SlJKGgo99a2doZHON
j5WgrbO7x8G3ur/AwramrKSfoZ6doKGor6OamJ6cmpqbpbOum5KLi5aYlZWSlZubmpaRk4+PjIuF
jGtdVVRQR0tCPDw3ODo3OT0+PktkZV5cVlRTUEtHRUVJR0NOeJignZuempqhnaGlo5yeoJqYnJOO
j4J0cm96fYWIi46RlZSRlpipnpKTnJuVlpOk7/7ihW1/hH+DgXp5e3d9e3RwcXR0dnuCjKGmrLa8
rdTu+fjVt7G1s7W6t7ewrrGvs7y5qqmemJWNm5J/g4mLiomJiI+lqp6WlIiGk4mEg46hpqSkqcm+
oZ6hrLOzs6OlrbmsqrCorKqwqKGenKGqpp6hoaOhn5+fnp+jmI95YV5iZWJfYmZrb29yd21ST1hY
WF1weXyBe32BfZaejZGPgHFxeX98eHRrZ2drb2tiXFRTVFlWV1xcXV9iXll4ZjUwNTg5PD46Oj5A
Qz5DQURLZHCEeXqDgn+BhoiKhoyMiIaCfX13cGpoZ2ZiZEthf4KGioaGkpKTmJ2foaWhn6Ohqbew
oJynqqGfnp6blouDgYJ0a2RTR0M6NDMxMjQ3ODApJykqMjE3SVZQVFlSPSsoMUVid3h7hIaMiYqK
i4WMlKeXiIaJgn2PgGtiWUMuJlC8pV9VZGFQT09PR0FBd3tgWFlmcYxza3t7d3p9e4B9fYB9hIx/
fXZxd5KYoaWqr7KxubqzsbGlpKmelY+Tlo2MiIqGhIiGhnRhXmBuamRlam10en18hYaGiYR2eHl5
dnB9d21ocHRycnR0e3ZvZ2hlXFNEQEQ5NTMxMjQ1OkFAQUpQUFNiYGRnZGBgXV1ZWFVUUlBMUEdC
PjtCR1dpfIaKhYOChYWCfXt0gbOOYHhtaHJ7gI6SlY6NjY6KhoaBhX19e2toWUNBRFVdZWRlaGty
kn+EfHl9d3Nybmt2iKGqp6SpsLiyrKyzqqmqrqihoaSkpaCamJ+kprCytba4vMLCwsrFw8fHw8fB
wbm8wLqzs7mztbG3t7Ozr6qssbajoJKMjIuOhnltbW9vbm9vd6GcmqGqqqqzt7muqqymrLmminRt
dHyCgoCCfXeCnKacl5eXn5iRj4aBfXd0f3Bua3Bwcm9xfX19iIKEgmlfXlVSVFZVVk9WV1llZGFf
YF5bT0s9Rk5ifYKGj5aWjpKSnpaRj6Gsqaqprba3trK1vsW4rayyr6qYkZegm5acm5icqaGYk4yO
j4ullHSEhnt9gIaRm6qts7vR17q2ubi6vsW+vsLExMO6uby4urq3sLOzqJ6dlHlfRkBWa3R2fIJ/
gIWJhYJ/g4mOr87MvsXHzdLQzs7T0M7OzcnFyMHBvKGGlJWSj5KTjoqIiYaNfGdoc3t3eXp4enly
cV9OWWFiZWhpa3BubXJwcXd0cnR0d3NycW1uYk9WdHh5hIaUm56nr6qpqKSfn5aMf46KgH2Jg4B7
dG5iUEpHQ0pzXkRHXEk+PTo8PT5ESUpLTEE5NTI0MTEvLj5TRkNFR0pNUllkbYOYl5OTmImRloqP
rLq6ubi5ubKyraShrsKWio+Ulo+TlpiUlp6fo6ehnJeYkpKVkY99Xk9HR0pOV11cXV1XVlxfcYGU
jY+Ki42Xl6e1t7jCy8C8uLi1qqalmJShdltPQztiyMCYk6Wvury+xci+vrzCxMK7taWlrrjCwcPK
yMHAztDFwMXEwLm5uayej4mNkpaSlZGPk5ifmpegmp2WjYmJgHx9d3R7eYV9dHh4cm5pbW9fR0RG
S1JheoqXl5iUlpiUlJWRk4+Ge3Bte4iRn6CkqrGzt7O4sbCyraywrKehpaChnZiYfWleV0xMUllc
W11cXFtZYHSLnaCorrW3sK6sqKelpqaenaGfmI50bWprbm9vbmtraGdycXN0eYGAjoZ8f4aKjpGP
jIuPk5WXjYuLi4R9fHhzcG6MdHFqfI90a29uc32DiI2Rj5SVk5iSl5+bm5qUlJeNdGdtbXNvcHmB
hIaCfX17eHR3dnp4YmVob29vcHaBiYSPjIuUl5SUm5eSl5iUjYB/enRqZ2JQPS8mKUlYYGpvdHZ3
d3d0c3RxdHNzb2ptb29xcnR0cW5qZ1JHRUNGSU5cc3aDiI6OioaDhYKDdmBQTlBebZ6pqqyxs7Oz
tbzAw7exsLCtr7GqpJGDhoaGj5GPj5ibnJqampuhnp6YlJaPj4iBi5iChZ2usbKqqqWdoamYfGJc
bouSkZOTj4+TkYt9dGliV1hVXX+AeXh8gHqGmKGoqrGztbaxsa2qp6mnpKGfnZ2bnJWhprO5ubO3
ubqztrOsqa+ooJuds6Sdpqiqr8vDt7q4tbqxtbO1sK6noLK7jHNkUExMUlZYW1xgYWRka21qW1Ze
a42qrqahqqifoKGhn52foZuYj4uFgHl6enl7fH16gXlzaW5wdH1/hIaPlpubn5impo+KiouPjY+U
mJiXko+IgmtrbnmbsLizusHFvrzExby2vLiyqKiJXTUuLjM8QTw8NzlBVmFVU1JXWFdZX15TVl1c
WVldX2JcXF1mamRoa3SLdGlBRFtxgH2WmI2TlJSampiVlZWTj5KPjY6TmJuWmJien6Ggn5ydkXtz
cnFubXJ7c2hSRVViZWptb3R7e32CjJGJfX2KepKIho2RlJuXkpKOko2OioOJdm1bXWBZXqODXIGv
oaObmpqdn5+ak4p4ZF9iXUFCQkJPXH+PjZKFg3t9iYuLlZ2WkpSVk5GXjoSBenRwbWVkYmaBmqyy
wr63uby4urrBw8DWwbOjm52fmo+Ik5ihoZ6bnaOpkoKFhYqOoJiSlJeXmJealJaYj4mIhoB5YHRi
U0lHSktKQjw1MjU1NTlDWVxZWFdWVVRQTGJQQT5FS16SoZqYmJ+hoaCnqaOanJydnpaNk42Oi39z
c3SGmIWGj42Mj5KPmq+Yk5OUj5SWmKjy/s54anF4f4J9gIWPfXRzcG5zcnaAiKCkp6Smqqyu4Nvs
6cqttrmvsbm3tbKztbe5tq+vqaGYhH2Phn2Cg4aJgnyFhYiPjYB5eX19f4aGhpWmqqSnqqa3x7eh
oai1r7O8s6etsKy1rKempqWfnKGko6WmpKOkpaSho5+Si29bWFxiZGZoZ3xvZWRiWVBOVE5SVWJ9
gXl0goqIiIWGj4mAdHFwcnR0cW9iYWZiZVtXVFRVWV1YW2FdWV9eWFRKNC8zNzc4PT49PkBCQ0dP
R0pgfHp2dHp9hpSGhYKGiomIg4KCfHdxa3J0Yl9iUFN0goaDjI6PkpKbmJiam5+fo6GlrqmjpKao
paGenpiUmo95c29oXlBFOTcxNDU4PTs9PDIrLDA1VTguNTU4QV9/fU1LW2ZucnqAg4WDhoWGi4qN
lY+JhoqGhHtwcHlbOCkuZMCteXaDg2lXVVhTTkVbamJiZG1ygYJpbXRwfYV/fXx8gYKBfH2AfHZw
kqOhp6+srra7sa+wraemppiPjIiKkYiNg4KEg4SJjWZYWVldX2JocXZ7fH+Bg396fXp2dnRwdISP
d2tudHR3d3Z9enp0c3h3ZkxEQTozNzk3NTU1OD5DQkNKUFVfb2dhYF9cWVldVk9QV0lHRUZBOjpB
TFlvfH+Dj6iMdnh9d2+Vw3hgdH+CfH2Iio+Sj5KPkYyJiImEgH+CdGRHPT1PWVliZWtyd3x/en16
c3ZzdHBycHmGn62pqa2yuLOvrrCxr6ypqqimpKimoaCboc7nsqe2ur7AwMLFxMPEvsLBwsG6vr68
vLa3urqzsrGxsbCvs7Cy17GRiomJjIaAdHdvc3l8fH+EjZSbprO2vLq8trizrKyzqpWDdGtycnZ9
e3h6f4acnpuboaOmnpGMhIF0c3eAcWlucW9xb2t6hYWCf4ZxXV1cXFhVUlNUVlVgZ2RiYmZfXVtS
Rz4yPl17gIaNkpGWlY+VmJGev8Ctp7CxrbG1t7i3ubmxs6ynqpiNjpqUjo+TlZzdyZaKi5KVj5GI
fX2ChoaEhIqPnqizusLCuLe7v8C+vsHDwsK/wcC6t7e6uLe1s6+po6CBZ05CQU1kdHJ2enyEiIaD
hYKDiJWyu7q+xM3Ozs7Nzs7Oy8vOzcXNxLzBuI6onJGUkY+Uj4mIhYJqcnBvcnh8eXZyd3hyaVdV
WVlkbW9ubnJ2dHZzdHZ3d3R5c25ufHFhV1+Fi4qYl56hqrKwrLO7qqOhnImAhoOAf4CKiYSJhXNk
U0tJTFVQSUxZUEI7Pj4+Q0JJSlNUT0pAODEwLywvOUVHQURES09PWF1lanR6eYOVf3h6gImsur+4
tbOzs7GupJ6Xm5SPo46Gj5KSkYqNn5+doKSdlY+WlZqWj4hiS0lHSk1VW1leW1lcWWaMjZiOiYqU
j5OVtt6+s8DNu7K1sq6sqZ+YkZqGclxOQ1CUoY2MobG8wMLCxMXEvLvAw7uznZ6qs7i/v8jKycXK
yMnIzszHw762tbWjjI+cmpWWk5STl6Gcm56XlpaXjoKJhY+FeHFxeYCAenlxcG1rYkpBPkVKUGB9
k5eVlJiXj5WqnY6GhYB8dIOLjZOYo6iqsLO6s66usrOyqKmqqaSjn5uTiYFrUkJDRUVQU1NUV1lU
V1Rdb4KbqayysrOvramsqaikpKSdoJqPiHdnZWhrb21udHBra2pwdHd7n494eIOEgIKLjIiLjI6P
kZGLj4+EfHt5cXR2bXBmYmt0cXFycG1wfX+Bj42Ojo+TmpuVlZiXl5eSjYVyZ2hra2tweHmCioF9
fXh6eXN8hGtiaWhpb3F2e399fYaNjo+XoZKTlJKTko+LfXJtaWJeUD4wJiAxWWZlaG10eHN6enp4
dndvbW5rbXNvbnKAgHh0b3FvYVZOWU9JSleAgn+GjImFhIJ/fXtoXVVSWGJ6mqmvraq8urOztba7
sbOxr62yu66YhoWcmIWDeHN8j5udnaCbnaShnp2al5KUhnZ6c2Rykq2uqaWmoZ2brJd2a2uFlZKW
l5iUlZOOjnpqYV5YVVBZgHRueoB8eIygoa6vsLK8vLGysLGnpqWpp6ShuLCcmLOtsLe4uby7s7e6
s66oo6ejmpikn6StsK+3uLm5ure5uLi5tri1raaau7WLeW9hUk9QUFZZW2JiZGVoZGJeXWaJpq+u
qamzp6Gapa2jnp+hrKSMhoF9e3p8f4N9eXd0e3Rra3JwdH18fYGGiIOBgIaGiKyWiI2Nio+Tk5OT
i4ODdGtrdJa8xbe8u8C6vsDDwcK8urW3qIlpRzQ0O0NOQz0+S1tqWVhXX1RQTlBbYlZYXVRkaV5r
iWtZXmJpZ2tuZmlwYEpFX3+GhYaUnqGYkpaYlY+Pk5Kbj4uKiYyUmpSVnZqcnp6hoZyYeHBvdHJu
b2tnbmtkbmpqamtwcXR9ha/amHN5d3RveoKEi4+TkZSPjZGPj4uOj4Z9Yk9NS1BbZV9ea4acoKOb
o5+anpyScWRfXF5dTUo+REpbcHN3enx6fX+Ip5SMho6OlpKTk5OVj4uIdmlgW15iZo+pqq2xu8C4
vLu1tbrAwsHI17+xpaiGeH2Pjpehn56fnYqGjIyIho2Oj4+WlpeclpWck4+RiYKGmIhwbWJSTUpH
R0xLNywoKC40OVNbVVVZWVhUVFlTUkU+PkVSf5icm5ieoKGhqaSgoaCenJ6XnarLn5KDeHJxdHiB
hoiOjoySkpGVnZ2empOUmpeVpuf5oXRweH2Bgn19gXx3fXt0cXFzeXiTybimnae2w7fe0K6vt7y1
tbO3trnLt7Kur6+3ubqqno99eX15fYKCgoSDg4KIg396fX19fH2CfYKGlayqpaisrLnbzqGdpbG2
uLauqqyur6qoqaignqGgoaGmpqWhpaqoqKGdn5aAZ1tdYmBXWVJOV1ZZXV9lbmZXUFNWVWJ6fXyK
mImChpGdk4WAeG9wcnR0dHBhYWFbV1ZTU1RVWVtVV1dcXVlXT0AvNTQ6PT5AQEJCRURCQUVHSU9f
a3R9fXp6goWYoIWDhIOEf4J9dG5paW1oZGliWFt8hoCDi46TlZqcnaCbnJqjp6+toaOlqaemoZ6f
oZuYgXd0cGdbSz44MDM3OTs7QD08Ozk1LDVBNS4rMzQ4RmFpW1lia3BvcnZ8g4OFiYqMioaEioaF
hoZ9cWtpfWo8LDtikY99c3Rvd3RnZmJhYF1dYGtzfXJiT05bYm12fXmGgHp5eXx6e3Zya3STnp+k
qq2xs7K2sa6knpaVj46KhomGiYiFhoB9f4OIZVBSWGBgZW90dnl/hIB/f3+Af3p8d3Jud4WTfXR0
eXt7enuDhoSKhnlvYU5DPjc1NTU7OTo4Ojs7PURHTFVgXmBZYHhnV1BQTEpTR0FBRkA6OjhEU22D
i7Dg5MqIZmhwdH2PcXq1qoZ9gomXlJOWl5ONi4mMhoN9g4N8ZkM1N0tZW2Bka3F3fXqAfHJycnR5
cXFyeImjqqSnqKqysa6wsK+qqqynp6asqK+nnJehoaOmrr7JzMPCwcXJzMrCx9HFxMPDxbi4u7my
rbO3sK+wt7i3uKqhn56ojYaIiXxxaW6Cio6XkpWWmJ+qqa2xtri/vLm3sq2hkn1gUFiAfHRzcnR3
fIWWnJiao5WSjIaCfXJzbWlkZmprbW1vYnB2eHp0cW5qYF1hVExOUFVXXWlpZmJkYmFdV09KOiw9
YnyGjomJkpKOlJSSmKa+uriysbGztbe1urq+v7avqqmllouGhoOGiY+Nj6Gej4+Sjo+PiIaGhoOB
iKSTioyUpbC1trO2s7a6uLi8wLzCvMDDvry/uLiztrKqp6qSfG1dQTUvRFxxd3Z7gomJhoWDhoSL
lrG4v8K/v8jU1M7N0s7OzdPSy8XFwcC7moyKjZSPiYqLhYJ9e2lvcnN3eHp8enp3dHRuVU9UXWRo
am9zcHF6fHRzcXZ2j3t0dHZ9gH10d4aOlZin0MyurrGzsqqnqqechn1/hIaJiYuLmJiPgn10YlNK
S0lOU15YT0tLSkxHRktMTU1PSkY9My8uLCwxNT5APkVKTU9QVlllamtqbX99e39/irHCwLi1tra2
r6mnoaGgl5KLgIKLj5aSi5iqp6GnoaCcnqGXl5KIfGlZTk1OUFVUV1VXVlRdZoGGhoOGiI2Pk5Wo
v7q4vsXAuLmuqqGgnZidnpSXn3JQREpZbYOnsbrMx8PDxcTDwcG6ubOThp6tubzAwcPFxcXFx8rK
xcPCv7u4uKqWmKGfl5SRkpidmJijpKGfmpONj4aDe3t3cnNwcnt3c3FvbWZOQUJHS0tXcYGKkpab
lJGOkZiVj4mIgHx8j5Whn56hqa/DsrGztrGwsayno56foaGgm4ZyWUxLU1BPSklNT0xSVVNWWFRk
jp6hpri5sa6qpqWpqqikoJ6dlY18a2lpa3Fvb3F8jGhkaHB0eXR9f3p/f4aGhIWKjImNmo+Tl5WX
lY+Gd3RzdndiX2Jvb2VlZ2dtZXCRiYKFi5KNjZOam56Wj4+PlI+LemZtamhobnR2d3+hhXh5eXN2
dn16ZGRpcHlzeHl8fIKLioqMkZWbmJeblo6GhHpuZGJhWVJCNSkgI0BdZmptcnh6gIGEdnR0c29r
b29re3dyc4mGfXx7d3RrZV9bTUZMVXGGjImFgIGBgX19dGVZVFhZZYSepKipqsGxqrC7vK6usa6p
p6Woo6aPg4+LjIlrYWaAlJKYnZ6dm5ybm5aSjYh3aVlGQlmDl56hoZ2Wnpqaj4qFd4Sdn5iTnJ6X
k4+KgW1fVlNOSktTYW53d3d0i5uhpaqpsrOzr6qpqa+tpqaloaG+s6Ghr6y4tba8u7m1uL64srCq
qKCdlpSdp6qurK6zubWxsbG2t7OwubOmoJeUlIh9f3dmWE5TUlhcbWFcW15iYl5kdpessqmlqaqp
pqGnp5uanJiclImDfHhzeHx9eHd6dHiDhG5ubm9zdHN6fHqFf3p6iYiJl4+KjI+Pj5aSjo2PhXxv
anehmrK/s7CzvMG/vMLEv7y/uruojHNeOzc4PUJBSVRbYmR8eXZ0cHBrYWFyc25wc4KNfIGkdlJZ
YWuGbmZmZWJkX15laXZ5gIqRtrOTi4+bnI6Pj4yIjI6SmpWanZ+gn6GfoaGdmJiPcWhraGlramlp
aWhqa3Brc3Z2dHeDmpeFgHp0dG1wfY+PjYuIjY6Pj5GVk4yGe3l0d11VVVxcYmFqeJuelZeel5yX
i3d6fH1oYE0+PjtBSmpxeHtxb29xenuAe3yEhoicnpOTlIyNjYaAbV9gXGJoiZyvuba1uLm4ubi6
xLq3u8G8u8G1oYV0eIaPlKCYkpaVkYyGj5GTjoyPlZKPmJiXko2NjYiBgIB8c3J3cWliZGJkZHlz
PCUmKS9MWFRUV1ZQVFVXWFRTRD5BQ2KNnp2foZ+hoZ2doJ2hn5+hn5aWlJWNiX10c3h9f4SGkrmc
houSj4+RmK+ol4+VlJKe0ql7d3Z3f4OEe3p3endtam5wcHN4e4amuaWqr6Gw3cWmqruyr7e4srO1
trO5ube21si3s7Ccm39zdnx8fX17fXp5fIB/fXp3ent9f4KCgYGbrqeurqWxsKqqrKqxtbW1v8G1
qaqwqqqqqqqpqainpqepqKiqra2oqKSjm4F5mGdWVFdPLCk8U2RkZmViamt9ZU9QWXR9hoiOiYaK
jo+Sko6FfHlvdndvYmJiYF9XU1JSU1VWWFZbXFtWVlBHNCsxNDs5PT4+PkJHRkRHRElLR05kenR4
eH19gZGViYiDgoaKnYpzb25wcnl9k5yEYGKMi4WGjpGVl5qepJ2XnaGoqLGqpqOkn6OmpqGnnI+B
eXRrZFtKPDExNz08PDo+QENDREo3LCkpLjEzNTg9QVJZX2RqbnZ0hn18gIaGhoyKioWFiYSLhHp2
cWFgTjU0R3GFf3p6d32bqpaPmpeDfYGBfYJ7clk9KTdLZ3p9enh7eHl5fXl3e3RucoOWnqGlqqmu
sbOzsqmgl6eWioJ/fYCGhIaBfXt3eGRTVFdZYG12eoF9enx9fX19fIOFgXh0dHZ4fH19f3t7eXqA
f4iJiYyFfXhnVEk9NTc1ODg4OTk6PD5FRkZHS1VZW1xfZF9QR0xMQDg1MzQ0Ly43QEtcc5HS/f7w
0p9nYmdrbm1oeZOShoaRlZSXlpSPjZKgj4WFhYSDhYJ6YDk5SVVeYmJpdH2Egn19eX15c3R4c3B4
jaCoqaevr7a2s7ezs7Kyrq6xsKqqqJ2WkY+Rk6G3wL7FyMTFw8PCxMjHvL/BxLy8xbyzr7Kzs66x
v8HBurW1urabm6WLgYJ8cm1kd4iLjY+WmJqcp6mjp7XAvLm6t7O1ppOBYjw5Ql5wbXFtcHF0e4uc
l5ehlYuKhXtwZV1ZVVlhZWdodH12d3RzfXt0cG1va1hQTE1QVFVgZ2trZmVgXWJeWVA0K0Fmd4WK
i4iGiYuPkZOPk668y7WwsLK6tri4ycS8uLavrK2gi3x8fIaLkZadkY2YmJiPj5GPhYaKhH+DhoaK
jZKWpLC2s7WzuL++vLvDwsPCwsvFwcDAv7e3vLOqrop6fF8+Ix86XHBzdImPiIaEhoOKjI6Ppbq/
w8nJztfU0s7O09XS1NLS0MzJxbyhi4qOj4yPjIV9enx/XmeLfXd3d3l9fHt2inlSSlNZYWdwcHl5
cHmCdHF0dHuBdHJzc3J2gYSEho+Vlq/SxLy3r7KzraqonZaNf4CBhYmSlZOgnZaPioJ5aVdUU1JS
WVhVUlJST05MSU1PT05OST4yLy8sLCwvOT49QklLTkxTWF1iZXZ7hpOLiYqSuMXOxbi3t7q4qqml
obablH92d4CLkouSqaGho5+dp6Gpsp2ajo2IeFhOUFVYU1BXXFdYW19vgIKAhIaJjI+Ojpeuu7/D
ycC7sqyqpp6hoZ2hoZ/BpHJOQ0xddpGls8HDvMnIv8PDwb+6r5iPoK68t7y8wMXJy8vIysfHysjA
vr62qqCeoZ2YmJaUkaClo6ChpKSkn5aLhIZ2bm1ua210d3Rzb2tqUEJBQEVHTVZrgYmJjJSUkZGL
i42NioaAfIKSlqGjoaSnr6yts7WyrqipqqCdmJWTlZWNdFZHUmZwamRbTlJWZ15VUFJVVmaWnZeb
wcq5sq+tr6amp6ChppuTg21qaG9ua21vbm1namVrb3FvdHl6fH2AhIOFgoSGj5KamK+kpaWloJeF
enR0cmdiYmBiYmRlaW1hXWuAg4mJjZKWmJWXlpWWlZSUhoBwamllZWlram1weIR8cXB0e3luZmJo
aW14e4F9fYOGk42Fho6PlJSTlaSYj4NyaWFdWVVURDQvIxwjPVNhamt0goN7fIJ6dHd3dHBxcG1v
bnJ7hoiBhYOAfXtwa2FQTE9VX3Odm4yGgXx9c2tmXlhbW2JulaaqpqOmqKWoureuqqy1s6mtqqWd
kYaEgYaGfWJTVmJuhpacoJibm5ydn5iThXxeOyYvS3SPmJibnZ6Yk5SYkpGEjKGgnqGenJaRjoh9
amBXUEQ6OT1NZ2tqbnyYoaemqq+usbi2s7O4sKqtra+sqqqop6yqrqqxvMHBvrq6u7a2sKynoZiX
s8qtp66uqqquraipqqqorK6tp6OfmJSIhoGDgX98VU5PVFlgXVlcXGB6bXeSpre4s7W1trOtraqb
mJqVmI+JhH14dHF6fX16eoN5d4uLc29rbm5ucnR2fJd/c3mTiouGhYaIjI+IjI2Li5uLc2tnZ4SB
l7C1s7O4ub/EwsG/u7yxraOTgm1QOTg7PkZYZWRmaIJ/fH2GjoJ0amlnZ2pubWtqa2JkYVtkZmRn
YmBeZGlrX3ppboaKio+eoJOVqOfgk3yEiouOi5SYmJ2cmqGjpZ+cnp2dn4xva2dxcmllYWtvbnBr
bW50d3R7fYGAg4aDenBwcG15iJSTi42YlI+Sj4qKhoF/enZ0Z2JnWVdfYGJqg62clpKTk5eFb2lr
aGSAbUE3PEJJZmpzd3NxcXBucHBxfH2Ol5ORk5aVkY+Rj4l0WVZcW2+Pnqaxw8W7trq+u7zBv7/T
0cG6ury+yZ98gY+WqKObj4+qmI2PkpGdqZOloZWVoZaPjIyJiIR8d3l3dHFwbmhlb3JqZVxKLyMj
LERTUlRVUk9UUlVTU1NDQkJWf5uloaGgpKGqraygmp6gpKGfmI+GiYuGf319lIJ7ho+ev5aIiI2P
kpKSl5iWm5SWmKasi3uBi315fXyBgYJ3cnJ/e3lyd3x7hZupprOloaGlp8Lp0s2xra7BwbWxs7/O
ubKvqae4r6SYd210fYB4en17f4KAeXR9eX18eXt/gYKCjbOsqbyzqqqmr7Cwr66utry2trOxs7Gu
raquqqqqp6ipqq6uqqisqqqtqKGbgWuFaFdWVzEXL1xhZmJgYmZmZml5cWWMmICAgYSCho2Kj4uL
jZGFfXRvcW1pYFldWVVUUFZTU1VYWVlWW1lSTkEoJSo0Rz44PEE+REdHR0JJR0dGT1hocnB7g4GD
goWGhn+EhoaGiIh5gJaempehqoyKf2drho+Upp+fm5ifrK2boaSqrrGpramloaamoaGYi4B3bmli
YU9EPTc1REY8QD5CQ0RBQTguLC4wMD5hfZ19UFZcZW5xdHdyeHuAgoKEhH+BhH2Dj6CSiIZtZXFK
MlKGhHl2dHl/lqm2saOkpJ6dl5eWkYp9bzsdNExtf459dIZ5c3R0dHZycXJtdpWVlJifqKytqaqu
qp+ToZiIg39/fXyBfX14eHNnT0pQVmhwcnp6hn13cXN/f3+EhoB4enZydHR3gHx8gH98gIGBhIqR
j4yGe21dS0I+Pjw8PDc5NTU3PEJBQVNUUFZVV1lYWFBLQ0E0LjMuKSUiKDlHVXB6htP+/dLHgmJo
am5rcXeBiIyNkZSSk5WYmpiYkpSPjo6IgoSEhIODYT1CV2FqaWt2eHZwcnd3dnRzc3ZycnuNnaWp
p6qztru3s7KyuLOzr7KsqayhmpSKiIqMlqa8vMHExcW/xMG/vL/DxcK/v8CzsbW3uK+wwL+8v7y4
tbezsqSUfX2YhXdxb22Ek5WYmpiYm5uhpayxs7m8vLq2uLGfhG9SNTU4TmtmZ2lubnR0fZq+pImG
gX18dGVZUE9QXV5fW2KbppeDdHR6dHR7eXp7ZVBPR0pQWG9tZ2hqZmVlYFVOQCcsTGt7goaFg4yL
j42LjpKfqbGvstHHrrC2ubvAvsG6sbCqrZ+CeIaWjYaDiYuPkpWelZGPj5GFgIqGhIaGiIiKiY+a
zsWvrq2xs7e3vL+/vr7AyMTFv7i3trOsnoR8hJJ/dkkjI0FidHuDkZWIiYqGhoiNk5Kktbu/x87R
ztHU1M7W0dXX0c7O2s7AuK2TiouKkY6JhoF9e2tga4N4dHR5eXp8fXZ9ZUdDS1VgbXR0go14dHZ5
cW10enRtcHNwdnt/iYuKlJibp7e7uci/sK+zsqqqmI99eX1/io6ls5iTkpOOioNxZFlWVlhfYFxY
WVRVUlNSUE5NTkxJRDMsKSwsLC83Nzo9PkFHTFBQWV1qhJGRioyKjpipvs7Bs7i8ubqwqqafnI98
b3B2fYSGjY+RlqSjpamonJidn6eTiIZ7YlZYVldZU1VWVFVhZYOGgIKDhomPkZabnK68ztXOyL+8
t7Kqn6Cjp62lpaieo31WR1NrfZasvLy8xMXFvsC6vLy8ubOst7+4vLm8vMXOxcXLysfN4Mi+vLam
paOhm5efm5aUl5qepKqwqaGhnYqBfXhvaGlqbXJ0gXRqXUxAPEFHR0tMVmB2iI+Oj46JhoaKg4OA
gH94fZSWlpijqamtra+zr6qqoJiXlpqTiIyLinxcTmR0eHtuaWJbUFBdVFBhYmBcZIann7Dk5Lyo
qaqpqqalo6Cdm416a2dnaW5ycXJrZ2F3fW9ram5xdHuBg318iIaIjIyMkaCkqKSpqaSuppaCdHJt
YF1eXFteX2BiX1lTYoaNiIqMj5KSk4+Uqq6OgYJ9a2FiZGZkZmZqcXJyc3R0b3R4hmFXZm5veHiB
gYWGiIWPkYySlJaYjo2SlIyGdGReWFdQSkU5MScaHTBHW2hvcnJ3dnh5e3h6c3N0c3Fub2tteYKE
iIiEiISDfXlzbVlPUlZWYHl9eHp9enBkXlhUUFlhaX2YpKSkn5+opaOqqqqlraqnp6mlo5eGgYCG
gnxqXVNSWWJ4lp6bpLGwn5+goaOReFw3IzBXfZOXm6GemJ2clJSWkY2Um5+koZ2Yl42GhHdhVFJJ
MiowNURTWGBqgpigqayprKyws7C1srCwsKqlqaalqrCvrKyorq+zusK+v7W2ta+vqaSfl5Wzxael
paqvr6ymoZ+mpaWoqa+toZiTk4iGiYuKi3ReTk5QVVdXVlldYWh4k6ats7i4t7u8vLy8vKqelJGO
i4uKgn1/fXp6f3x5en13dHh0dG5pa3Fwcnd7hXt5goiKhomKiYaGi4SIiIaFi4BuaWRlaniFpa6w
uLW6u8XIvLe5u7muqKGPdmJHOjpASmJnamZrjY+Ki4qGfXdzbmdiamZobWt8bmReX3tzYmJfYGJm
ZGJiX2FhZHR9qKaRjoyy+PuxeoCKiIqRlo+SlZKXoKSgoaWhnZ6fqoZra3Bta2Vrc29wb3J2eXp5
fYF9gn2EhH+BenJ0k6WWj5STk5KTjIiRj4yNhn17d3NqYltZWVtcX2FqhZGRlJOOeHSFb2RkXmJT
RDk8RWJkaXqEdHBydG9rbXByeIOSl5yYmJGfnZqGdG1ZWV5ic4mYobC7vLy+vsPAwcvDvMvHv7Wy
s7jCppWcn5iYlY+TmKebkY+amJaPlJ61s6GXjoyNjYl8eXNyc3Rzc3BrZ2pqcGhiYVhBKycuRUxP
UE5QUFNUVVZNST0+TpOYn6GloaSjpqiknp6goZ+fnKCfkpKOnX10doSFfHqGiI6Sj42Ji4+NjZKV
l52WlZaXmJWFfX19end3enpwcXZzdnJrcHR2f4+co5ifpLOlnqqz1uTlsZiqsrOvtczCrLeqpq6y
rKmqppN0anJ4dnl5eHh0eYB5e4B6fXp9fHp9fYOIkrzDqqanrrCsqrG2tq7Dx62ssKqtrbCprayu
raywrKyts6+yra+vrq2ppJ2KX1lcXVtLMCNLb1xeYmRkZ2lrbWpweIGBdHh/goKDgIWLjoqRkqGS
eW1qa2lcV1tdWVJPU1VVVVZbV1RXWFBFMCUlKi8xMzs+Q0NFREFFRElMSUtPU1xnc3d9f319goKA
goOGhoaKo6aalJKYmJeYlpGGlXhihqyki46Sk4yUnJ+jr6qorK6qoaGoqKSkqZyGenZwbWZfT0M7
NTU6SkVFRUNCRURDQDQwLCwzYc7+9JhHTVlnamlrcnR9fYF9gX+Gg3+PhHuEhouNjoBxakExTHaF
g315gZGpqryvrKego6emoaCXk4x3RjR5hH2Ge3t9ent0cnRzd3+Nc2dqi5WXmJqgp62qrKimmpGO
hH+AfYamj3d2d3R0aUo9QF+AeHh9fYCXhXx6c32AgX2Cf3yAdHR9gIGBhoKAfYGBgoWLkpSKjIWG
hWtVR0FDREJCQkQ7NTw8QEVGU1NMUE9gXVJQTD43LyonIyIiIiMmO0lZc3h5ktbrtoVram9tdHJt
dIOFiZSUnZyYmqSfmpigoJ2dnJOKhoR/fHd4PjpMX2trc3d3dHt6dHBwa29vcG90gZieoaqnrrO5
uLa8tbOxrrKxr7GyqaeglY6GfICKoLfCxMHCvLzBwcfCuLm/wbazuLawr6qtr7i/v7zAvLm5tbKw
qJh5dHR4eHN5gZOYmJuenaGfn6Chp6yyu7e4tre4rZ59cWlCNDhATWBkamtma3mGm8uti4+JfXFm
Xk9GPj5ES1RZYoN/eXR0c3F0d3h2eHp2WU9JV1lZa2ttamZpZVlXT0ovHilJd5KBfYGDg4mGiYyR
kqyqqq6zwLuvt7+8trK7zbyzrayjlXpwcnihqoaGiI6Pk5KTl5GlmH19iIiUoImGiIaPj4+ws7Wz
qq6vudG8srq8u7y+wci7s7CzsJiDe318fXZrSjQ7YWt0eoCIhIKLi5GJi4yOlaGsuLzEztLS09PR
0dLT19fUy87Oy8O8sJuLjpWPhoaEfXt9cmRrcW9yent9f313c2hWMj5NVGR0enl7f395cYp0aG12
cG1wcnh5eYSMi42krJ+stbi7v7azs7CqqbCgj313fIKPn6qmmJeYmJaPgnR0dF9dYmJeXltbYF5Y
VlRUUEtHSUc+LywsLCwvLzk6Ojs9QURGUFhZYGJ9jJGSj42WnKm8xby7s7Kzr7CtqqGdjoFyaWlz
e3qAhYSOl5WboZyamJaVkY+MhXdqYl5dXF9eXlxcV1lZaHuCgYSGi42Ok5qav87Oy8vDxcC5s66k
p6iqraeoqqGbi3RXS1t2jZ6utrq5vry8v7/IytbWy8C4sLCzt76/x8XCxcXFys7KwL68sKihpqGc
oZiYlpedoKGkrKemoaSllIR9enBrZmJrbnJ5alVDOTk6PlRKRUpTV2l6hIqGhIaEgYB5dnd3f398
kZudn6GhpKOvrqmnpaCVjoqDdnh5d3d6allYcoGEgH16cmZeWE9QWFldXmd2t9WWlMPFsqyuqqql
nJ2hppiPgW5qZWRmZmlqbmpnZ3pzaWtrc3h0e4OGgYWEgIKMi42WoKWkpKSkqqimoY92aWdhXllb
WFlcVlRXUFNzg5aNi5OXlZWPkpGck4qDf29gYVlpjWtcWWRpa29ua3ZtYVlhU15xiHp2fIKGiImM
k46Njo+Tj5GPi4SFdHBpX1VOS0dDNS8vKBwhN0thaIZ5b21zc3F3d3R0cXFwcmppaXOEhYmJiYqL
hoiDfHd0aVVpfV1TXmJmb29qZmhhVVdTWGJuhpadpKGfm5ibnp6ls6WjpaSkpJ2ViIWEg4KGfWFU
U1BVZXaPnaCw4tagmKGgm5+EaEc1Pm+PmJedmpyenJybmJaPjoqUpaSdmJiWhIWBa1lMQDUsKSw0
R1dhZ22Anaqnqq+zrbGzsbKws7Oxr6ysqqqqrKemqKyssrm4w8G3ube2s6ihnp2WlY2MsLOuraqp
paGjpaekoKGkrbyki5OTjI+Mi4ygg29bSVBfVllZWV9rdIultbOqs7u5tbm/vri3vLCYlo2Li4qG
gnt7e3l5gIF7eXh0cm9vcGpraW1udHRzdn19hoiGhoaGhoWMhoR/gX98bWRlZmdlYmiRqMTBtbu/
w8K7uriwr6+uoYt0bUkyND5Za2locHSRko+NioZ9enNraGZiaGpoanRob5FtWVxgZ2RhYmJkcpqB
bpuzeGFrmKaRmp/f6ZF2hIySlqeqk4+duaOVmJ2bnJyfm5+McXBtZm13aGRycG1wb3B0e3d5fX2A
fX19fXp2b3ORoZqjqZWOjo6NjomKhoWGgoOCcmpgYGJhXGBkgWlqjYyJk31qaWtoaGRkXUA0Nzc9
Ul9rbXFvcnBqb29wcnp9ibWuk5ORqtKwqoRvbV5XWGufj46bqq+zu7vBv7/CwMS+v77Bvrq1tryz
r7q8qqCVlZWTmpqal5yWmJ2gnqejnqq7lY6Pj4Bwa2ttdIiIc3Buc3prbW5pYVU1JzBCTVBQT1BS
UGVeUEtHQk9zk52goKikn6Ompp2anp2hoaCeoaWKf3t7en+Pj3l4fYGBhomJjpOVk46Tj4ue1MWX
iY2UoI13dHN0dHd7enZ0dHeEdnSafIqho6G2n5iYlJy3qrPf37+hnaausKyur6ytsq2qrrCxqaml
knCYi3Jub3NxdISYrpyPgIF5fHt9jX16gYKKpLq6pKiqr7O2s7K3s7Ozqaq4vLWzta+zsq+xsbGx
sbGyqq+wr6morK6klXRcXF9ZVVAyITJQXWRiZGZra2lqb3hye3R5fX1/goaEi4qMj4yPj4qCf3Fp
dGVeYWJgXFVTUFJQUFRSV1dUTjUgJiYoMTEzOjw+QEJFRkJFR0pLT1VUW2h4g316e32Af3+GppWG
jJOXmJicmJydnZiSjIuVkVxdgZiDf4aKmI+Uoaqqqqyqra+vp6qupqytnYh6cm9rZVtOQTs3NTc9
Oz5HRENEQD5AOC4rMTVFd9DFaU5YYmhqa25xeHd4eHt/fYB5d3yBfHqAiIuRnqp9PSlDeIyakpaq
qqGhqK2vqq6oqKGmo6CXj4VgSWB3cHmGfXh3c3FranBqa2pnYmRzj46MlZ+oqaeooZ+TiYaEf314
gZOPfHyDe2VPMjNAZHp/g4SBf3t5enl8fXp6f3x5eHt0dn2TrYV7fX2Ef3+DhoiMi4mGiIZ6bmJk
WU5HTFBOVEo+Pj1ASk1HSUpOTEtHRkdKOSwoIR8hIR0fIC4+VGZwd3yGzNKUb25ra21raG+BiYuM
kpWXm52am56hrKiloJeWqbOPf3duWEA0Pktia21zdnRzc3RwcHBzdG9xb3ODjZizpaqnrrK2uLm3
t7W1t7Kuqqqmo6CXiHl0fYuprbK7urW+vLOzuLW1tbazs7Ozs6+ooaixtre5ucDDvLi3t7Wtln1w
a3Fwa1+DnKGfnJ2eoKekpaeorLW/ubO3u7OoppN7fGpfTFhVV2Bpa2tzi5iblqGemI6IdnZkSTUw
MDQ6Q09mcXh3d3Fyc3R2eHd5cHBlU0pSVl9wbmReYF1ZVFJOVSYWJ0x9hYGBhpieioiLiouMqamn
qbiwrba3ubu5uLu7tbWuo56SfHNveHuAiIiLj5GRlpWPioyIgH2GhYaEhIWIhomPj4+Nj5WhrbG8
1ruzt7i/vL7BvrOysKa5k3dvdHl8eG1LO01rfYmMhIiFhoqOj4uJj5KUnKezt7nL0c7OytPUzs7R
0cvNzMrHw7q3p4mPnoyAhIF/fX9/dGhva3N3e3yAhn95d2E4QEZSYnh7f319f31xamtua2ltb2pv
fYWGipGSj5qmpbO/ube3trW2s7OqoJ2Ve3B4mLKln5yenZ2Xko2Ign18amZtZ2RkYl9gYGBfWVZX
Tk5LRz4xLCcvOzIvNzw6OT0+PUdGR1JUYXmPj5WRlqGdn7W5s6+vraypqaGbnJuWioJ3YFZeYmd0
eHeGioyRlpSVlZGPjoaBfXZ6cGJhaGptc2hZUlRYb32AhY2TjpKUmKHCzcvO083Lx767s7Gxsq2q
rK6poZ6XhndqWWeAlKa1urWxtrazvM7g39XO0Mq6r7O7vL/AwcLEwcHCxMTD48uopaCgoKSenp6b
m5uhqKysqqiqoJybjYB2aWJiYWVucFhHOTU0MTVAU0tHS11eWWJ3hoh8fX96dnRxa3BycXKGmJKP
l5iSl5qcnp+XjXx8fXZxb2twa2pia4CUhYWDgX97bmZeVk1OWF9rgpKsqpKTlpuhrqylnpybl5qj
mop5a2ZgYGRqZ2traGltlndfZWptcXB0irCIfX2EhoqfppudoJ6oqaOmpqOdln9mZGlpZWZnXFZl
VU9QYXqNmJOSk5SYmpeSkpWPhIF7dmRdXV50YVtZYWVpZWhnX0w7NTxHWWtwcnZ2eoWKjY6Lj5GR
lJSUi4iJhX1rXltXWU5DPjUuKScjIio5Sllib25ra21vcXFydHR0b2pta2VoeI+EhomKj5GPj4uG
fHZ0Z29tWFxbYGZpZ2Rnbl5ZV1ZgZnGMm6OhpZ+Ul5ifmJWjpJudqbysqoR9hIV9gZGRa1RSVVVm
c4qdprDMv6qnpqCYnJaOalBQdpGSmp+YlpyYmpiWl46Lj5icnJuVkZKJi3lTQjoxKicpM0JYYmhp
cHyUqqmws8Kwsrmzsa6qsbC4sq6xsq2qrKqqqa2xs7jDx7i4ubKqqKeenJydiH2ns7Cqp6WnpaGf
nJ+gm56ho5qKiomLj4+RioyEhnZYWFlZWV1kaYaPoLjRvKyus7i+vLi8ur66s6makYyKiZGDfHd2
en19gX99dm1rbmtrZmhobnJzdHd7hICAg4CEg4WOmJaPhXd3dHBlXGVnZmhzZHajt7a7vLu8vra2
tbOwr66gjnlyUjU0PlttbnRxdpWUlJKKj4h/cWtmaWpqZmpramhzm3JZYGJdYGVmZ2dpbXeSr6+u
lo2bpJKIj7+3kpihp6qsrK6qqqqsm5aXm5uWl5SOinJoc3l2eYRpYmJpbm1wdHd0eHd6fYF9fXuA
eHZ5gpaUmpaSl4+NkZGRjoaGg4CGiHdwa2JiZmZkXWJiZGd2b3R3dG9va29raV1bRTg1NTo+TWlx
cXNwcXBra3FydnuCio2PlZWbp5WbioOAWVBTW2Z2i5+mt7++ubu6v8TDvLm+wbizs7Kwu9XSsK+o
pqSalpuYnK2lnZqcoaShpaOko5+ampKMhnFvcXByc25wd3eFlXdqaG1mZlk0LEJPSUxNU1VUbVZP
UmGCd32Pk52uqqWnrKihoZ2cmJ+gl6GjjHyChoWLfIuFg32FgIOIi4uJiIuKi4aLjaHy/u+YhrCb
amtqcHRzdHRtcXFveIBxa3uTl5icoZ2XmKSgnp6hqK/F07ajpaeqp6qvr7Cvs6yqqaqooZySa1xb
bnxya3+VoZiWmKCek4yGipWOenN5ko2WqrK1rqevsamss7Kzt7O+wbOvr7Kxs7Ozr7OztrWws7Ou
r7OwsLetqqGOcGBhW1tTRygrTVRYXGBhaGdkbW1nb4J9dnlzdn2EhYaGhoySkpORjIaAZWJmYl1f
ZWJdV1BTVVRTV1JQVFREIxgeJyUrLDE1PjxDTUVBQEVCRkpPVVlWXGSNf3Z6d3Z9fYKCg4SLjo+X
k5Sen5yckpKXmJ2ke1JQX3R/gYCIjI+fqKmqrK6ur8G4rLOvp6GYiXdza2ZgWVVLQj5AOjk1QENE
QUBBQD45My4uLzI+VF1ZXGRoa2lucXJ0hnt4eXp4fXx/hH+Dg4aMjpKXl4BYRlmMk5Ko0bqan6Oe
p7epqqmop6OlnqGmvKl7am1ze316dHNycm9nanSEcGJkXmBoiJWWoaalqqqjlpKOhYKCfXt5eXN0
dHx4UzEmK1CMdHh6fYGAf3p9hXh2eXl4fHt3cnJ0d4SPe3R/hqCYfXqChYiKi42Khnt5eXhrYl9Z
XlhYUkdESURBSVVNRUpTWU5KR0U6LCcjIh8gHx4jNUtoc3d8enqIhnZ2c3Rvb2trcY2PjZKTlJSa
nqCjn6amqaagm5eXmpaTf3dcOzRBXGtucnR0dnt5eXp0cHR3cHR3eYGMjZigprCzuru7ubi2ubO7
ubKwrqmjnJSLeHd9o+TKsq+2s7Kwr7O2s7i2saqurq+srKaopqq2uLe7w8K8urqytre3rYJqa2tp
fZWfqJ+dnqOlo6Olr66zury6vLexrLKehoaChIB8d3lxcm5rcX2GjpKSk5Sbmo6GdFtHOzQzPUJF
W3F0eXd3dHRrbnRwcHNybW9nTkpUX2doXllcV1RSS0I1GRUwTnR0cHiCl6+Jg4iIiJGoo6Ouybeq
sLO+w7yzubqzqammmIF0am14e3yChIWJo5WKi4qGhICAhoKDgoSIhoaFgImNioKDiYaJmrCzsa6x
t7e5t7e+tbahhH99fXl3dHZ5dFZEX3l9f4WGi4iIjpKUj4uTl5iapa65w8vLzdDU1MvO1dbNzM7O
0M7JvK6OhomKj4+JhoGBgIWMf2prenR0e3x9fXh6cVBDRk9weHp9fHh6f3lpaWVoaGdpZHF7goaK
jpGYlpOfsrq4vLy8trOzsq6om5aTb3S34q6SlJ6fm56ck42JhXx0bWttb2tmX2JiX19dWE9NTUtH
PDAqKDdbNy80Pj48PkFCRURBR09ieY6OjpGWsqqhsry5tbCtpaekoZyXlJKLhnRlU0ZNUmVwZm2E
jY6PkZOXk4mGjIl/d32OiYuPlpqmhmJVU1Jcd4KFiImOlJqgqr7IzNLU0M3EyMO/vrqxra6urKan
p5+Ri4FZWWuIpKqzr66qpK/C2uLf29XU1M7Atam3wLy+v7/AwcjKw8HDtamko6GhoZ2goJqanKGn
rayuqqikoZ+OgHRrXVltXWVQNywsKSwuMjk+QkVHV1JQYmtqbXN6eHhybmtqa29udHuKjYuIhoaG
iY+Pk46Bd3Ryc3N2cXFuZ2uIsq2CfX2Ef4SAdGRVVVlhdImYmpafmJKSlaS2pZ2tn5aYmJGSim1m
ZFxiZ3Bqa25pamdwamdqamtydHJ8g3p5gIGFjJull5yjpaOpsbuxoZ+diXJraGhnZGJVT1ROSk1f
domqm5eXm5uYlpWPi4qGgX12cWpeVVZkfWlbX2dpYmVQNCkwOkdfYmZrbnR7gIaKjo2PkpGPmJSR
i4WAc19UTExLQDw1MComISUlLDhGVlthZ2VmZ210b2tzdHJrZmRhZGdxgIiLioaTjY+Sjo6KiHpv
aGJXWV1kYmJpZ2JeWVxVVlhheZehn6Gxp5qWnZiWoKOgoaOmr7LUpXh3eHx9fXlrXFRYYXKEnKal
qqyssa+oo56an52IeHuPi42Sl5WampiVkZGUj42PjJeYlJebk4WEeEc3LCsqLDQ+U2ZrbWt0eI+n
pqy2zLOxvLits7i3rcC2raywsayuqKmqqqqxuby6xdu8oZ+joZqUlpuPf5yqqqmmnqOhnaGfn5uW
mKCdkoSbn5aNkZOXlIaEi3pdXWBiYmJifZ2qscCvrrO6urq8vLm7vMC2qKSdk4+LhoOAe3R2eX1/
gX1zcXB9eWliYmdrcIGGi4yJgYJ/g4aKip6opZiCdHNvYl9gYmRiZWZiapKwtba6uLa2t7WwsbCs
qZqIeW5JNTREanh3dnd6j5OSkZWNhn16bmVmZ2RlaGppZmZiXl5fYmJiYmJqbnF0eoCEho2Tk5Gk
oZOOlZuhpKWmqqqsr7O1sbCooZeYmJaTkYyCbW5/eU1CVXpxaGtreHd6eXx8dnmEgoB8fHx8en2V
lpKSj5KWmJOVjY6Kjo6PjXt6dHFiYGBkc2dgYWZna25zcG5rbW1pam1uam1iTkc6NzhFW2Rxc3Nr
a3Frb3F3e4SGkpOPj6DIpJJ/gYJZTWZgXmuGmqa2ubm8wMPIyMHBv7+5t7Wura6ts7Kpqamspp6h
mpugnqCgnqOkp6amsK2hoaalmpuOdGtta25udHZ0c3Z0d3Fva2hoYEUwQ0tHSUxOS0dJVIZ0am+C
s5SNlaCqpKOkoZ6cn52ampWUoJiAdHN7hYJ9hIaRhYychoCGhYyDjI2LiIqTy+z+5I6BiYVhdJN4
ZWhrbmpma4VwaHOUj5aXlJSWmpqamJ6bm6Ooqqits6qpqqanqKqzr6yysqyqqqejnpNoYWptam1z
kpyYmJygnZiYl4yPlJWPe3yYlZimrqqnu9GwpKqtrK+vsrKztbW1u7Owt7ews7e1tre5ybmvrq+u
r6ynn4p5cm12cV09JTlLWF1bYGJmZWdmaWtxd3Z3eHp6fX2AgoWFiYmOkpOPj4FnWVZdXmFkZ2Bd
VVVVVFdVU1BORzcdEx8mKCwzNTc9Pj4+QUFEQkdiV0xTWV1iaG18b3iEfXl8gIaOjo+RlZSTjpWf
o5+el5iWk46RhYWTi4J/d3R2hZqqp6ivrq2wsLGsrKahn5iPeXFmZWFcW1JKQ0I9Oj5AQ0dFREZD
RD4sLDAwMDVBT1xia29raWdtb25xcHZ6fHd6eXyDfYKGiI+cqJiViImBiJqWkZ3Aqpqhn6Smqq2u
r66qoaansbrFvq6UgX2DgH18dHFxdHNobYJqX2BZWVVbeZ6ooaGjpaGPj42GhIN5fH14dnd0Ykss
HBwoTHhzcn2Ef317fX16cG9xdHN3dnmLenR2eXx/e3eBlaSDeX2CjJeUhoiGg316dHNwcmplYmBc
V1BMRUdPXFJHSUtLTkdFQEAsJyMjHh4aHyg3TWFuc3h0dHR3eHZzbnFzcnB0f46OjpKWoamqrK6x
uLihm52bnZiUkYyCcl1GPEdYYmt0eHZ5enh9g319fHx9gX19jaiYlZibr7rRuqqztra4u7W1s6yq
p5uYno18e4CSxcWvsrKzsqyqrK2srKiqqq2uo52WfY2hrLG7vsO7vru3s7W2r6GKf3NrcmiEmJ6l
qaehpqinp66vsbe8usG8s7OpppiKhIuOjISDgoOCenJyfIaMj4yUlJyXioJ2XktBPDU0O1BqdnZ0
d3N4c3RwcnB2eHdxbW1hWVliZ2RiYlxcVlJHPCcRFzNOa3Rve4GDioaRjoaNpMekoKfKv7KusrK1
s7W5vrCqppyPa11dZ3F3f4KEiIaJjI6JhoWAenqCgoGGio+LhX2ChoiFg4KGtZF5hrOwqbC2sra3
sKytpY2Gf3Z4e3t0cXJvanZzc3p8hISIi4iOjY2Kj5GUl5qwsrO2w9Dc0snL0dPT0tTS0M7OysjF
vJh9hYyPk4uOjomMjYqSfWhwcHR7fHt6e4F7UktUUGJzdHF0eXl6fGZgXl5ibWRicHyGioaKkZWT
m6Gzs7K4urW2trOvraSdmINqbZW7paChn6CjoJWNjImLgHRrbWdqbm5rZmJoaWJTS0dJSUY7My4s
O1k7MjE+QkVHRUlNRUFGTmmBj6eSjI+Vm52mtrOpqqiloZ6dkY+SkpGId2tVPkBLUFxfZHODhoSG
ho2MhIGGhYiJip6ak5iampyJeWhYUFRic4WMjJGcnqazwcvO09XR0dDSysfDwLu1sLCvqqqjm6GV
eVxHUHeRnqqcn56hu9fg3t7e3NzT1MvDuLe5vLy8urvBwbzFxbipoaWhnJ+hoZ6foZyepK6wr6+s
qaGhno59dG5YR0E4OTQyKSooLDA1PEFGRElOTFJna2BfZWlkbWtrbnBvb3N0dHd9fHZ3c3mEf32B
f3ZzdHZ4dIGGcWhqd4+Vko2EhoGBgnt4bVlZYX+Ul5ycn5yYmJyXmJ+dnaiej4+Rjop9ZV9eWWln
aWpob3NpaGVoaWVna2twcHN0eXx9gYSFkZuYoaekpaq1y62cnp2PdG5ycGpraltLRj5ET2Z0gYuS
mp2cmpidmpKNj4yCfXt9eWZdWWRxZ2h2a2dpZFIvJi48T2FmZG90dn19hIiNjoyRk5uck42NiXJk
W1BGQD44MjMpJyMjIyIjLDpNXWJiYWJmZmZlZWhucZZ0X11eZXSBmpuTj5GTkZGTi5SPf3RlWVle
YWJkZmhkYmVlYFdbVmBzi5egpKmelJSYn6SoqqywrK+urbehg31/goN9dm9kW1xpeZezqKWnr7u4
t66hnJWbo5qTlI+Ji42Pj46Pk5STlo+IioyKjJGPjo6KfWhLOS4sLDRBRkxdZ2loa3J0jaqwqLKz
r6+utrXMtaeqsbCtsrKxqaiurqqpr7OtrrC50KqboKSjoKGemJOFhaGspqOnoKGfmpifm5ubm52J
eIGXl5OVlZaYj4mEe2hmYmFdYmZ9pKqxtbyzt7q/vLm3vLy5u7quqZ+YqayOgoJ8eXZ2eHyBfXh2
c3x0YlBcbXB9ioaJiISCiYyKj42PrLOqpZGJkWJUWWhgXVtZYV5igKWxs7Ozra6zs7Ctrq6plIR7
c1M3NU1pdHNyeX2Sj5GWk42De3ZxamZlYmptZmZlZ2VfWFthZ2dhYmtrcHR3eX2Ei4+UmpaUlJaY
nKCoqqeqqa2ysrOuqqqsn5ePko+Kj31tW01KV1ZQYmZnZ2tzc3R4fHt0dHd7eHx6gXN0jZiWlZSS
nJiPjpWPj42YupN4c3R2dGlgYGJnaWRta2Zmamtpa2hiaGliaGtrZGBbU1g9NE1rdnFvcGtza2t4
e3mGf4iPi4aJjI+Ogn19YktOdGJWYX2Vs7y4uby/wMfHxMHAvLW1sq6qqK/CvLCyt6Wdm5ienaCh
prmwp6inrLazqqCkp56dmpJ/a2tqa2twbnBydHl6dHBzc3ZwYlBEQ1ZMTEdJTGFvaGtvdH2RjpKY
oaqqpaqsoJqfn5iTlZWPent3b3uCfXx9gpeRhoV/fYGJhoSJhYmOj5Sdm5uYoKOhrNP+3GpYXGRr
aml3b2hqhpaXkpWXmJ2anJyhnJeepamlqqiqsrKsrK2usbG1sK6ssKyqqqSgkm9oamtydI2anaGg
oaehm5yVlpGNipWfvLGSiJOYnaWwrrGwrbKxrrGxsrfLvLjNxLWzu7O1u7uvrLa6s7Cvr62ztqqY
koZ7c3Jrbmg6OE9ZXVdfYmRkZmtqanJ3dnZ4d3p9fIWAhIiIiI2SjIuKfWRZWFlgYltZYGBeXV1Q
TlBPSkc9JxMUKSclLC4zNDU6Pj5APj5BRk9QS1BYXlxfZGprg76Jd3R6gYiJjY6SlJeYnpiYl5ia
o52Tj5KXlaakn5qMeHOAlaassa6ssLCwsLCvqqGcqZh0bW5nXltZX3NhRTg3Oj5BPkBGRUVFQDIq
KS41PkdQWWJla2lnZmJpa2tranJ3cnJ3e3+AiYyLj5/OrIyJjY+TvLuOhZOenp6gpKSnsLCxrKWu
sbC5u7+7s6+nqqaIgHx2cmtuc450YF1eYV5STk9rqKCepqWunY+LioyFhIWBenl0b2hUOCAUFixH
Xm2CgX18goB8dHFvbWttbm1xd3d0c3Z0c3p0eH1/f3t5eoSRlJign5iUlJKPi4GDf3h/fXhiV09H
REVCRUVHSkdGQ0JDPS4jHRwcHhoaJjxQYGpzdnh2eYB9e316e3h7fH2DhoaJj5KttqmssK+xpqGc
oJ2cl5KVkoZ7a1lNVmRnbXR5f4OChICBg4aLhISEfXyIiZfDnI+VpbG3uLa4trOsrK6qrqqpmIZ7
fHqBgY2WqLewrKqmpaahpaOhpKeoqp+dmHRQZJSjqrm/wry8uLW1tbO1pomBfHR9b2+PoKqsqKmq
rq+sra+zuLu8xbixr6ensJODio6Pi4qJk4+CfHl8g4WGi4qPkZOPhXJgV0RCQDlAbnRzcXl2dHZ2
dHRvbXFycGttbXFtYmJlZ2RhX11ZUEU+OCMcMlBwcmpweIGDhYSGhIiPkpiep6evrrGzs7e3uLew
r62knoZkVmBrcnR/hISMiIiLjYuGkY+AiIODgISNioyPiYqKhoaDfYzKjl55n5ydrLOppa2oqp6K
iZOGdHJ0eHRvamJbeXdydHyEhoaOjo+PjY6WlpiYoKqtsbO72dvS0NLS0tPR1M3I0NXNzMm8loOI
jZGWl5eWlpKPlJqYd2ptdHd8dHR2fX1bUFBPV2dua3B2d3yEdlxbX1lWU1Ruf46Jg4mTmJuanqaz
u7rAt7W2s7O2qKWjf2preomYoaaenZydl4+MhoV/enFtbW90iXdwamplYVJLSUdFPjouKyw+b0Yy
OkNHS0tKTE9QT0xQc4KPj4yPjpOVnKW1saSmoaGenJWPj5GVl5SCe3xMRVZeYGVlaXmGg3t9hIGB
hIKEhoiJj5ifoKegn5GJgGZZU1Jmf4iPmp6htb63ubzEx87SztPOy8XKy8K8tqqtrKqomI6CcE9J
anZ8f4GGmLbZ3dvg29zW1tXW08vDs7Oztre5vLa2ucfIs6GgmJqcmJyfoaGho6ahqa2uramnpZuV
hYN2Zkw1JyMoIyEjIykvMzc+RktQSktPU1l0cF1XV19naWhqaG10dG9vdHJuamBbZG5ydHR0dGty
dHRtcnhrZ2t9jI+Rk46PiIJ9dndlWV9riJaen5+ho6SfnpqXmpaYk4+LiI+GcV1SX3JqZ2ZpbWtp
b3FwgoFlYWlwbm1tcXSPj3x5fIWPk56hpKWho6SqpKWgn456eHFvbnBrXU1HQD5JYnSDho2Tmpig
nZyWjY2FiYZ/fHd0bWJbXGJqa29rZ2JrYUMyMzlSX2BhaWp0dnp/g4+Ok4+Tlqyhi4Z2WU1JQD43
MSgjJx0XHyMmICEiLkVTVmBhYGFiZ2dpa2twnXFXVVZrgYKBkZKOjY6UlZKPjouDdm5fW2BiYWBi
aGtvcH1tXFVVYm15hpOcoZiUjpeeoaitr6qur66qp5+Kg4CAf31/eW9lYGiEoKyqqa+3uLmtqqad
oaWhmpiVioKBg46TlZeUlY+PkY6KiIiKjYSGiHttVT4xKSgsPlJUVF9rbmtvbnOCpcmtpK6zs7a1
usWyrqqqra+ysamor7CqrKmuqaelpKisqqScm56cmpaVlYmKoaafoKSkmJaam52gnZiemoV0eYiV
l5yblJWRjIaAbmJgZmRmaHOYp7Cytbe6uri6u7i5v7y8uryvn5qnro5/goB3dnd9fH96fHt9g4SA
doCFhoqGhoyPiIaIi4yTkqGxrKquloNzVVZZZmFeXV93cl5hf6Gkp6yqs7Gqqqqpo6+bfXRwYklM
Z3F0d3qDe5ORlpaTkoqAdG5ra2ttZ2JnaGhqaGFie4Jycmtma290eHR5hIaJjJSSl5uenJ6jn6qo
pq2qsLOtrbOtoaemmIuIhX10elhFTUlLVFZraGhqdHR0dHRxcnx7dnl5eHh4dHaGj5GPi4yTlI+Y
kYaGhoOEfHd0cmtpZmRhXGBdaXtvamlua2hmaGhnYWJrcWtoZFxXV01ZZW1xeH2XhpiPcnF5f6qh
sq2YjoiCgYKCclA+Qk5bW1Zcb4+mqrO6try8xMO+uLi3trGoqKGhrLGppqi+y6qho6mmpKOfp6qq
sLWzt7eyqqakpKOzo4lraW5weHNtcnJzcnRzdHRubnBxa11bRkBCQUZccW1vb250eoGIio2Uoamo
oZ+dm5qRkY+IfXJ4hHKEfXyAg4aMkpSTjYOAgoSCgoOGhYqGi5qdmJqapKq15f78oWtWX2BiYWBi
ZH2Mj4+XmJidnJihoZuYl5qco6/Fqp+lra/I0aymqq+qqq6yqqqspaeYcWptcouGk52el5yap6ih
mJOVk4yPjY2gmI2RlpOTl56kp6+qra+yrLO2t7m5vL7Av7m4usjZvq6xuK6xsrO5trCynI+RjYuD
eXRuam1oXV5eXF9kYmVrZ2ducnRzb3R4eXl7fX+ChYWGioqMoJF7ZltXXWFeWWRiZmJdUk9MZGVK
QjknKSUlJioqLjE1Ojk8Ozs8PUZdSklOUFlhYmRiYmt0gXiIhYaGhoyRlZeampiTjpOXj5admJqV
lZaWn6GhoKWGdIOYpa2zsq6wr7GurKStpp6ekXNpZGRiWVlywbtNLjA6OT5AQEI+QUJDRDU0PDhD
TVdbZGJiZ2VkYmVmcYNtZW1vcIGJgIKIiI+PlpiUkpKUsaOWi4KGipKVmJedqKakqLOxrLC4tby/
vLqyubXFvIh3d3h6bm9tcG1pbl9dcGRPVXKVlpSYo52YlpGPkY+YiH99dnFyaE4wGhEYLE1kb3p/
f318gntvcWVdZGVmbm5ycGtqcHB0dHZ9d3Z8eHp/f42co6WorKSdm5qXlY2LjYqBeXd0b1ZHQT5H
R0lLR0dEQUA4JyIhHh0cGRgnS2Rnc3R2d3+JmIqBfYCEipGYj4OFioaCjqWzs7OvsLKqpp+hnJia
mJuYjoh3ZFdbYWp0fH+Gio6GhoSEi4yIj4aDhYmOj4+Ok5aerbCyt7e4sq+ppKGfmpyLa2tzdnuC
hJKq0LWhoaGkpaGgn6GhnaChn5qTcF97oaGosbe/wr/Ct7i2sradiISFhLXWfX+bqKyssLOup66q
rayyt7a4urizo6OYj4qPtZuSjo2RlZGGf3yChoaChI+Rj4iBdGJZSUE8Okd9dnR0e3t6fHp2c3By
cnFya2dqdJN5ZGJkZWVcWVxXUEpENSM1SVZdbnp/fIKGiIqCho+Wo6moqqqztrKztrOztbauo6Gk
iV5XWWp0fX+Gj4qJjI+Wl4+Pi5ycgnx/hoyRi4mJjoiTj315eXZrYmJ0hpafpZ6bnpqelIyGhXx0
c3BvbW1tVk90d3Z5en2FiImPj5iamJaYl5aaqLa1tr/N1NfT1NnX0dTQztXOy8zFwbaYhIyamJiY
nJyal5eXmJSGbnh9i312c3JpWVJVV1JOVWJma2prbX1tVU9PTUJBTWt7fYSIhYqSlJitr7O2t8O7
uLu6sbGvqKONdGtzhpadpKOboZqUkYyGiYaGcGpobnF3cG9rZmBYTD44Oz46MzMxLzRDQD1JTE9L
S01UVWhhT09yiIaFiYyRjo+YoKm3rqOgn5qWk5WVlJKOj4J5e2trb3Rua2tudIV9dnh9gHd9goSG
iI6Ym52kpqehm5OMe2ZVUlZpeo2kprO/t7ayusXOy8zO0NLNyszJxMPAsq2sqKqhmIV2X0VESlhq
doKp1eDf39re4NnV1dfTy6+qvrOysrC2urvCycSqnZWUmJiXmJianp+ho6eutbGqqKahl4+OgXRl
UDkrJTUnIh4hIygsPktKTllSU1RUVVldWVRVX2RoZmZpam5ubmtoaGZkXFlcZmhpaGdnbW1wa2Vm
Z2JobX+Rko+Xmpqek455ZFlgYneLn6GgnqGooZuhqpiPj42KjIZ/gXBWR0VWdGVhZWtua2tobXCL
lXRiZW1va3JycoZ7eXaAiZKYmqGlp6ilpKSmpaOei3t3dHRrZ2JgVUM+Qk1kdn+JiYyVnJSVk5OM
ioaChot/enR4a2l2gnFuZmZpbWtlVUlAO0lZXmVmaHF3eoGKjY6OlJqPmJKIhGtVQD47NCojIh0a
ExMcHx0dHRwjN0lPWFxdXF5fX2JkZWtuXVVVVmFygYqOj5GRkpeUlZSPiop9cWJbWF1gYGdufZF0
fGtnZ2dnZW90gIaUjI+UlZ2kp6mlpaq1saqtn5aLiISAfXN2eZFwbpOgqKy3tbW3uLKspaGjoaSc
j4uEe3uBhoqIi42Nio6MiY2MhomDfXh5amJQPCgnKzNHUldUYm1pam5wcHSOpqOmr7W7trW2urat
rbK2sbKtrrOsraqtqKWppKOhpaemo6OloKCgmJaTmIWBl5uamJiXnJudnZqVl5aTiXh6hY6Upq6Y
k5ahnn9uZmRmZ2Ria4+pqKmzs7e3s7e6vLq3ub68trKpo6CjnZWLiIF6eHR6eHh6kaaYko+JjqnT
rn+BjIyFfYGPjJOapqympqWRf21dWV1dXFlZW2t/Yl9pgo+Yrry/qqepp6GVm4t7enFiVV1ka3t7
gIN7lpibmJOPioR/e3RuaWVnaW1paGpnZ2BZX3SMcGpqbnR5fYF9houVmJeTjpaaoKahpaavrKqz
srOwsLKtpaGfhn18a1ZUYneLW1lYW2ReZGtydHdydHN2d3t5cnB6d4J/fIWJio6TnZiSkaWbiYOD
g319d2tqZmFhZGJoZmpwgZFyamhtb2piZ2Jia25vaGRhX19paWRna3B0dHF0dnecgoaUn6myqp2X
loyKgXpXMzVHYGBfYFloe5ewurXBurnEvLq6t7OvqqWjoZ+oqaCts7OzurzEt6qjoamqqrGztb+8
trOzrK2ppaGysnFha4tuYnJ0dG9vb3Z3dG9va21ueVQ+PkdLVmVqcnBvb3Z3eH2Fio6dsaienZ6a
mJeIemttiG1qb3uGhoqGgoOIjY+MhHyAg4SAgYGCg4uPj5eXlpihqrXV/v6fTUxZYl9hZltrgouP
jZGTkpqfnKChnJaen56foZymp6Sorq+usaqvqqmpra6qrKejn5h2a2tub4WfoJibnZ2jnp+YlZSR
ko+JhYKGia6Yj4+VmqGksM28rKm2y7yzs7u8vry8vLu6tbzFvLa4uLW4sLG4sLKkmJKMjYuCeHNt
a3R3a2RhZGZmaWhvbm9zc21tdHd3eX16fIKGiISIjJaRnYlqWFNWX2BfXmBkZGFQSkpQUEVHPig6
MykqNUE0MDIyNDo+PkJKR0lFRE9bWF5kaGZkaW5tanCNiYKGi4+SlJSPj5aVk5WTlJSSkZGXmJyd
npifnZR/jZqgrK+nrKqvrKqpqaGhoJSIdmhcVltcWWCOnlA3NTpBPj5CQkJDSUFFPTQwMkFQWFlb
YGRmYmFkYmJ3pXhkYmdrcHR4hoqOioiPj42Lj5KLi4qCfXp9hY+Vl56hoaOlqbCtsry7vMvBt7Cv
uMLBlYJ9d3Z0cnBucGpuZ1RcWVVmgY6SmJifnqCemJqklI+EhYqKgHRvUCgaFx04VWl3fICDgXt8
eXRuXk9WX3ubb1heZWhwcnFtdHp4en16fYGMl6W+x7Kwr6ewqpygm5aUjYqNhoiLdltORktHQT5D
QUM+PDElIR4ZFxocGSNHdmtrd4uPjo6TlJaYl5eUlpKSk46JhIabrLCvqqiwrK+mpaafmJibl5iT
hollTFBeZ3F/iomIiIyGioaGiYmEhouCgouKhouPlJign6Out7Gvp6GeoZybhnF4d3Z/hYaGjI+Y
pKWgm5iclpOYnZqbmJiSgnZ2d2t7l6Susre5t7u3urK2wZiOi4yMlam4mJaprqivsK+tsK2srrC1
t7u1s6qdjYmOkpWcmJqclpKXmJSKhYaMj4iLjouIhH17eG5eQTk9TG1zdIB9fX2CgHt4eoF3b3Bz
bXBvcnBpamtraWdiXllVTklHODtJVF1tgXt4fYB8fYWMj5KcnJ+nrK2yr7Kusbe2s7asp56EfFtZ
bYObjYSPp5uRlZShkoiEj7WDdH2AhoaDhoiJhY2Vioh4dHBhW2uFlJeYmpuWj4mJhoJ5fHZ0eHNt
a2BOUGptdHd8f4CGjI+TmqCYl5eYmJystba3usnS1tTU09HU09bOzc3Kyci+sJGGj5WUmJyhpZ2f
m5iTi4Roc4l2dHhuZVtYWVZQVFBMUFxkV1VZRz5BRE9HPT5Qc3p6g42Lj5OcpLO1s7i6wcHAwcK8
s7KsoYh8b3alqJqWk5KWmJWPj42GhJd2Z2ZnbXp2bmpmZVI0Jy4zOjw6NDQ4Nzg+UlVQVVZQVFhZ
XFJMTmB/goSFhoiKjZKYnaCso6Gfl5icmJeWlZeRhHp2f4ODend0b3N3eHNwcXl8fX2BgoWOk5ee
qKqqoaGdlZOPcGFYU1dkf6GjtbOsrbGws8HHztbU1dfQztPOyL+1qqisqqmdi4N9UD5ATVxqj7za
4ODc3d7g3NfZ19THsKeuxbyvr7a4t8LKsqGbkZGSlJuWlZqhoZ+lqrKzr6aloZ2WlI99b2VQOCId
HiAgHiAmKDBCS1BVWFhYX1ZZXVlYWFZYXWFobmdobXNxaWRiZGBgYmJiYmJiZGVlamtoZWZlZ2Vx
f46Tl5ycnJyYnYBhXXNyeISUnJ6foaGhoKGwoI6EhoWEhIF2WUdHR1BbYW1waXFxb25xcXl/cXBu
amdpcnNucHR4fYCImJiYmqGmo6Ofm5+jtZ2OiHdyb21qZmtbRD5DS2F3f4WMjpKTj5WPlJyKhoCB
f3p8dnJ0d4WKfXRrbmtpZ2phVE5CTmtfWWJrcXZ6goSEipGaoJONhoFuUEI8OTU0KyMgHBcRCxAW
FRYVFh0mOkdOVVhcXFhZYF9gZl9hcllXVmKBio+Xk5aPlJuYnJiTjYN5a1xVWF9ia3mGhnt8gYCF
cWtucHd0c3h2iKC+pJ6jqaeprrOxraezs5aFhoR9f319inuIna6tuceysLq4saqur66loZiPiYB5
eX2BhouPjIuPj46OhoaGhYJ7dG9nXUQzJSYuNUdUVVtkb21rb2t0doadpKSvsaylrLO3s7CtsrCv
rLGxqq6npKOkpaagm5yeoaannZuboZ6blp2Ye3RwhpaYnZybm5SWmJqWkpOAfXeAk5iem5idm56V
hG9nZ2ZpaG96mqSlqrC6uLa7ury6uLy3s7i7uKqjoaGpqp+VkoV7cHR2eIaXnJqWmJaPn6qYjY2P
lqGOho+XlZudoaWlppOBa11hYFtYU1ZZWVliWVxmdoa7yqqYmJ2XlI2LgXpwbnFiXmJrgYF9g4GY
k5iUlZGNhoB4dHNuaWdpa2tpb29lX2FibnFubnJ0dHuDhoOGj5OUmJebmJujpaapqKyur7Cys6+5
vKakoZaGc2pZWVlXWF1cXlxbcGdpamtrbnR3dHdycnRzd3htenR0hY2YkY6Rko2Uj4uJgYSYfHJw
cGplamVmYmRiZ2qhs29iZm9tanlrYWJmb3JpZmJibXFucHh2bXFzcnl8fYSJm52fpayko6GgoZh6
bWBiX1xbW1tZWVtynbi8u7q+uri/ubOura2nnpiamKSgp7HQu66ztre5u7iyqK2wtry2wLi1s7Gq
qqqho7W/fVllampra2twb29ydHZwc25oaGdgSjxFTFhndoB4d4mFcXJ9gIGopIWNpKWamJGPgGRZ
W2FpbW50r+KYdHaBfYJ/fYaOhn19eXmAen+BhpGYlJeaoaCqrLPZuG1pXVhZWVhWXIGGhoSJhYyV
mJ2dmJiXl5WVk5SPodOymqivqq2ps7WtrqmsrKWsqqagi21na2tvipyYmJebmp2gnZWTj4aGho6m
sYqCho6Nj4+PlqGsrq2ws7C3uby7vMG7wLy4t7y6vLm5wcK1sbm5uba1rp6Tk5OMhn96c29vb4Z0
aGRhZmJlbW5qcm5ubW5wb3RzcXh5f3+CgoOEho+NdGRVVlVcWV9cXmVfWEtHSUdGQ0ExIygsLj4+
Qjg3OUJJUE5QUFJXYGViZYVnWVliZGRqaWpobXeCiIqIhoqPiY6Pko6NjYyPjpKTkpKXnJuYnaCd
lYaKnaGqqqmuqKqtqqyvuKGYloRxZGFfVlZYVlJKQTs6OkBKREJFRkNFR05HQTQzRVRVVVthYGFc
YWJgXGFiYmdkZ3Frc32EiYmGiYuIhoyNkYqAenFwcHuCiJOVl5ugoKWtsLe5s7i+u7a1tba1uLOq
m4R7eHh3cW5xcF9WTVRVXHSToZeYmp6nu6eYoZ+YmJSMi4mDe3BeNR0XH0ZoaHeBeHyBgHx0cWpV
SktPYIFgVFleYmVob3Rzgn13dn99hpujrMLLuKyvsqqwraGdnZ2Xj4+NjIN7jGRHPUBAREE9ODc1
NCcdGRgYFxgWHTNKXH2Rmp2jo6CfnqCfn6GamJiSkYt4e5SxrKysqrmuqKWlo6Gbn5yamJWVhW9M
SW5xeZ2RiIaLjouLiIuIio2EhoaChoiEg4mPl6GhpKeysKijoZ6akn9iUGB/gH2DiISIj5OWmJib
m5iWnJaXmpiWkYl9fXZ3dHF8jKGlsbOurLOzvLiql46bmoiCfWl3qqenrrGwsrOsqrezrrO1s62w
t5GAhY+RmJaWmJ6fnJ2cl4+IhY6Pj4+PioyMhnlwbWJQRUNLbnd8goB9hIWFg399e3h5dHFvaWtw
c2hlaGppaGReXFdYU1BHQ0dOV2dyeHR4eoKJhoaOk5ecpKakpa+traqss6+qqqWho5V4YGaCko6O
jYmRj5iXlaGPhoaFfX2RjIR9e319iYaGhIOEf3l2dGFbboqTlZSampeOiH2KlnxubmdqbWtfT0RO
Zm5vdHt9hYaGiJGSlpKWlpicmqastru8xcrMysvW1tbV1c7MzMfFxcKoiY2WmJuYm6Glm5ubmJiS
jn1ZUFVXXVlZXVdXWVhST01PVlk6NTU3Oz1DSUtMVFlteH2AiIqUnqewtry6wMfLxcDFvLy+ubK5
nHp0dqC8koaPlZqalouGioWFemtranBzpKl9aWJpUjMrNDs7Ozk5OTo6PE5XWVtVWVxZXF9ZVVJP
Um+DiIaKiouOp76glqSjoaGbm5eUk5GPjo+Gf4KRiZaPjH14enZydHR2dHN7e32Ij42TnZyhqaak
oJuamJN2ZmJTWVxlhKCwtrCpoaeotcLHy87S1NLOzcvOvrGqraemrZiOg3BLQUZQYXaYxdvg293X
3NvW2tfRzsyzoam6tbKwt7aqqrynm5eNi4+Pk5aanKCko6eqsLCqpqael5SRjX10YEw7Jh4aGhoe
JyYqO09VUldZWVlbX3RrWVtYU1VZaGZgYWhlZ25lZWRhYm18cm5nYVlbYGFnaGdhWVlfaHSIk5+e
m5qeoJqYjnNicmhxipienZuhpqGhoZySiIB6eXR0eWlHQkdKVGBmfIZza2trc25tdHh9gHx0a2hp
a26BdHJ2e4aMl5iaoJ+bmJuhm6Ojj5WPenFramhoaG9ZPT1GUGt6hY2Sj5GSj4+TnpqOfXp8hIF9
fYaMpJaSj4Fwbmppa2JXUEtTa2ReZGtvdnuFiYuPj5OUko6Cc11LPj09PTUoIyggHhoREQ4LDQ8R
GB4oO0FLUFNVWFldXWJfWWF0VVRecouXl5icmpuYmpyYlZqUhnp2XlJWXWR7hYaIiIOGf3dva21y
gHhqam13k6yhoKCnsbCyrK22qaWYj4uLj4N7f32Bhp+mrK68w7m1usG4sq6vsKiflYiAe3p6fIWG
jI6MjIyJhYaGhIiGgHZuaGFZOywjJjJETVNZXGBiaWhmaHFyf5WjpLGzsa+trbC3sq6qsbG1s6qj
oKOem56cn5qXnpSYnpycnpqcnJ+XlJWFd2tvhpeYm5iUk5eSlI2Kg3d0dIaTlZqcm5uVlZGEfHJk
aHGFpZiUmp6fqq+yuLq1tbm7v7y/vLq3s66prrGxrKOcl496cXuNmpygoKCcl56hpqa31rqjn5al
n4+UlJehoaOekoZ4aG1dWFhWW1ZUVFddYmhtc3qBgouWlpWNhH18em1nYl1gYWlre4aEf5KYko+P
lpSKgHx0cGlmaWlqaGlpYV9ZX2RnZm5xcnJ0eYCAgoWLj5GTlZGbm5ujqqqjp62trKyvrrC1qZ2a
qoJoYmtZXV9paWBfYmRwa2Zoamtzd3l6eHR2dnN0bW1vbW+RlY+KhouTlo+LiIaCfXh0gXNrZWlg
YmlmZGdobXFraWprcW1mZWdhZ21ubWpnYWdxc3h3d3N0dHR4e5qEfIqaoKemoZ6hoKmhj4htamRf
W19eWVlee5aywcjOu7a+vry3ua2no6GXk5SqxLKkqbKwtri3t7KzusO8tru8sbW6t7Wztbetrqyk
oaiDZ19oaGVpb2ppa25rcW5naG1pYFhGMSo0Vm53bnBxc3p5eHh5fZWNhouMm6GVjXtbT1BcaG9u
c3B6g3p8eX17f4GEg4aAf390eHx4eYGKjpWWnZucnL6+s86MbXeDfVJMUE99l3d5eoGGjJOYnJiV
mJWYl5SVlpShzbOnsq2qrbGuqamqpaqqqailpKV9Z2ttb2+Mp6WblZSYl5aYlY+Kj4uEhYaGjIyG
houMjpOYmp2qqqiqs8DN4MKxsr6+wLy2s7m6urq2usG5s7O2sa2pn5eXl5WWjIyTiIR4b2hiZGJn
YmJkaHl0hGtoa29xdnR0dHd5ent8f4aMjIRxXlBTWV5iYGBcYm5SVFlJQz5BPjIuKyw1Q0lOUE9W
VllcXWBgXGBfaWtlZWFiZWRkZWhlb3Jxb32JgoSJhoqIho2LjpGIiI2OjoiLlZ2koKSfnp+YhYKa
oaiqraekqrGwraqmm5aciXRqXltVUFRUT0A+Qjc8RFxWRUVDQkdGRkRDPjU+U1hXWVtZXF5dXFdb
VlhZXF1laXB2eYKIhoOEhoaJhoaLhnpyZGFhcnuEjJOanqOqpKmuu7q7vMHCuri+urq4usG7hnd8
c3R0cW9/dFlSYG+GgoKJlJyeqbapnqCfnZyVk5GOiYZ9dGtLJh0lRWFre32CgIF/fYN2X05MSkRJ
SU9TUF1hZGZ4c3FucXR2gYuWpK6zuLm3uLe6t7Gtr6qlp6Gfm5KLhHx0ZE9CPj5EQj41NDVAKxwY
GhkaGBkaIT5rjpioqaanqKalpKOdmJqbl46IhXeBw7aloaenqqmtqaGppaShn6qaj419YlBOVmh8
kYuFgoaJjIiGiYaGiIaBhYOEg319hpORmJukqaGtrKyqnZF6ak07SXS3rp2DgH2Lk5WTmJWanZiX
mJiYmJKNiYWGc3NtbmZ2j6GhqKesqaekn5uVj7KzjIF7d2KCoaqqsLCuqqqus7Kyr6+qsa+ejYmP
j5icmKmjnZ+fmpqXlZSRkY6OlJiTjoyFfHSMemZXRkdoeYJ9en2KjIWCgoKAfHR0cm9wc3RwZmJo
Z2tpaGRfWVdUWGVQQUlUaG94d3t9gouLmIyIi5GYnKGnqqqorK2qqKqupJaTnnJteZKRjJKUjYmL
j4+OlomGhoR9enh6fXt9f3l6f3uAhYmGenRrXl15j5GXmJaYmJKLhIWBenJ3dnBoX09GQk9la3Z3
fHx9hYmMkZOXnJaamJygqrO4u7zHycnLzs3X2dHQ0NDSzsnFuZyNlZieo6Chn6ahoZySlJqVhWFP
UFRWWFldWVldWVlZV1BOQSwsLzVAYF1UWF9iYW2FhICGjJehubewtb/Fy8vLzMvFxcXAwrmchHd6
gIyMkZGSk4+Pj5GPjYRpZmdoZ2qKiXtqZWtgPTdFS0FBPDk7OzxDU1RWWV5cXFhcWVZdVlBOUnOC
gIaMlZKesqWhqq+nnp6enZySjo6Uk4qGio+OjZqRhH9/eHx9eXuBe3+Af4GLmpibpqispp+enZqY
hnhrZF9bYGt8o7Gtp6iqoZqgtsXNzNXUztHQ0MW2ta6usrCloY+BZEpES1ZifKC+1tfZ1tfX1dbX
0MvMyKiUnaqko6GvsJ2YqZSPk42MjZGUlp6koaSmqLW2raeqpJuWkY+PpY9YRzogGhoaHRwmKDNE
UFleZ1tZXF1hg3lfXl5XV1lZXGhpa2lraGptZ2VpeX15fHFiW19fYWdlYlteXmRrd4iRlpyhpKSd
mJqSiISUcGp9j5qgpKajqqqmnI2Ce3NtZWRYRz5BRUpXa3l/g3dxc21xeX+Kjpygl4+Ec3Bxc3R2
eXt/g4aGkp6dl5eTlZWdoZiblYZ2b2dlaGZnWUc5OUNNZYGEho+VlY+GjpS7mH98g4mLiYSKj4+f
lpSXkYh3bm5kYV5ZTlRtZWJocnh7gomJjo+UnpSUjX9iUktBPj05NSsmIh4fHBUMCAsNDRETGSMn
LDdCS1BUVFdWWFdOUFdXXW19j5aYmJ6anZiYm5SYkY+GfYZvVE9PYnuEg4SAfX97fJJ5cGttbXJw
cHqYmJWcpKitr7Gvs7OhlZGOjo6OiYmGgoaXtq6srbLKyLW3uLGzsaWmoZaPhn92cHB0gIB/hIqG
iIWGiIaIiYmAenNnWTcnIh4nPlZTWWBhYmRrYmBtaGVrhpqenqmvsK6tr7O6t62wrrGvqqGhoZ6d
nZeVmJSUj4+RjpGRlpufm46Iho+OgnN0iaebj4+PlpSMhYiCdHF/i4uPlZqcmJuYmIuJe3aFj52s
mpOVlpyhqa21tru8tbe6vr68urmysK23vLOup6Cfm4Bzj5Scm6CfnZ+enKnHzdfl1crBrLOompiY
m6Ghm5eXjYNzXF5ZV1dYV2tdS0xibXBud3l4gIKDiIJ6fHiGa1xXXWBqb29went5k4+RkpKVj4uB
e3RxampqamtnaWhlW1lhXl9ha21zcXN7fICChZGPiI6NlZeYn6DKzqWeoKWkqaqvqqeem5iRa1hk
aWBiYWJiYmpqYmVcYGBhaGhpbXR0c3JvbmtqaGJiboGEgoOKipGOhoWBfXx0cHBtaWFfYmthXmFi
ZWlna21rbmVmZm1rZmVwamVlZWFfa3yIe3p0hHlycHh0cHSCkZyjp6Woo6CcnJiUjXNnYVhZWFxg
ZXeapLG8wb7Cu7W8trCtqqCYl4+Mi5i4raeoqrCzs7a8u7a3uLe8uLjFvLavsbO2s7Ktt7Cko7B2
YWFoaWpra2twbWtqa5SEaWFZVlBMYItzbm9ra3B0eX16eHR9f32FiYB9ent2alhYX2dzeXF0eaaG
dIGAf32EgoCDiImKhntzdnZygYqMkpablp6ko67y741udoiAYEpAPnG3dmt0fYaGjpaXlZWYlpaY
nZeUlJKUmKqpqKq3p6eqqqmqqKioqq2poHRiZWlze52tnpiUmpiYmpiPi4uJf39/eH2GhIaNi4yS
lpiYmJyYkoWWxdPKvLnBxMS/uLi4ure4trzDwraysK61uK+hmJWWl5efyenw2qZqVldTW1tbX11h
aGdua2toaW5ybnBzdnd8d3mChJGzj29ZUFRWWV5cXF5dTUNBQ0VGQD44MTA1PElXXVdSVFVVXVtg
a2JeXl9fXl9kb25dXWJkZWhncXJ2gX97e4SLiYSEhoaEiYyMiY6Ji4qNlp6fnZiYnJiLfY2hpaSq
ra6pqaqspqCgoZeaem5pYFlVUFJJPjs7NzlMfXhJQUNDREVEQ0dGREVWVllbWWFdWFlXUFJVUlBZ
WWJocHR4fX2BgIF9goqKi5SLa2VgV19re4aKj5ahpKOhqrO4ube4uL6/t7e6urrAxbiggXh0c3Jx
a3FmV05Uf6GKioyPkpqw1KeOlqGgmpufj46FgHx3a252MzFZZGtzfICAgnt0i31bRj5CQ0NHS1RW
V11nbXBrZWZudH2GlaGqr7e+vMC8u7q1trevqKympqWfmJOPgnZtVmp7Sj5FQUA8ODwwHh4ZGhoX
GBojTYScp6mtr6yusqqjp6ampZyel42GenKIoaSmp6ioqaeqpqaho6CgoJiPiYZvWVlcanuGho6K
ioqKiYqMjomKioWJiIV9enqInZiMjIyPkpulutSVbXppVVJfe6elmpJ9fYGJjo+TnJqYlJ+onZqU
j5GCjJ52b3Bzam56jJqWmJ2emJabmJWRj42IhoGEamiUrLCorrOxr7C3tba3sa+6yKiLiI+Xj5TB
+8mYlpygmpeWlJeRjY2PlpeRiYR6e3p5dnNgUmFxd3p5eX99hoiIhoN/fXt2cnJ0c3BiYmZoamlo
YmFeW11bYlNKUGuklG9qdoGGo5SFhpWXlp6foaGqpqmxrqytpaGlmIR0cnmJjY2TlI+LjYqOio6M
jYmGhXt8dHJxcnN0cnl8enx/g4F6d2lXYoCPjYuLk5qWlpSGfHl9f3+EenBUPjo+TmJobnJ4eXt9
houLkZORlZypvqWkrbm2wbu6vMXJ0dfN09bNzNDKy9Kqk5GUmqClp6msp6CdmJ2bmJOLa1BNT1VW
WVlWWFlZXFdSUElDOC4zQFbF1G5YX2JiZW97go+aqK62s7i4vsTOzsfOy8fE0drKuL6hgnd2fYiR
jIiDiYyPhomOhmVfZmhobXRvaGBdYVlEPkRLRmJHOTc5PkxWWV5iZWReXl5eV3yAUkdNZXqBgISc
lZSUmKmzsqmlo5+amJaSkpSPioySioqNjY+LiIODiIZ9gH19enx6d3qgpp+lpaSloZyYmJqMeG1m
YmJpdH+Ura6npZ+TgoqtxdDOztTXzdndxbmztrOztrGqmIhuVk5PWWWFp8LO1tXV1tfX087U0MSz
o5eUnJubmp2LfYKFhomNjY+RlpiboJ2hoaeqrbOuqKmgmpiTjYmUfV9MOiogGh0aGh8pPEpVWW+I
Zl9bXGFhYGFgXFhSYmBZZGtnbXFwcXZrbWt/gHR0cm1hXl1hYmViYmRiaXJ9i5ObmpukpJ6bmJSN
kpdpYW+JlpyfoaGkqKCYjX10aVxZVUdDQ0ZKVmF9jZKRjIRzcHeYoJqdnJ+em5eJenJ2dnZydnh6
g4qOj5KSkpeWpKGemJiTjHhwaWhkYmVKOjg6Qk1TdIKKjpGPjIuGhpiOfYGEiY6IhpKTk5GUl5yX
joN9bWVlYFlLT25vbnB0fYGJjI2RkZehk4yGdFxOUE1EPTgyLislICUlIhcRCwsNDRMXHiYqKjI8
Rk9OVmBZUENAWXKEgoOIj5SYnpuor5ycl5aTjIWBhmtVT01vgISGhYSDgHp/jHx2c3R2dHp6gZib
mJijpKiurK6kpZ2Sm5eNjoyKiYqLobOvqa61u8K/v8C1sbOurKSYj4iBeHdxb3N6goKCg4SJhIGF
hoOAfXlzbmZVKxoXHSdAVFdhc2tlZmVgYmViZWh/kp6nqrGxrqiur62qqqOmpKSgm5yYm5yXlJOS
pouBgH2FhYaLjI+OhY6hqqSVj5GPlI+Pi5GTiYOPiXRtaXl5lqaJi5aapKmqp52XmJiYmp2Ymp2g
oaOqqq2zvrazubm5urK4vLq7vry8ubawpp6Wgn+WoaCfoZ+kqKezxeDXzdDV0cXFu66lnZSen5ih
mKOaiXpvYV1WVVVUd2pFOklia3l0dHqBhYCChIOFeW9gXF5laHBxcHR6enqWlpeUlJWUiYaBeXRz
a2diaGtpaGBicaB5XWJnb3Rzg7mTfH2ThIqdjYaMkZ2elZifnKSlqamqqqqopqChno9xW11iX2Rr
aGV0dGprZ2JcYGJhZW5wa2twbW1uamVgW2BidnuDfYCDhoaGgnl4eXJnXV9iX11dZWpiYGRoamhm
aG1paWJkZmZrZGRnZ2ZkYmVzdHNyb25vc3ZxbXBzhZKbn6GgoJ+goJ6mpqCsiGRbW11cXWKJpaaw
tbe4ubm4ubKvsK6km5eLiHlWbaGqqqyus7eztrm8ubm4s7a+wLqzvLu3ycGtqqmurKqtzIhZXGZl
YWJkZWJiZWVobmtqaGBXTkpQZXRvb21wcHFyd3l7fHuAe319gHt5cWpVVmlVT2hucXB0dHd7jYF5
en2AgX2AgIZ/dG9xcXB4iI+PlJWVnZ2YmJ6OgIGDgouUXT41Q4twanmBhouMlJKUkY+TlJ6dmJiX
l5OYn7Kzra2qp6epqqinqqqoqqaFYmF0c5e6rZ6dnJ6gmp2ks7GPhImhj3x9e3yCho+Pj4+Ul5ab
l5iXlp/Ay7+8xcDFxby8vLqztrizvMG4r7CvtrqzrqSWlpKVmKaxuLykiYF4dGtQUlZUW1lZYlld
Z2Zra2ttbmtxcXN0dnqBhX90cmphWVJWWGJhXm1JPDlEXUxMQzU0PktOTVNZVVVVWVleYmFcYWJi
YF9iYmJhZGFgYmJmYmRtd3yAeHR2eYGCgoaGhoSDiIaGiIWBiY6RlZidqJ6eo4+Bi6q1qqqhoaWq
samvpqiyln95fXNkX1lVU1BDNTQ6O0yNfUc5PUNARkZFRUlZWVldX1xfdGZZV1BQVE5MTFBTXGVr
cnl7fHyAfYF9f4GFi4VPOERlb3R9jo6OlpuhoaSqr7Kztrq4v7y8uru3try4s6ONgXx6eHNrYVtU
S1Jhe4qRlJKdmJqgn56enJ2bmqCYioiEfXpwc5ZCLE1hf499fIOGhHyDeldGR0ZGR09KREpkX2Fl
ZGR4cW1zf42hra6zvLi7v7y8vrm5uLy6s6+vpqGflZSRhnFWYm9dVllbYFtNQCwgHiAaHR0aGjFr
u8OusLCsrbOyra2nqKmhp6CYjoRya4ScoaWjoaeusaqnqaqkoaGcm5iOg29iWV90jYuKhoiJjIyK
hIaKio6IhYmGg397ZWiOqnxtc3yChY+VmH2BqJd5dHBxioaBe3R8g4aNlKCelpiYs+aqj42Gg4B4
eHh6c210b2p0jY+SlI6PlJWUk4+PjomEgXtrXWuUrrGxrqy1ubK5vLOvtbOvnZGRmJeXp+L+56CV
oaGbmpuamJSUk5GOiX97en9/fHx4dHFxa2pzeHl6d3yDgn2CioaGiYF7e3txcGtfX2FnZ2ZhYGBc
X1lVVlligY+Lg4F8i4+GhIWGiY6Pkpigp6GlpqShpKSkspiMfXRrdI2Nj4yOko2Ki4qGho6KhoaG
fHxza2hrcnR0dHh6ent6fXpzZFhzg4iUk4+Nko+anYx/f318gYN9dF9MPD5VZWtudHl6e4CChomK
j5OPlcHmpqOyub68wN3OurzN4NHMztPTzsvIw6ablZigo6WkqqqnqKGhnJqYlo+AVUtTUlZUV1lf
W1lYVlVYcl1DNTJCYpangnd5f21kaXR9jamzrrG1t7m/y83HxcvNyMfHzcXAybB/dHl8g4+JhICE
ioaGg4RvZmZnam1vbmhkXllbTj06R0NFRUFAQENBR1VfXV5gX19dV1VZYF1MTFNkc3d9goqNlJie
r7OqqqijoJuYlpOPhoaJkp6UioqKjomGiIWBg4iJgn19eHZycIiYoKaloaGbnJSapKGFZmFia3+P
lJakqKeklXtud5O3yMjEzdDLxb/Hx7fAv6+vqqSUinRhVlNcaIuvvsnX19DNy87N0c3KvKWamJaX
lpORhXx/fYOEi4+RkY+PkpqeoKGlraevs66nnZ2dk4+JhntvWUxGQDs1Jh0aHShJTlBVWFxdYGJn
Z2ZibX1iVlVVUldobWVtc3NzcHNucoJ0cG1xc2thXFZZXmR3eKqWa3iJlaCfoaOjpKGdlZKJcWJi
anmGmJufoa2tnZGOhHloXVtHQkdQUFx3iZORnJuYk4Z5g5ybl52kpaehnaeGdnR2fH15hH9/k4+L
jJOYns3guJaYmpSTgHFtZmJiZEc+PkBHTlBddIqRjImEhoaAfH99f4aLjImFho6LkZaYmJiXmJR4
aGViWUtPc3J0eICDio2NlJGLjZOPjIFvW1NOSUVAOzUuKicqLjU1LCMaExEUGBgfMygsNTM4PkFK
b1xALztcfI6CgIaKj5qbnKOhmJucl5iJhoV3ZlBZZXqXioCAhoWEfXp4eXp4dnp2fX99j4+Xlpyf
o6Wqs66lnJialJSUkYyGipi1uK2ztbO6ubm+vryzsKylnpGGgXlxb3FudHt/fX19gX2DhIKBgYWC
eHZrYUUjFBkeLEFTXGl/dG1ta2dla2dlaHKFl6Cmqqysp6Chpqidn52hoZycoJuVl46Mj4+OiIN/
iKCLeXp4d4GGnqmoqKWnqp+PjpKMjIWBf5SObmFlZW+FkpGRmJyosLOsp6aon5eYnZiYmJ2gpKah
qa6utryzs7i8vri8v7/AwMi+r6qkoZuUkpWcm52fpaGns8jW1tbT0dPO0s3Buq2gmJehm5SYoZOL
hXRgWVZSVFRXS0IzR15pbW9xfIKEhIZ/eoJ3a2JZYGlqb290f3yBg5OUlJGNlpaKhX9/eXFyb2Jf
ZGRoZmBijKZqWWRmanN0eHh7fH2EhIiKjI2Pk6CYmJyeo6GhqKinpKSfnaOdk39oYmFla3hwZGtw
d3lnYV9kXlxgYmVmZ2dva2hkXlldWVlqe3x8fYWAhYN9fHdrYkc0NVJdX2FfYmhmYmhraWlpa21q
X2FmYVlbX2RkZmReZXBwa2docHFzd3pwb3eGlp6hoZ+dn5+apaqxsq6jkXh8ZF5eb5GerLy2s7O3
ubq8ta+tppuaj4RiQVSNnKWqsLOztbi4t7OytrW2uLm6ube4ubzFt7GurKiqpaWgiGVdWVtfZGJn
aGRlZmFkZGBeWVRcXqCAZWhta29xcHl/dnp7enx/e3t2cnFvaF9SS0pMZXBxcHFxd3uAeHh9gXx0
eXx/hoOGYE9JTFl4iY+UkZKYlJGPiIyurYZ/iH+RaTceI01mdHyGiY+PiouPlpejspqWnZSSk4+U
nKitsK6tqqmkpaWnqq+80ZdcYWiCr7msnJydnZ+doainqqqhhX2JiqeAb32GiI2PlJeYm5uVl57F
5dPBvrzR0MW8vL66vrm1tru8wbiws7i3t7eyrp+VkpSXlI2PlpGPi4aGdIFbTU9WUFVdXVleYnNy
ZmZra2tzcnRxeHx5dnRvbXBpWVZVX2liXDs4PD5QQz5JTltkZGtnX1hVUlNXWWBmYmJiYmJkYV5k
YmJiZnF2fWliaYSCenJyc3Z5fH19f4B9e319fYSCf4KGjI+Vm5iYmJegmoaAmqWoqaSoraqlpKaj
oZ2bj4h7eG1iXlBJOzUzMzU1PExkTj5BQUZHRUVMWF5ga2VhYmBhXl1fWFZWS0A1LjRUaXBzdnh4
e3p8fX2BiIaGdko6VXp8eH+JjI6WnKGhpKeyt7Oxuru5vLy3ubizs7awnZOGd3Nvcm5iXE9OVGJ5
io+araqbnqGgoJ+foJyYmqeSho+GdG1mVy4sXXBzd3yBgoB/fYBpUklEQ0NFUlBNUmJhYWJlZmRq
c3uMlaGts7nAv7y7vMG7u7+8t7q8uLKvqqSjoJaMf19bZGp9iI2PlJJxTTUoIygmJSMlQGuXqLKz
sbKtr7Oxqqqtp6Ogm5ibinZnf5OdpKClpKqqqKmnpaGhnp2elo+PdGBdZ4KNhoaLiIaGjpGNiIaJ
iYiKiIF9e3xgVV9ocnFwdHd6fX2AiIuLhn+BfHh5dnp7eHd9fYWe4MqXkpiYoZ+Xk4qGf4Cae2tr
aWtoZ22NjIGDjpaUjo+Uk4+IioF/gntyYW2XsK2pqrKys7a5ubOus7yqlJGUlZeezO21mJecoKOh
nJqYl5eSj5GLiX97eX18gHt7eHR6b2VweXZ2fISAgIWEhH+ChH99dnNxaGJhYV9gXlxfWVtcYl1i
anJ/hoqDgnqPlYWGjYqJqrCPjpKWnKOjnZqfn5uVjIZ7cm+Gj4aGiImNi5KOj5GLlIyPkoF5d3Bq
aGptbnJ4e3t0fICBfW5ZX3OCiI+Rk5SPjoqLiIR9gIJ/fXpuZl9URFlpZ253dHl/gIKDjI+SkZed
u+Coqru4uL670su8u87pyr/ZzsLDubOtpJSYoJ2krKyurqqppKCXmJiSko9gRkdOV1xrYmVkX1xX
WFuJalVHPlt5hIuNlIuAfXNobXieuLG1s7W8x8jKysvIyMzMycrMxL64qJOBfIOCj396fYCypIBv
ZGJoZXt9aGdlXFxYU1BUR0dFQj5BQUI+PDxEUFlbWVtbWVhYWFBQSlRPVWRpa3iEiI2TmKe2t6+t
sKyhnp6cmJKOiY6Rj5GPj5OXko6LioqOj4yKi4N6fXZwdIabpqWhn5+Yl5qeknhra290j7Owqp6Y
mJiPgnZ4jam7xcrMycS7vMjFuru7s66np5+KaWJeW2J7lazBxMrSztXS0NHU0cKonZqSlpiVk4qD
fICAhIqYmI+NiI+XmpeYo6Wsr7OuraijmpqTkZGGe2teUFJKSVBCMiUjLk5QUlhYXmRiZWJkZWZo
Z19ZWVlUWGtrbnRubn+DdHFzd3hxa25vamJZU1VWWWt8nZF/hY2Xo6aqrqyloJuWko13YWJob32P
n6Ox0L6jk4+GeG9rZlBJTFReeJ+kmJibmp2gn5SPlpqgpqaqqaWhtot0dHZ9f3l2cnSIi42WnZ2h
vMionJ6gnJWFcGhpZm1hRz08QkdQU1lrhpiOiYN/f4J9eniGiYaGiYyIjZOVlpeYoZuVlXtmZWRi
SlNwfH+CgYaLhoqTn5eLio2LgHBfVFlMR0I+NSwvLjQ4PkE6NSkfGhUZHSIoIiYrKiwvMjhJOjE1
R2J6g4SJi42PlZygnpido56VlI+MhH1zXmZziZqDe4GChIB5eXp7eXd9e315d3aIjpebmJ+hoaWp
rKqXj5OVj4yLjoqSnqmosLK1t7W3wcG8t7CqqZ2bj4R9d25tc3R0d32Bf3+Bg4SCfYB/gX1xaWRY
PSYdGR80T11rc29vcWtvbW1nZGdlaXqMmp6jpKWhn52gn5eVlpWWmqOqnYR/goaCgYKBeXuIr4Jq
bXJyeJOqs7CsqqyqrqGYm5SIg3ZnaWllX2RkeXOIhYyRmKq3s7OvqqehnZyfoJyYmqChnKGusK2y
tbGws7a5uMDBvL7Ex7+1raWhlIGEjpWcoaCmp7PMztHV29nT1dPS1Mu+taWalZWdn6Ogn5aGgXJr
XmJiWFRQUFBVYnBydnx/f31/g4F8f3NuZGFiaGpuc3SFiICGlJGVj5SbjIaJhHt7dG5iYWJiYGRg
WVticGZiYmJna3B0dHh5fIKBf4OJnaGPj5GVl5iYlI6YpqylpqSknpqShnFkYmZmaGpqbW5paGZk
ZF5dXlxZYF9kZGFiYGFZVlBQUlxrgJ2FdHiJgYSAe1k5KzFHWV9iZWFhYl1cXGBqa2lqZmJgX2dr
YltZZGhhXFxxhG1kaGZqb3Rta3BrcoaYnqGdnpudnqeqrq+tqKWjnoVha4aWpa6zsrKvrq+wsq6o
qqqpmI2LfWlcm6igo6qqsbm3uru3ubi1s7a2uLu4u7y3t7izrKqpqqmjnpqKallgYFxdYWJhYWZi
XFteYF5cWVlXj3Rpa21vb292dnR7eXF0dnN2dnt5dGtpWE9HS1t4cm5yb21weHR2e3t7eHh5dHp7
ipROPEJKaYaIio2RkY+TlIqJiZKKgYODgJ5vOywsRmFycniIiomOjoyPkpiamJ+am5GKk46Xrbax
sK6oqaqno6Ows8vAdluBtaqoqqGfo6SfnqGqqq2urbalgXN6fXmNiIyMj4+SmKCtoZqepMXgzsPB
xcXEwsHCwbe2uL/EvMvMvLGtsrW5wcOznpSXmpiTj4yPkY+PioaCfGZVTk5SVVhZWVldW2JtdnZr
aGpra3B0d3N3dHF2dHpvWFBVVFhYQD07PFZDSWBZW2JgZnp6dGdbX11bXVlfamJfYmdhYnprYmt8
goaBcWd0hHlucHZ0c3N0dnh8fXt7en19fHt3eoOJiIyRlJiYmpuMgX+Srqihpqegp6iur5+hnpaN
jIZ9d3RrXElANzEyNT05NztDRkVDQkNHRVBbYWVyb2tmZWJmZmBfXGRQPSYdIEFobnN3eHR2dnh8
e3yBf4BwUkdlgoB/eH+BjpWfo6SnrbCysrG2s7O/ubzFu7Wzt7CfloJ0b25mYlx5XEdOVneOmJuq
s6SkpqOho6CcoJeSnJOGlJhzaV5CKDFedHl9fX1/f4F5inROQ0FCREJESVtfXGBgZWRlaXB2iJeh
qK63vLq7vr/DvsHBxbyxs7m7t7KqqqOdlJJ/cHN8i4+Wm52blYRzUEE1Pjo0MzVHbY+qs7Kur7Oy
tbOssbeqoZ6clI2Jf258kZidnZqlraalqqakpaaknpqTk5t2YmWFjYiFhIuMhoWGhouLiomGhoyG
hYB7cFZYXmZvbW9wdHh6g4KGioWJhYR9e3p3eHx4eHd5i4+YlJOYmp+Yk5OYj4B7dHBybXF3b2lk
ZoCPhoaGiYmMj5GPi5GOi4yIhIBvYomqqrLFr6q1u7i1s7++u7m5r5qVmqCfn6mmpaGfmJihnpKV
lpWRj4V9end8fHt7fXt6e3h5a2+Bm3x3enx9gn+AhIB/goB5cG1mZmVmZmJgYF1ZXl5feW9pcXuJ
hoOCg319f4OJho+PjIuMj5WWlZqjnJyWlY6Rmph0b4CJi4yNhomPspqMjYuYjoiKfXZrbXtwZmlr
cHJzdnd4d3h6k2tmeYKNj46PjpWPioSEjYWOjYOBiHtvamVdYmhoaHF0enp9hoWGi46SlpShyaeV
pbzCwsHAvLu+wsTFx8G6vMG+treol5Oanqaqr7Oxs6qqo52Ym5eTj2pOTk1Va3RuZWJfYlxQUFJO
UElScI+TipKsmI6NhHRveo+os7GzucXZ0MrNzcrNyb7CzcrHw7WojoGGoYp8ZmtwcoZ4Z2diYmlo
i4ptYFxfVk9NVVlTR0E+QEFBREQ+QEVNVlViYmpdWVhZV1RbX1VTWWJofYWGjJKYqrm3s7Kuqqao
oZqenJSOjYqLlJuXloyPkouPj5KMjoqNjIZ9enh4e42hpqOhpJiboZyEc2ttcX2LlKeqp5iRjIiJ
hIWXprjWwri7wL67tr65t7WyrqadnIloW1heYoKgt8PLztPQzs7KztHEsZ+Xlo+Sj42Mhn13doKP
kpiUk5SRlJaXnZ2hp6qusK2noZycmI+Miox8ZlhWYlhPUEtQNR8nPk1ZXltZXWZxYV9gYl1ZX19i
YmJra2tybXR2gHtzcnN3cnBvbW9oXVBOTU1QVllmcIGSmJuYn6WqrKWfoJeUjm9iZGdvhpKdqbCw
qqaglYqCdnR0aE1QWW+BmqGcmJidoZ+hlpuYoaeno6GhoJ+YhYOBg316d3RyfYSNl5qan7vBw7ao
paGhn450amJgYFBDPkJHTllgb5aSlJKLhIKDe3d6fYGGhoSIhoiJio6WlJabl5aMe2thXVZLUGl2
pYl5hoiJjpOPjYyPhYV6a15VVU1JRzszLzQ5PURJREI9OS8jGhkaHCAjIiYqLDMvKysuLzpNbXl8
hYiLk5aVm52bm6Chn5iYkYqGgHBram56hIJ/goCDfYJ/gn19eX1/fHx3eoOKjI+PlpueoaOnsaGX
kYyPj4+NjpuxsMXLrqyzs7e8vraxraqkmo+KgXx2a218homFenp9fHx8fX2Bf318fHFwbVw+MCUi
Jz5pe3p0bnFzdG9ydG5rcnBnbn2OmJ+bmpeYk5eXk5GPj4yEfIJ9d3R9fH16fIB9fHp8cmhoa3GC
paqqrbOuqrG4rpeXlI6ShG9bV1ZZX2BtbXR4gZahsLCysa+qp6elpJ+emJqdnaGnpqitsbW6srK6
vLy4vLy8wcXFurCoqKGFa3+TmJ2am6CpusjN0dTW19nU0NHUyb/CwamTlJiYpZ2Xk5OSiYRqaGBf
W1xcU2JrcnJxeX2Df316eoB7cmpgYGRiZ3RvdICAf4WVko6Ulo+PjIaBfXt5bWVfXl1ZYpZ2WFlb
XV9fZWRtZ2dudnB2d3x/hICEhoqPkp22o5GKiIyaqKOem6ChmJOPhnRqanNraGlqa2tmaGViYGJk
YWBhX2JiYGBZV1NYTkpES2u+9PapYm5yf7mVPiI1TFRXW15eYV1eXV5kZmpnaWhoYmJhZ2dgXVZb
ZGJeXVxpa2VlZWJmbW9wcnSFkZyjpKOgm6Wor7W6trGspaemo5Khs6GjrbKvr7W1sbCusrCsp56a
lpqPbW2boaGorbC3s7O5urm3tra5vLu4vLeytbO5ure1t66pqqOgj4trYlxXU1dZWVthZW1/YVlv
XlJZUD1Wa3Zxc3N2d3d5e312dIp0c3t9eXRzd25rUE1qc315d3J0e21ranB0eXd0dHN0dHlkU0dJ
UmZ5i4uIjI+Lj5iPhIWGhoSBgn94km4+NzU+VWdrdIKKj4uIiJianpqdpqScjICGjsTDra+zsqqp
qaakqqixs5hgYYuzr6SnpqSjo6aqqKmprqmoqKGPhoB0c4qSj4qNlpSanqWqnZ+npqq61czBwMfF
wLy8wMDEv7u1zu7Bqaets7KwtqydlZiUl5SSko+UlZaNioZ/dHtcUE5QUFVVV1tYVVlgYmZqaGhv
cXp4c3h2eXl4gIBnVFBVVlNQOzM6RFNbWV5ZX2JncnJybnRuXF5dX11cXl9fX2JlYmhve4OKjYyP
kol7cXBtbW5ydHR4fHl4e3p/dnl7d3Z5gYiNi5SYlpeYlH17f4ydpaednKGlpaqmo6GgnaCck4qB
eHNeTD4xLDMzNzpBPkFFTUdGSU5LVmBlZmdnamprZ2ZpZWJZVkxKPSYeNF5qa3BubnF0d3h6eH+l
j2FQYoGGf4N/fYaOlJqdo6mtrqmvs7a6tbe4ur6vrbCws56Rg25iYmBdVWdYQkZScYykvrKtqq6t
raWel5eXnqyqnYR9dHFqWzcmNFR0fYB9fYCFgnxyXkdGQUA9RktUWGFfaGVgYmZpcX2RnqmztbW2
ur7CwLu5ucG+uLu7urazsbOzqp+dm5SSj5SgpKmqpp6Vj4V8YFVgYGJgVWR8lKezubW2srCzsa6q
qqakpZaRj4mAjYaFj56hpKelqamlpqappJ6dmJSXo3RlcoCIhoSFiImMiY2Mj4mJiIaMiIaEenx0
WVNWYW5tcXh4fIOJjY+Rj5KMhIR9fXt6enZydHiCi4+JjZeUl5iSj4mEenNwbnB2gJKheIJ9dHqF
fYGBhouLj4yNjI+UjoyIhn1rhqG5zKmkrK+3uLq1s7m8wMjBrZ+Yo56coaqmpaGhn52XlZeRjpGT
ioB9fX19fIJ9eXx9j4Z2Z3CFenZ2enx6e313e4F8enJ0bm59gntuYFlYXllYWFVZXWVvfYWGhYZ/
dn+IiI6KiYaGhouOkpWWmJehnJ6TjIaNinCAmI2GhIaMjIuWj42OjYuIiYF5cWRhWWJmaGZnbW92
d3aAgWtoWVxyg4aEhpGRlY6EgYWGgISEgYaDem5qZGZ3dGVobXN3fXyAgYWKjY2PlJiblpqnuNfJ
trnAvr+8wL65trC2rq+ur6CRkpyhpaenqq6wrKShm5qblZGVeFBHVGptcW5raWhoYllPR0dLWHKL
kY+Pj5SXnZqWloZ3jLq2s7e+28vDydrW3s3DysnEycG/tqiPhISGeWtZUFBUX1ZUWWVna21namhe
WVVPUFBOVVNGQ0FFQ0dLQ0M8PkRKVYZ7fWVVVFZgYmJeU1dWX2V0gYGKkpawwrq4uLOurqanpaGe
pMe1i4iarZSPkpOUlpSPjI2Mj5KXm42Egn+FnrmzoaGYmJWRi3pycHF8jZaYmJyemJiXjIyEip21
wNDDu7q+xb68ury4sKyon56bgWpgZGJlco+pv8vOzs3O1NTMwrinnJaVkY+Oj5KXqX13g5ahpJyU
l46PkZKanqGmo6evrKahnpKPj4qLiIRwYFdVUlBWVU1HMiY9T09NVVVZX2JeYmRgZmJmbnFpdoZt
bnp2dnZ0eXR0eHl0cG5whX1cUExGQ0NDS194hpOYn6SpqqqnpKGjmpGTeVxfa3qNmKq5taqqpqCd
j4V9e32Mgl1geZKUmJ6dnJifo6GYnKGjo6OppaGhnJOGhoaAgnp4dHOBhqnKn5yjuLy1qqmpnJia
jXhnYFlJPj4+R0tVWXyElZ6fjIWGi4Z6eIOLj4qEgoaMipKPjY2RlJeYkYl/bmBZU01UZ2+EgICI
houNioqNi4yMg3loV1NLSVdTPDM3QT5ETUtFQUQ8ODAjHR0jISMjIyYrLisrKS41R19vc32DjJKU
lpOanp6hsKqxqpiNiYOAeXZzdnR6fYCCgn95fH+CfX+FfX19end2do+af4CIj5aYl52joZ6PkZWR
mJaToaiqvsmwqq+vtra1ubKtqJqSjIR8dG5nZoCmoYh5eXp0d3t2fX+EgH13dHBta29YPjAvRXaI
fXRzc3t5eXl2cG1zbWtqcYKSmJiYk5GPjoyNioWAc2VdYGJrcoaBd3R9d3R0dHFpZV1eZpbAqaOp
rbKzsa6mmJefoZOOfW1eUkpPU1tgYmh3jKG3vLKwsa2wqqSdnZ2anaGfmp+joKWqr7Oys8Wzr7jD
xcTAvLy5uLGkn4N5jpGbm6Can7DCzdHV19nX2tzb19XTx7yqpZGTo6+elJibmo6DhXNwb3JpaGJk
YmpranF0dneAf318dHSDbmJhYmRrc3N0doCCfYyNlJOPj4uLhHt9eXZ8YltZX1tij2pVVVhdX11f
YGZiZWuFfW1xd4F5fIKChIuLko+JiomOjZKYnZel0KiUko+Pi5F/aGRqa2ppaWtramlmX1xcWVxc
WVxcVlhWUktNRUVHZJ7mwmpXW3TV/v7xci88T1lZX2FiX2RkZGFfYmZoYmJkYl5cXoGAWFRVV1RT
V2BkYmFcXWVqaGhudoaUm56goaGlqrC2rrG1uLGsqayqrZ6bpayuraapp6yurLOwqqikoKCamohv
gqCqqKq1tba2t76+u7q7tba5wN3FrrK2uriwrKquqqqopKeciGlXUEtKRE9gUE5QXVdVVlZUUlBK
O3eNfXd6eXd9fX2AdHBxdnJ0mH1xdHeEdnNxa2p2hHZ7gXp0dHNuZmd2eHNxbnR2ZE9MS2J9f3x6
gIqNj42DgYKFioaEgYGDf3R6bUo6OD5HW2lteoKGhoiDj5qkqqSgra2el5GOqrm2s7CwqrCsqaqt
rrWVYnakqaiopKSmp6WnqKqopamqqqyqpZSGcnB/k5OTlZSTmKCozsGhnqOpwMXDw8XDxcS/v8jF
s7CzraOx3L6ssLKxsbu8paaflZWXkpeVk5aVk5WOj42Fe3t3a15TVl5lXWRpZVlYcoptaGpwbnJy
c3N0fH17dGhVT1VZU1BVRlRmWVlXVVdeZWdwcW1ta21ianBZWVxcV11iaF5faHR0eoKKi4aRindv
b29ycG5vdnh9end7f4KGe3R4eHl3fYaFjo+Rj5OOfHd8iI+huaafn6iyrKOpqZ2UlpiWmo99c2tU
QS8mKSwyNTo7Pj48QEJARElVYl9fYWdrb2tramlqZFlZV1ZQNSAoT2dta2trc3Rxc3R0eIGBZ2p9
iYqEhIaKiIaWnJibo66vqK6wsbG2s7WztrKtqqqhlo6Ab2FkXFBKR0ZFSlZujqa2uLW2srOxqJ+f
mqCdj4mFg313cWtTNy85Vmt3fYB/goJ7dHBZSkRGRUVNXl5hYmhnaGliZ21rfJWjr7O3sri3vr++
vL6/v8q7ube4tba4uK6opqCdoKGhpKWoqKmln5+RioRvampvbXNycHeTqbG1sKyssLOysKqqpqSh
npiRhXZeYH+Lk5ifrKWloJycoKGhm5qXlY99c3mGiIWGioWGioaFg4WIhoaGiIuGgn98f3tZTFNk
enZ9iYSMi46OkpiVmJiPj46JfXx5fH13eIGMoaWUkZaVlJqRjo+Kgn+BmJSLiIZ/gIF9gHR0fYOD
jpSIjIyKipGTkZOKgndumKqyrKiws7Gzxc7M17+zt77BxbGhnqGkpaaoo56hn5yWkZWXk5WGd3Z2
fX2BfX2AgH2AfXZzcnZ9fYKDgH13dnR0d3t8eG95en19dG5pZFxdVU5LUk5ZZWp2eYCFjX97eX2G
jI2JgoGGiIiGkZORj5SWo4yCgYaLkpOPhIKEg4WGi4qGiouDhIiEfXRrYEdHUF5kYmhtam1udnZu
ZWtiZXmDgYKIiIyPhH+BhpOGe3t9g399eXBraHJ0bW5vbnR6dnt9g4GFiIaKkpiVlZ6tu7u5usC8
vLi6tbOtra2qp6asnpGYlpyhp66jqa6urKOkn5iUkpWSmFtZa25xc29ra2hhXlBHQ1h4iY6UkZWb
m5ydnZqYj4F6sbCxs7W1t7rI3tLNxMnOyMHFxMe8spiAen2Bd2BTTUlLVGJ9bWJqaGVkYmBTTU5M
TEdQTUdGQ0NERV1JPj1HQUdNWFdXV1tYXWZtZWBWV1ZZZW+CgIiNmKi8wLu1tbWspqahoaGhn5aS
kY2NkZWTm5ySj4+Tjo6Pj52boY6JlqGvxL6elo+GgomBd2tueIONkZedm5iXmJeTjYqVvsO2vL7B
wcDBurq8uruxrKqknJh/Z2ViYmZvhaG8yM7QztPOw8W8rqSkl5GMjI+LhpumfX+LmJ+hpaGcl5OP
lpqhn52fpKekpKGbko2MiYaIiZJ/Yl9ZWVVVU0tDMjNBR0xSUlNTXWVyXltvamdrcHN3cWlpa3Jz
dHZ8e3p7d3F0c3SNimBMR0M9QEJNYnmGlJihpqmsqaeloaCblZZ6XWJ9kZiota22vLGqpJyVjYaF
gIuWenmYw5eGk5udo6GkoJ+npJ2eoKOkoZ+Yj313eH19dnR3fZGMuN6gkqGwtby+s6yem5yWfWdT
QT44O0BFS1ZheYqOkYyUko6xn4CPk5iUj4mLjIuMi4+PjpGUlpOOhn1pWVNma2Vna3SAgoOEj4+N
jY6KiYZ9dGRWSUVBQDo0OUl2W0lOUE9OSkpHRjImJSMlJiYnKi4uLC4sMjtQaXd/hIaMj5OSm5+f
sK6ur7GtpqCUiIV/gYWBe3t9fXyPj317gIaLgYKAgYB6dHd0eH1tb298jI+alpuXlY+Pj4+Sj5Oc
qamqsqqtr6yut7ewr62flpGFg31xbWhic6yviYJ6en19d3yBgH17eX2CfHR0g3FWRD5Qd4uDf3t6
fH15enh5d21vb2ZofI6LjYqKhoaJhoKDd2tZWVVQVl9tj4FyeHRzdnF0b2dbV15ml6qgpayus7Gu
saqgn6GempWMgnRzUD5HVV1gZnmOqLK4sq+srKyopaWmoaGcnZudoZ6do66sr62tvLK2tcHIw8HB
vLOwqJiJdIuUk5aYmJyfu8vM0dXZ39rZ1tXa1svFvrOgk5aYn56YlpOGfXpza2lta29zb2plZGhp
bWl0enh4cnh4bWlZXF5mZ2Zqb3F5gYB9k4+UlpulkoSEfHdtXVlfXVxcZmFdWVtbWVxiZmBXXV9i
aHRoampwcnd6eX19goOJjI+PjYqPlZuen6GhnJ+jnJKOgmhiZmZlaW5raWlpamhiXF5hW2FbWV5Z
VV9nTDw1OThLZGtqZ2lod+D+/sVOPEtWUlddWV9kZmVkYl9fYmJlYl5eWFVZg25QUFBceldQQUpX
V1leYGZkaWdogpeYm5ygpK6wsLa4tbCsrbGwqKGoo6Oura2qr7GsqqmssKqjnqChnpOOfIGjr7Wz
s7m7s7i7v7y3uLq6tr64wLivsbG3tq+vwbiqpaGhnJWLblROSjQlapJSREZLUE5STFBQSz49d4SC
gIB9f4CEgYaGd3J0dHFzdHZ6dG5vbm1pc3uCnI+AgHx5dnRna5F9am+O1YVDQUNbbn18fYiSj46U
joyFg4WDhIODgoJ7eHFhQz07Oz1FW2Z0go+NgnuYoKGksrmzraixt66prK6wsK+usq+qsaqsrpqY
oKzLxa6hp6aqqqmnp6enqaepqKaon3dndoqVjo2PmJidoKmxs7OoqaatsbzHxLu7vsXHxbiuqqag
paqsqaWqtbyxpaehpKqhnKOaj5SVlZiTkZKTk4uGeHh2dGhiW2tiXltbWVVeamRiaGtvdHR3cXR6
dI2AXVBQVmd0W0tLTlNUV1hXXGJoaGltcm1va2ZralhYU1lbXmBeYGZla3N7gIGEhol8cm9tcXFx
dG1uc3JvZmtveXR2dHR3eXl6f4ONjZWPjIh7d3+eoaSgmqGnr7nEt7CuqKmmnpiYko+Aa2RNQ0pH
OjQ3OT5CPT4+PkJCTlloZ2BmZWRrcm5tbWtqYF5ZWFlALyhDZGpra25pamtvcHl3dHKbiXmEjIyJ
iYiLj6Slj4mPoaamrK21t7CysbCtsKyjp6mXi3lyXFdUSUVEQ0RLWW2NoK+zucPHtbGwrKOeprCU
hoB9fHluYU41MD1Zcnp4fYOCgH19dl9KSUVDR1BraF9maGhqamlocXB3kaOpr7a7t7i+wb67yMi3
usC/ubm6t7q3r62upqOprq+qraqtqqqqoZiXj4V4dnp5fXx0hZqzurOyraypr7G1rqmqppyYm4+D
cllThKaPm6GeoaShoKGgn6GamKCYj317j5aMhISFg4iPjIqIhoqKj4qPioaCgX2AcFlgZXmNmLCh
ioyNlZKcrKeYkY6Ki4uJiYKBfYKPm6CfoayhoKWYj5iYpqqdl5GOjIiFgn15end7enhtamt0cHqP
j4+Sj5OVk5GFf3GGo6y7s6qztre5v7zCxL++vLzBw7ysoJylqqSempybmpeSjYyOkop3cnR4f4CB
g4GIfXyAgH1zdH1/j4yDfHt7eHR2d3x0cXR0dHt0bWqSeFVHSktOTFdbYm54fYWdg3N2fYmGg4iS
jImFf4aMjYqNjomLhoSGiIqOhoaKhYaFhISGgoKEiISEiH19cmFPNCwvOlJda2trbWtlXl9hX2CB
mIGDhYaKioV/fHaBlIaDhIKEgIB/em9vdnFobWtudHR5e4GIg4aNjouOkZWTlKO1w7y/xbCus7ez
sKmlpqGfmI+Oj5KhoKSnsLGyqaivrKGcnpaOlZV2Ymdwb3J0eHNra2phUENXcoubnJKPnJ2dmpub
mJ2cl4qerMq3pqiwu77JzsfHxb+8wb++s6+8oIaFg397cFhMU1lhaIZxZnBmZlteWVBQUE9PS0c+
PkJBPDs+TWJFQFRHRU9ZVVZTWV5gamtlYV5ZVl1faXF9jJigprvBubm3urOvrqitoJaYqKiVko+P
lZKXj5eSjZOWlJKTkY6Toa2ttreytq+klH94f4GMeHB/ipSgn56alpSUlJWUoY+hsq+4u7a4vL/E
xb+2t7etoJuWjXZoaWdkYmeDpbO+wMXHxcDAvK+clZuYk42SiomEfXaAjJOanZ+do52XlpubmqGo
pJuhpJ6jmpaRkpaRjYyMinlzcGlhW1tWUExDMC8+SUtMUFVbaWtZXXRwbXR0cHBrZmhvdnZydHR6
eoZ5dnZxdI2AXEdCPkNFR01bdIaUnqGoqqqoraqopp+XkXJfZ4afqq+ys7nDraahoJuPioqGhpeP
hY+dl5ibnZ6hpaGem5yhnp6lpZ2mppiSf3l3enx7e3Z3fYaYoJibqrO5uLezrqGgoZeAaVg9NDg3
PklNXWuAjo6Pj5GSjZOPjJ+koJuRi4qPiIuIiYuOj5SWlY+AaV5bVmd0dHJ0dHuBgoWJi4yRj42N
hX1vX01BOjAuNTlAUGZQSkxTV1ZZUk9QQSojJSYnKywvKSksKjE3T2Bvc3uFi42RlJSco6awsrGu
r7CxqKGblpWWlZSPhnx4e4uIgoN/hIqGgn19eXd6dG5oYlxcW2FuhpaSkZKSj5GTkY+Rk5umqKqz
s6+usbC2vLeupp6YjYl9dG5pW09SeIZ8nIt5c3dzd3R4eoKDhoZ/gXx/jWlZWGGAiYmDgH98g3+A
eXt0bnBrYF90joF9gIGBf4SFfGlcWVVOUFBWXGZ5eHR3dG9ubWtmZVlVVmKLoaGmrK6zt7asqKCj
oaGmoJSEe3dmSUtZX2Fnf5ytsrWwr6yopqiqpaGgoZuYm5eVl6Ghpq2wqqenqrPFxMHFxb61s6+n
mIN2f4aMkpWXn5yzyM7U1drX1Nfc5tnOzs3AsZqPjpWalZWUk5GBeHJycGtrcXJyf3FkZGVlZmtv
bm5rbmphXVtYXmJkZ2ltbnJ7fX2VmJePj4+GhoR/dmZZV1dZV1dZWVRYX15cWFldXFtbXl9ZW2Rm
Z3Bxc3t5eX2CiI6KhouMjJGWnJ2YnaGhoKGdmJWMfGlkaGdpcm5mZGdpa2ldXFxfXlRSUFZXTURB
PTwzHzpZZ2tqZWduo7uvZkdNVVhXV1xgYWZpZWViX2BdXFlhXlZQUl1WUFBUPDQ1ODM1O1BYW1xd
XV5iZ3SDp5eLlKqvsLC4u7i2urWys7Oqpaanp7Gvrq+qqqyzsqqpqaempqGfpIyAucCutrm+uru6
ur68ubO3vLzCwsDBu7izsLOzqrOxqaWnnJqYk4tuUEk4LCkrPEFGS1BSTU5OWGJZPl+AgICCgoaG
io+Pk42EgmJqcXRxb3R3c3Rzb3B4g4WJjISCgYOAemhoaWdpbZGOUkdKWW19hoGDiIyPmJOPioiK
lo+Dl4l8f3x7dGlKO0BAQ05hbYCXzeR8UIKerLW3ubizsbCyt7axra6pqq2yr6yusLGvqJ+hpqix
qaqqqqyqqKywqqmtr66tqammfWd/lpKPl5ucn6Ghra6qqLCus8W8tbW6w8O2tbGzqq+6p6WhoaOn
pKmqt7KoqayqqKmhmJaYm5ipnJKPmJOPn5Z8c316d3JmYlxfXGBhXmJpaGZpa3BxcneLpZ1zbW5k
VlJXV1lSUlZUVFZfXmRkZWtoanNxbnBzd2JWU2FhWFVXW1xcYWVqeH14gYR9fH1wcm5ra21ubmtr
Z2BbYGBka3Z3dHNzcXZ3e3+NjYOFi396fZadnJ2Ulqi2u7e3vsK/vKibmpiWkYx7b1dNZXNOLzA5
VohuQTk1PEFMVV1iaGhoaWpuaWtva2llYV1XTEM9MEBTZGViampna3Ftb3R9aYJ9doSFgYaEhoyG
g5K1hm+Tpqyssq2ztra4s6ynoaGqn5KDeGFMRUVBPkBDRVBXa4uaqLKztbe2s7OvraaXqbCGfHl3
gY9nSy8xPlxygYF/hH+EfYF6a1BEQURPW2dmZ2hra2ppZ2dqbnSPpKqvrrW5trq+tbK8vLy6wMK2
s7q4s7GuqKScqKmsra+wsKqqsbmsoZiTj4J9fYGDgH2Emq+2s7Ovr7K1qqanqqSloZqPjIN0WUxZ
e42jvKqfm5ifoZ+Yn6GclY+IgIuOioqNiIaKiYuPk5GNjImIioaGhX97e4CBgYqPnaWVk4+Pl56o
nJyfoJybk5OTkY6OjpOanqGjpaqqsa3S47GVmKWkoKOflI+OkouEg399fH15eHZoj4ZWZo+IipGO
k5SSkY+GfHGUqKmvrLOys7rIyMTAv8DWyby7urWpn6GnqZ+cl5qcnZWVko+Ng3h0fHt6hIGAgoF8
gISIgG90eH2Gg399fYB5d3R6fXZ9enBzb29va2lcTkZGRkVEVGBpaXN3e3x7eXp9iI6JhouYk4yG
f4CCgYWMiYaKi4qMko6EiouGhYWGgYF9g3+AiIyDhHRnWUUuJygqMDtOWFtcYmJbX15fcISDg4KP
j4WEj3l4eX+EeXh9gYCEg4J9enZ3em5ram92d3h6fX2AhIWFjY+SlJaSmKm8vra1t7OwsKqmoZ+d
j46Pj4yNlZaco6ivr6+ysbGqp5+UkomIhmdna29ra3N0cG1raWFYUHCGlpiRl52dnp+eoaChn6Oq
s7KqvrOqramytsXTwLy8vLq+vLezrKmThoaDe3x0a2BZX2dmZ21ramdeXFxbUk5MT01KOjA1ODg8
REJLTkVERkdJUllYXWBgXmVucW98a19efXRycH2MnKmts7m5uMK7trOwrbOopKGlr5+fo5uUpJiR
jo+RkZGPjouOlqawuLi3trOztqyclI2EfHd5e4+so5aWnpuYlJWRj4uIhpGur62vsra7ubu6u7uv
sqqlmI6FbWVnYl9fZXOImq+7xbm4t7Gonp2Yj5KPi4uLgnNrdIOGjpicnZydnZiWlZSIi6Gcn5uc
mJaXkpKNj4+KjY6NiYV5dG9iWV9cU05HMTA+R0pNT1ZWWVthaG10fHxzbW1ra22JhW1udHRxe3R2
eXp4gHtfT0M+QD5wYlJrkZibpK+vqqeqsKagnJh3YGB7k6WxsK2wrq62sKWgnJKRlJKPjIyMioqS
m6GgoJ6gnpiXl5ugo6Gho6mgkot/eXp7eXh9eHuBjJOXnp+vuLKvs7OtrKiYlIZtaGc+MjhET1lt
gomLiI+Pj5OUk5KPnqGopaOelpWOi4qMj4+UlIuGgnJbVl9lbXZycnp7gYF9g4qLjo2Ki4qEe21Y
QDUqJygxQVBHS1JVU1hYWFhgXlxQOywpKS8vLzo0MC8wMDpZg3h4fYaGjpGWl5icoaqqrrKzr7C3
urawrayqqqSalIB5fYqDgoWDjYaEhX95enp0a2ReVk9LRVBqfYaRjY6Oj4+Oj5WYn56hqrCyr7Oz
trazrq2mnZWJgnZtZltURTxJUFl3eWVlZWttbnmAhIWJioaJi4Z/cHFvcoGGiIiEgoSGg3x9eXlz
bm1fV2J0aW5tbnNwbWtmYllYVE1OR1BXYGdqcHR0bWpoYmVdS05VYYKcoaeqsbO3tqqmpaaeqq2e
mo+Dd25JR1dga4Kdr7Cxsa2tqqyqpKOhpKGenJ6dnqGjoaOlqbGloaqzrLq/w8XBxLe3r5yGenyF
iI6SlJWRmLvKzM3R2dfb2eft2tbOx8S1mIyGjJSWl4+JiYGAcWtrZWpram55eG55dGZfYGFgX2V2
X1NSWFleYGJoamlqcXZ6fJWRjo+Ni4mChntxX1VXV1ldV1ZVVmh3X1ZVWFhZXXp4WFJXWV9maWtr
cnJ5e3+DgIOEiI+VlZSYnZqYm5qanJidmJKIeGloa2tpa2lrbm1oZGVoYFdYT0pGQ05QUEdDQDIf
M1diYmFlX1thYlVSVFdYXF1lZmdnaGdpa2ZkYmBdU1RXVlZYTkRFRDw6ODk6PTw+QUleWVZeZ2Ri
YnN/hIaOn6+xtsHBs7a1trK3r62qqaquqqqwsa6qsK6mqqafnp+hoaGkgIzFyLa2ubu8vMK/ure7
s7a8xcS5trq/ua6urqmqrampwbaakpGSjXxeRy8oKyIsO0RERUpHSlhoa3F0e3x9g4uFhIiMkZab
lHhiQlh0aGdoa21tc3NydI6JgICGhoV9dHF0j6m4g3Fqa2RQSldyg4SCfX+DjY+PjYiJjIuFgH99
hYB5eHNwYkc8QUdWcnx7fZzExFxhjKC6urq6vrqurLO1t7ixraqqqa+qrK+ppqeqpp+hoa6tqays
qa6qrKahqrCtqq6vsaqRfYyYmJycnZ6foaiqqLCsqrG1s7e4uLq2wrzAsqqqs7Wqn56mpKGnramq
qKiqqaSeoJ6anJydnpiYlpebnpSTj5V0dHp7eXRrXlxYYF9cWWVtcH1ranNvd3+8rXNudnNqXVdS
VFNSUFVYXlZZYGBiaGpqamtvd3NzcF9QU1RWVmFZV11eYmhxcnJ2c3h4dG9wbXFub2tydG5uaWRZ
XGJqeHlyeHd0c3d7goV/go15dHR7fX+AgpWdrrK5vLy/uL7FvLGmoZyYkYJ0XExNS0RAQluUx6qJ
jEU0PVBdZmZnaWpvdHNubm9tZ2ZlX1lQSUAuQ19ZYmVpaGhtam5yaWFocHd4eXl9gYiFjYV6cXFv
e56qpqOorra4s7KwqaitoaShkYt7Ykk8OTs+Q0dJTVl2i6CqsLW3t7OvtbOqo5WKhnx/enJ4mGY8
MTVGaYB0eXyAfX19enFhUEdGSVdgYmtraGlnaWtraWl0c4Khsq+zsbi8trq5tbm5wcO2srWxs7az
rq6qmo6YrbGwsq6usbevsrCknJ6XhomNiYuGg4CVtbKxs7Ozrq+ysKmqpaGemJiThnpUQTxSfZaf
qKGanJ2Ym5ycmJWOhICCjomLio6OjImJj4ydnIF/gX2CgYN/f3t0fYWGiIyWkpeSk5OVqua5lKCp
oJuXl5iVmKeuraynpKGgqKquqaysqaqjpqanpaWckpaSjIqGhYGCf398gnRoZllYeY6TjpKYmpaP
iIh8cHGUsbKvrLa8w7++wLy8wczDusO8v7Ohm6OjoKGYmJiTj4+Ni46FeXRxd319hKGcgX2Aj4uB
dnqBiIaFhIN9e31/fXh2eoubcWdrbW1oZllNREJBPTxNZXJzcm50e32IfYaIjI6MjZKLhoiEhoaT
kZibl5eVkYyIhoaEhIaGhoKEg32Dg4GEspSAeXBiUDsrIyMsQEdQU2J4XVleZGh2gYuLg4SLg3Z5
hHp0eYR8fYKThnyAi5V9d3l5dm5vdHZ2en16d3p/goODiIySk5eXmqSssLa2rKqhoaGYko+PjY6L
i5GUlZ+hpaetqqqvraqlnI6Gf3hvb29wcHBxcnN0cWppXFNoipKVl6eqnJafoaCjoa+qp6mwrrG1
sqqlqbOxusrIwLq5ure2s7O3mpKag317d3BtZ2JkZGlrb2traF9YVlNWWFRMXl41KDM1PT1GQkNF
RU5rT0pNVFxiZm9oaG9wcpKGb2JxanOLvLemo6esxLOws7Kwr6+wp6GmoaqqpKaqoaGsoY+NjpKO
j52Uj5ios7e5uLm/v7y3t7OpoJqUmLCpm6qcko+Sj4+MiYqEiIWIjZymrKipsbOyt7y7u7OvqaWb
kXloaGliXl9iYm59lq++wLCpoaGhm5qUj5OVmIFyaWpxf4qUk5WUmJyUmJeYmoV8fIyShYaRlY+P
lpiUko6Oj5GPiX97fXhrX1ZXWVAxKTlBQkNDTVBQUFlicn+FgH19eWhiYXR9c2tra2tvi6Z8amp2
bmFSRz46OEdAR2aIk56kp6qqppyfoZiYlWtbZIylrbGspq+xsayso5yal5WUkZWakYyKiYuWnaCh
o6GVkpSXm52bmJqYmJyRe3F0dnd3dHR0c32GkpaYo62wsLOsp56ko5yXjnRmZUc7PkdQYHOJlKiS
j5GTj5yXlpiboKyxpKGeoJ+Xk46Lj5WWhn94Xk9ba2pxcXl/fX+BgoSChYaKjYuCf314aFA1JRoW
HzU+SkVLUFVUVV5fXmtqXk08LissMTM3OjUwMzQ0Pl6Sf3mAhoqSkY+XnJugrK+wsLO+wsvNw8XC
vLy7vLOhkZOUmpaPioaGiIiIgoJ9eXFrZ1lQRkE5Q1lvgYuIio2Nj4qMjo+MnqiprK6turayqqmu
qZuXi4F5cGhfVUc3LjVLTE9TVlZVWFlfcIGFhYOBhoaKgn14bXaBhouNi4aEgYGDf3p9fH1ual1N
SUxQVVhcYGFiYV5nXVNOUE5QUlldXW92bWtoaGRoZ1xQTVNiiKGmrKiprLa1sKajraq+taGYlph4
ZUdOX2t7mKatrKqvsbCtrKalo6aloaCenJqampueoaSnp5yfraqqr7O6vL+/t7G7qoJ5goaLjZKP
i4+Vs8zU0c7T1tfW1tnUzs7WyK+YhoKLjJSSjoKBfXNudHJzcXJ5enRzcXdwYlxZVlVNR1BMSk1f
YVtdZXdqZWZpdHeAjIqUs6yOgX16enhrZl5dYl1ba2VVW11YV1lYWVtdWVRZV1lcWVxmZnh2am17
dnp9gYqJjpSWlpyYlZacoJubmpqTlox8bWVoaWtqb2tmYmRkYl5ZVFRSS0ZETUtGSkI9OC5CXl9h
ZYFiWGZqVUtVdGlibmtiZWpqa26TfWJfXlxZVVJSUFBNTUZPUE1UUk9PTTw+PDs5Q0dHQz01OV96
dICcrq6zs7O7uLi8u7qxrrGsr7Kys7KtqrGzt6+sqKOkm5+ajHx6kbbFxcXDvr/CwLiwt7y+v8LF
v7i8vru+wLOorKqnpqqopqGaj4yMgW5WNzspIjE+R0NDSVBVZ3N0dHyAfX2Eio2MiYuPiIiBeHRc
TExeZmJobnFuc3d3gIaCfX+BgouGhoSGiI2LkZ6IgWJLXW57fXt5e4KIiIuTjpGVj4aFhYV7fHdv
bWBZRERFVmh0fIGIjYuBfYGSubyzurq1s7e1s7e2rrGpoaaqqKatuKqlqKWgnqGkqK2sqKqxraqt
rKqsqqyzt7m6rYl9hqqbkZienpihqKelqLGur66zsrOxs7Oyr6+vrKyqqqWhoJ6boaqmpaimpKej
oaijmpiYmpqYmJuhn5aTlI+NnYFvb3iLlXZdV1lbYGRZX2JiYmJobW1wc4B8c3N2b2tnaWpiUk9T
UFhcX2BiZGZnaWtua29rbm5yb19TUlBNVFVXVGRhX2pyeXh2d3d0cnR0bW1ycmtubnFva2JeXWRx
cXRzdHh2dn99eHd0c3d0eHl7enx2g5yxu7zDwr68xcW6ubion5+einFfVExCPjxGUFadn4CNUzFB
WFtkZWVlZmtxc3Ftc31rYmFgWFVKQjAmPE1ZZ3NuaGhrbm1kYm9xbnZ5eXp6f3x3c3Jxb26Il6Gh
pKytr7C1r6mopKCjn5uOj5hrTkRCPj5ER0pSYHiLmK26uLm3sLG5uLKsk4R9fHp5cWdeTDw1PlBo
b3R7fXx6dnFwaF1HQkFEYmVgZmtpZ2praW9oam9veaGyrq+3s7O2s7e1uLazrKyuraqqs7Kqqreb
ipGqsbOxsLGqsbWvsbKpua6Oi5KOhoKEjZyzt7W5t6qturipp6mqpJeWmJOGa0w0MEJrpaijo6Oe
npufmJyamIyGgn+DipGGhI6LioiEgX2ChYaAgn13eXx6fImGiY+RkZ2fnJifqpjO662coaeloZqa
naavr66srK2sqampra2nrLGyqaGmsq2spKGemJaNjYuGgoKBfXh7gWtoVlB0jpGWlpSam5OOio+b
p6eeoaeqsLe6wL+8vMG+vLu7vL+5uqikpKOhnp6bm5eTj46Ml490a3B3enyAmpF/fIGFgXNydn2I
i4WFhIF9fX19enp9enRwZGhiYmFbVEk+Pjk+TGhydHl4dHd0d4yFf4aPj5GXn5yPho+fnp6gqq6h
nJ2VioWKiIWDhoqIioyGlJ+DioaJioV8cWthSjQrJSg6RUlQaYZgVVhtgnuFjY6IirOvhX2LgHl5
fHx6fYaEf4F8fYKBfX1/bWlwdnd0dnp7eniAgoKGi5WSlZWTlKOprK2nnZiblI+NjpaYioWKjZKW
mqGlqqq8s6mppp2RiH9zaWJka3N0b3Bxc3Bua2ZhWWuPlY+XssWempilr6OfpKmqraqtqKmztaej
qKqur6+3vLawsbGqqq+Yj4aAd3dvZGFmYmBmaWdoa2lpYltTUlRVX0I8MiwyNTs+QEJHSUpMU1lQ
TldcYmhqeIV4enRub3Bramt2haHVvrGvrq66srG7sbGzsq2kpaemqaanpaGloKOlnI+MjYiOkYuV
n6y8wL/ExMHAwcO/s6+npKGlqqGhnJKMioaDgoWGgoCBf32EjaOmpJ2epqqtsbG2vLmnno5/cWpo
ZmViXFJLU2+Jqriuo5ianJaYmpiVkZOPe2JTVXeFi42Oj4+SkY+Ujo+LgHhxdnRkcoOFj5GRjI+O
kY6JjI+FhYmIg3hmW1lUTDkpLjU+QElNTVJZW2+IiIGBgZuLZ1xhdIZxYmlybnSPnHptcXNmXFJL
Rzo3MzVCZYWTmp6mpqOjo5ycl5SNZ11yk6iysa+zsbKzta+lpaWdmJORlpePkY+UkpKVl5ialZKR
l5+dnZiVlpablYF5dHh7e3h3d3h9hYyVl5qlpKWoqsCxoJqYlZKPfFtQRkVGTll3mJ6bn5iVmJyV
j4+Rm6OqrrKqr6ysqKOfm5qXmJGMemhKSVdraW1ydHR4gYKEiISCfYGPg4J7eXRmQCcaERMiNUFQ
S0dTV1VcYGJhYmhqWDswNTU+Pj5BQTgyMjQ+V3R3eYCGjZGTmJicmJ2qsrCqqbK/2dPFztPOysfB
uLKqqqago56VkY+SqoyAhoR4cmtoZVlNUEY+S2d7gIWDgI6ThIaGiJGsqaWjpK6wrbGqqqynm5iM
gXdwZVVHOzQsLDxFTldVUE5QUltziYmIhYWPj4yFfX17e52Mj4+Lj4yIhoWCgH2AfHNgUEFCSVBV
X2BhYWlnX2BWVVVWUlBNVVdcYmluaWdkZmJeUEVGUGujoaGnqKqtsbCqqqyopammpJ+gnoVrV2J5
j6CmqKqtr7GyrK2spqCqpaGkoJqdoZ2doKGloKihmpyhqq6vs7OxtbO3urOghYWGko+Kj5GJiZOq
w8jIx9HV0dPOy83HyMq1npaJhIKKio6Ff4NvZ2p2dHN4dHp0cnmDc2ZZWVBCPTUsMDlCSlhXVltb
YGBlb3Z7fYR7i7XNmHZ0fX2AgIB5a19XVVZVV1RVVVhZXVlZV1lVVFNWWFRZVV9gZ2VqbmtydHp/
hoqIjJSbpZWWm52emJeblZeYkoh5ZGJpZWRkZWRlZmVrX1lUTURBPkNOUExGREM7Myw+VGBkYFlc
VUo7a2upj1xWYmlra2traGRmYWJhWFZUVFBNSUlTVGtfUlBTVFNUUEk9NTU1OTU3NTQ1N0KehpOq
r7Wytru2uLi6uba4trOvrLGxsbOusLi1s6+qqqqkpZeFdn2OzM6/wMDCwMTEu7u8vLy/vL/AwLm2
v7+6vLOppKSno6Gcn56bj4p7ZGVidlU+QENCREVGVWlzdHh6eXt8fYOFioqJjoyNhnx9dGtXMz5Y
YGRncHx5dnN6g4aGhIaFgX99fIaRj4yEhY+pf1tfdHqAfXp9hIaLjpKRlJGPiYaGhH2OdmplXVJK
Tlxka3R5gYiMhYWghIupvL66uLi3ta+1s7C2vKymo6OlqqGqpaGbnJihoaiqp6ioo6eur6mqraqy
uLe3u7iznXh7ipefpaGmqKqnqKqwsLCws6+qqa2qrLCzqqeppa2zj5ebmJ6lo5+hqKqns6qgnKWc
k5iYmpydnpufoZiVko+JeXd9fHx9fGtbWFxZW19fXmJnbm9rc3t0cnFwcXR0cXR0amtkVVBSVVxr
YF5iZmhoaG1vcG1ub3BpVU9VUE9SUFNTV11iYmdtcHR0b3R4dHR0dHFucG9tdGtgXmJpk7h8Z2ht
c3R3jIt0cnFvcn2Ae4KGho2TobK1t77E09q+vsDI0rGdnaeggWtSTUdHTU5UUGZpRDo1NUZVXGJh
YmRrbnBwbXF2k31xZFlWTEpDNCUwRFNdXWBnaGVlZWJqdHBwcnh0eIF8eXt3dnFrZ3CSoaakpayt
sK+nqKWhnJKSl5WUuoVYXFRHQ0JFUlhlgI+er7q2s7mztbGvr6idgXRyboBvYllUUEdMX22Af3t3
eXd2dG5lVktFREJQWWFlZ2l7cGZib2pnZG53jKeusbKws7OtqaqnpKOqp56hoaGhoJeUk5+Tj5+q
saqqrK6xs7OzsLOpj46Pk4+FfHmCk6yxsq2tr7Otr6qppaWam52qknxhPiYaMFN7lZyjoJ2dnJic
nJOPhn98fYaFiY+MhYiJiouCgIB/fHh3eHd0dnuCiYyPkpicoKOhmJWYmqGjo6Ssp6Oko6Ghpqqq
rqehqa6pqq2tr6qpqqilp6itqqqmoaGhmJSPjIyIiISDfX19d1lLUIaVjo+SlZyTjY6PrPD614Vq
rrW4vLu/v767ub/Av76+vrzIt6efn6Cgn5iYlZaPjY2Xl3hnanFxcXJ3fH97e31/cm90fJSqj4OC
f319eHx8e3x5dm50b2VeWVVMNSwvPFtve4WAfXt4eXqSf3mGkpecp666wK+orqyjpqmosaegoZ+R
hIWGiYqIioaChYSAf4KEhYWJi4N8cmdZSTQnIytDS1JQVFdZX2Bwgo2Nj4yJj4J5fYOAgnl0eH2A
fYOVgIKAg5qBfX96a26Aa21vdHd5enx9goSNl5eXl5aYmJKRkp2YioOGipOPjI6FiIqNjpScn6Gq
sbK5s6Gek4OAdGJcYGVrcHZ2eX2Fc2tuaGVqbZGYl5iYnZygoaSnpLK2p6WlpqitrK6vo6Cjo6at
qKmqsa2wrqGVlpGGfHd2cWpkYmdkXmVoaGtram5lV1NUVlx3OSYoMjw+Pj5DRUpLS09MT1BVYGVp
a3B3hHuAfXN2dndxd3uRqbOzr7e2sqyqraqlrry4r6emqqqqrKmmpaGhpKOfm5KIi5WYm6CpvMfI
y8XAv8G/u7m3tbCvpKGmn5qUlI2EfYJ9fXx7eHR5eXt9hqOunZSXo6OpsbO4qqGRfW5taGpnZmhh
TT46VYWqtqabm56dmpidm5iUkYZpUERLcpWViISIiYiLjIWJhoN5dFxNTk1Ze42GhYSKjoiKiHpx
fISGhoJ9d2peV1RQQS4yLDFDRkdLUFZhc4CGhIN6hoJoXVlbYHBoYmRqa29wdnR0cGRZUktFQjwy
LEtrhY2XnqGhn52eoZiwhmRdZ32crbGxrrG2s66uraifm5uWmp6gnJilkYyMpKqbl5+SjJGTkpKP
j4mMiY97c3BxdHR0eHZ9g4aUlI+Vl6CgoKGhqqCfoJiSkY9/YllUVVNlcJWqnp2fnqCYlo+Okpil
paSzsru5s7ezraqko6ShnI5wTz5EV2VpcHB0d319fXeGint8enp8e3x3bkwoFAwMESM1PkNHUFVT
WGFiYGJeX11dUkVER0xKSkxQTDw3NUJZcH+ChouNkZGUmpuglZeqrKOps7PA0NLW2dzb1M28u7a3
s7OuqqqhmJ6qnI+FfHhxc2JdWVBQSUlPYm94fIGIjI+ChomJqdmyoaCssK2tqqisraSalIZ9cWlf
U0A1MzEvOEVKTlBMSkpPWWeGjY2MiImPj4Z8e3l/kY6Ij46LiomGhoaChX94cV5FODpGTldhXWBg
ZWFgXVdZXFhVVVBUVFdhZGtrZGJdWVNNRUZPZaCdnKCnqq6vs6+vrqqtqqqqoZiSlIqDi6Gnpaiq
qrCysLGwqaeoqKSko56YmqGdmJijo6iqpJGKlqOorKywsbGzsLC2nYGAipSVkZGUjoSFhqDDysjL
zs3Lzs3FxMC/v7afnIZ8hYWDjYxlXFtlbXZ5cnR0dHl3eH13aWBgRTFCNy4sMjpETFBTXGJhZWty
fIaNkn19fHuAfYONg4aAf315b2VdV1dTVVlXVFRYWVlWVmBfUEpNT1BZXmJhYGRkanR0eIWLiIaN
l56VkZedppqYmJeYmJKLhH9ob3ZqYmBoZmBhYolxVlNNQz5CRktOS0lDPj1BODJHWWFWUFBHNC87
UJWWXFdcZGptaGtmZGdlZWJeWVhVU0xKT09TVVVTUFZUU1RQTklGOzU1OTo0MzQzOk5ZjqWts7G1
tbm5trm/v763sbK1ta6xsrW2sq6wr7GtraypmoiBhY21zcrFysnFw7+3ur6+vLm6wr67t7i1ury7
ubenoammpJ6XlY2LhnRpam9kVE9FRUNBPkxmb3J5fHx/e3l/hIOGjo2Rko6EgYF0b4yhZHB0ZWZr
b3aAcXB4f5GNgIJ7d32GjY+RjomPi4R9b1lqfXx3dnmFi42LjZKTmpaOiI2LfXJtZ1xhSkxTYmtz
eoSDg4V9fXl5jLXAu8DBu7axsba6ubyzqKmqqKqqqamnoZ+hpqOtqqmqqqyqqq+qqKy1s7i8t7e8
uLe7mIiOlpueoaGkp6msrK2wtbOwsbGpqaqusKqno6yqjYKBhpecnJieoJ+kpKWqqKWjoJiTkpSb
npybnJidn5aShoVzcnd0d4J8cmBXWFlbXVtfYGZnZGpoa2ttb25weXd2f310dG5eU1VWXV5cXGBi
aWtua25wcHBxa1VOT1NQTktNU1dcXmFdXl9eZXFxeHp5dHN0d3N0dHJ7cF9fX2qg0IVkanBvc3Z9
dnBqa3N3gpGPj5KTmqOmqrO7v8Lg3r64vL68s6euxMybeF5WWFRYVVdPQ0FCQUlLWVxZX2lncHJy
d3dta25ycW5lWVJQTEE7Iyc+SVZcXV9dXF1dW2htcHFyc3h0cnZ0dHx5b2tiZ4agpaGoqqamqKim
oJ2blpySiYaFdmtta19OSUZSVmiGkaOst7y2sbOzrqihoY12bm5ra2JfXl5YXVtibX19fXh4enRz
b2JORT4+QlBka2tqa3Bubmtyb2lra3uKl52kqKWlo6SnqqWmo6Wdm5eXmJWWkZOJhISGlKGqqKin
pKyzr7OqoZeRlJKTm4+BhIiLnKeurKmurKilpKmmoZ6alI+GeVY0GRowTGKGnJyen5uYmJaYlol9
dnuCg4uIiYaEiIaDfX16fHpvc3FpaG10gY2WnJydmqCeoaOhn56bnJ+mqK2tpKWcoaiprKqqqqyq
saysrK6trKqmqaymqKqvtq6poKGbmpaVkY6JiYmDf315W01MZYqTlZeYl5SPjI+Yw+7WgWFvlq+z
u8PAurm/v7y8u8HDwcK2n56jnJuYlpGPkoqKi5eFZmJka29wdnl6fYB6eXlqcHeDi4uGhYSDgn18
fXmBf4SLhqeRhGBQRzksMUFYbX+Il5WOhHx8e4B7iZSfo6qyub+7uri1t7OvrLOzqqSjo5uPioaE
hIaIhIaJg4CDg4iOiIuKhYJ6cmhZQSwlKEJSV1RQVVlZX3CDi4mNi4iKfHp9hIF9fHd9fXp2en16
en18e4F9fHNlanBubWliYmJhYmdygI6cmJynlouKiIaGg4KCgX2IjY+MiYuJjI2PkZabnqGqrKeq
qJuCf3ZpW1tkYWtye3p7e3p6enZzbltzmpePl5WXnZiYn5ycpaeqpaWlqKeorq6PlJihoZ6joZiY
m5ydlpePiX16dHBraWBdYWBhZWVpa2tnbm5ZTU5SVEczLCw+UEI+Q0NKS01SU1VSV1tnbXR3enqP
gXh4fX19goahoam3urW8trG7v6mnpJWnwbiuqq6urKinqKinpqShoKGnnpaVmpugpK/Dy8vJzsW7
vsDCuba4uLOqoJ2alpWLhn14eXl3dnR0eHd7en19kZ+amJyan6CnqqqThYh8d213dHBqbW5YPTdH
b5Kal5acnKGamp6XlpeSoH1NQUuDmpF/e4CDhIKGhoF9endzW0dBR2F5hoaPj4aRjIiEa2BvmI6F
goKAdGRZWVdMXnpKMi4yOUZQXWJ4hoSDhYF7emZXVVhib2ZlZ21tbW96dG1xZ2FYT0dDQj5ATmp5
ipKXmp+dl5iWlqd7W1Rki6WqsbOxqq6qsK2ooaGenJeWlpiYlpSTmJShqJaRkpeTlJWMi4N/d3Fw
cXByd3NvdHR6eoKLkpiUk5ifm5ygoJqWlJeUkY2Ohn9vYVhbYXqGmJqYoaOlpaSYk4uNmKanqrnA
uLa5uLOuqqyqp6WchWZNPEJSYG1tb3Ryb3Z0fH19fXx2eHx9dG9iNx4QDAsOITQ9QkxSV1ZZYG1i
YFxgal9ZUk5SU1VYWVtWRzc5QFtue4aFio+TlZKVj4+Lj5GTm6SssrvI1efg19nX1svEwL/BvLi2
tbCjrK+ll4+CcWJcWVhWUFBPWFlcbnd2dnp9fXd7e3qOoJO1p5ydpKWloKGhoZyOgXpxZlhJPDo5
NTxFSUZHR0ZHS0xTXnaJkY+VkY6MgYuGeXCFjoqNlJSRiYmKhoGDeXNrXjsvQEdPWWBhYmRiYmRi
X1xcXV5ZWFZlW15iYWBlZFlSTk5GRE5Zf56npqmqrK6yrq+xrK2ssaWck46enpipubaqrbO1srOv
raysqqqmpaCgoaOeoKGdnZ+lpaefeHJ9o7C1srazqrO2qqiXjY2KjpORlJOPiIF5i7PIzMXFxcfC
wLq3vL63rZaPgIu2oH97elhPV2JweYF7dHR4enx4e31yYFIzLDAuMTIzOlBNUFNZWWFrcHyEjZu3
nZGAgYaCho6LgoWEgoSBcWdeWVNSUFlZW1hcW1JSeW5TSk9PTE5QUFhdXl9iaXR9e4qLhouMkZWW
lpiVlqOhnpiVjoyFfWheXmJiYmFeYmRgcGhUTU1FQz5FSVNQTEdCQTwuJTA+QkFBOiwzMDJAX25g
YmVtbWpubmRoZGJkX1lXWFNQTUxQU1NWWFtYUFJPTkxMWVw5MTQ1MjQ8PlJUVFl8oa+xs7mzs7O2
s7PEv7O2ta6ys663t7O3sbKwqLCwqqmYhYKBj7fIyMHHzcXBvLe5vLq6vLy/vrO2u7qztrnFuLKl
mJialpSUj4F2b29wf4ZbUFNVUEROdnBwc3d5goWFg4mGhoiJiY2Ojo+JfHh2eGtgYWJmZ2lwc3R0
dHR5eX2AgoCDiYqOjZucioSKoYN6c3Z7d3F0e4CDiYaLkpKPjpeYj4mDcm1iXUc5Tmh5c3l7gISG
hoiGf32NwMG3trW2trO8urOztq+tpKCmqb6ynpydm5qgpKSnpqSkqqysqa6zs7O1uL+/uby8xbuT
hY+eya2YnqWkoaSqqrG3tq6wr6WjoZ6gqKyhpph9e310eY+Wkpadn5+npaWupZuYlZaam5eWmKCc
lpualZKMhXd0dHR5c3FrW1hXWVxbYpiGYV9hboBta2pra3JxcHd5dnZvc2peVldXWVlfX2VlaG5t
b25ycGVUTU1NVVNQUEtZV01SW1hUXltYb3h2d3p3cG92eHBxd3JlXl9kaXOSjW5xsJtya3BvbnB6
goaSk5WTkpehp6mss77Dwb6/wMPCvL6/sa7EzpJuZmRfZGJiZF9WTFBUW3N2bmhmaXR8fYOIhoN4
b2trZ11YUklZTEYvJThLT1RXWFZVU1BbbW9tb3FzcnRydHZ3g6Z3ZYNzeZiho6ipp6+oo66glJOS
kpKIf3x4d3Jua11UR0lQW4OYobC2sra2tq+lo6CginFoZmRiYmJiZGVnZ2Vwc3p6eHh4cmplWEc+
PT5BTGWGcWVmdJV2Zmlqa2tqeYabpp6hoaSgoaampKOjnp2dlpKOkouIi42IfYCMpa2qqqqqr7Ks
rayflJGXnZiNipXDk32Pqq6pqKqpqaajpKeloZuXkYJuRyMOHDVPZn2XnJqVlZiYlp6bgHRxf4SF
hYaJiIaGhoB5ent5dnN5mHNmi4Z6lqGhm5+anZ6enqGhn6GeoaChpqiqqKSopqqqqrGzsLCqrKmw
rKiuqqyuqaqura+ysK6qpKGgmJqal46KhouIfY+bWU5dho2VmJWVmJifpKadmrCpbWF/prCusbWz
t7q8vLy8xcXFwqegoaGjoZycmJiVkouFgWRVXmVna29xeISAeHt2a3B3fISFhoWBgoCCfX16f4OK
joaAf3x0cF1LNzhOYGt/iouLjJKWjImKfYa6vKitt7aytrm5urO2tbm4saiqqKGlnI+Ni4WIhomI
hoODf3qBo56GhIqGgYaCeW9gSzIuPE52cFdTWGpwdIOJio6PhZR9eIGIf3x9gXh2eHp0dn93dHh0
d3d3b3prX1xgXFtdX15YXGqMkpualZiUjoiAfX1/fHZ4gImIj5GNiomKi4uLk5ugpKispZ+bi3Zg
VlJPaXlpa3N4e3p3e313dniCmo+klouLkpuWlpqWnqGhoaWpqqWhnZiYin2Mk5iTm5udpZeVm5eU
lI+GdnFra2tkXllZYV1iZ2hmamhxemBQUE9OT0xFPkJHREBGR05QVFxZWV1iZXB0dnN6f4SAgIN9
fYOBjqrFuLGwuL+5tbOxrqqjlKq8u7axrq6usa6qrKGnqqGhoaCcm5uhn6eqw8fN0MfBy9TFwMK+
vLe6u7OnoZ+dj4uFenFxcHRycHF2dHR0en15fXuRnpuenZuGi4Z9fXx5e3h0dG9xcWZSTWF0io+P
lZyYlZyem5aXmI+Pa09DQGB3eHh6gYOBgYOBgXx4cGpWS01ccICLiIKCiaOLd3FtZnGEgYaEiXx3
Z2BZWFVbe2hPSUlMTVhca4aSkZKGin+Ie15NVV1fYWh0a2tvcW9tcG1ramRVV05GRUdJV2+Jj5OX
l5eWqpGIhYZ4anKVqa2wrq6ws7Cps6empqGcmJucnpWTk5WTlJSUlpSRm6a8oYiDf3BkZGJnaGlr
bm54enyIjY+Uk4+UraiVjpafnZiUj4+SjoaBe4q4bVVdb4iaoKehoaiqp6WXk5Sbo7m2s7vCv768
uLq7tbOspKGPcFA9QEtoa2lqa3Jyc3Z3eXp8dnN0d21iXkcuGhAODhYsOD1FYmpZW15hYmBiXl9h
YWFZW1ldYWBkZ2dZSkNPZnJ9hoSIipGMjI2LiY+LfGtwj6Otusjg5t7a4ODazcfHyMXFwrmzu7Gq
qqmhnoV6aVlZW1lVV1hZWFxpc3d7en18fHl2c3SFiJqcnZ2gp6egnqGck4aBdGliVUE9PkJKRk5Q
SklNRkE8PkxZcIiPj4aKi4V9i4V0cneFj4+Oi4+Mjo+KhoR8cWVQMy49REtUXWFkaGhnZWdmYWhh
W1VWW31dUFJXW2dZT05NTEdHUFx5n6morK2ysLOzrqywsrGwoY+Kjaeqmq28t7G1s7CqsbKzsqyw
rqipo6Sgnpyfo6SeoaWkpZZxbn2ksLG2ubiysamko5aKjY6PkZKPkY2Jjnt0krPFwrW1trWzs7W2
uaWfmop/gJaGgX9/aWBlZHJ7enx8enmAfXZ2jIBiRzArLiwyNDI1R0dMUlhiam59ho6cr9CPlI+G
homEhpi1k4uNiICBfW9cVVdWWV1fV1tpZFZSUEtNTVBPTlhVVVleYnByb2tye3qEhoiGjI+Uj5ea
m5+fs7qPiYibiV1ZYnhoYF1cW1xXU05HR0VHPkNnUEpJQ0FBPiwiHSAmNEk3MDE1NUlwYV5dXmBq
bmptaWlqZ2RgYV5ZWVdQS1BSU1lZWVdXVVJOUFBfTTo1NTU1NTxOW2R2f4SeqbO+sKqvs66yusjE
wLi3t7i1s7m2uLmzr7Kys7OysKiKhYaSxMe/x8rHv8PCvLm6u7/Avrq8v7++wLyzr7C3zLCYlZiV
pLuYdHJ8eHR0cntiVlBPTl5ma3d4fYKAf4R/fYF9f4B9g4WSi4GCgnp7fWBZXGJkbW5wcGtvcm96
gn99gYiPj4+Rj5ORio2Ng3d5gnp4cXR/gIaFhouOjIyUlZiXl5J0YltWOS5EVGR0fYB7fX+Dg4OG
lpezwL+7ubO5vLu6t7KvsKq8pZylrqyfnKSenp+luqympq6sqKmur62vtcjBzsS4y8PdwJ+Gjpun
oZyeoKm+qKi2sLKztrOpoZqVjo6Pko6MnYaDe2tneZKataOdxa+joKOgl5GSlJKXmp+amJadoZqP
lpJ9cm5zdHR0c2toWFRXWF1dXF5bYWpua2lrbW9rb3F0cnN0eHp5d2ZWVFldYF9mcGloamppcXRk
U0pHTUtNUE1MS11tWFBSVlRXU119kYJ/fXt6eHpzcXF0aF1fYGdtdGtrcHu8pmdiZ25zeIWzppST
l5aYm52lqbO3urvBwr7FwcLFwsq4pqGWgYJ6c3Fzd3R2fXdnYGBqdHhwb3Bzd4SOj4iGko+EgXRo
WE9LTEc6KBwfLDhJV2pZTk9LRU1iaWhpaWtpcXFwcXJ0bW1pa2p5k6GfnqOloZ+hmpiTi4yGgYF9
e317dHFrYE1JR0xWiqGer8S7sq6sraqhmJF7bW1pZmhqamloZ2prZ2preIV0cnFxcllJRj45ODxJ
gXuDcWhqfHRucWtnaG52i52fn6GgmpqqrK+qpJ6enJ2aj4t/fX2Cg313eYKXo7O2raWprqmloZiS
jZGUj5WLmJqCe4GYqKmvrqWmpqesrZ+dnpWLemg3FgoeO1lrdJGfnJiRlpeTmo94cnB7hYiEhYaF
hIOCfX99fHRtbmZZUFaPj4aCj5elo56foJ+hp6ihoaWhpaWpqKamqKyyrqewr6qlqK2wrK2qsbKt
rKyqpaqyrq2wrqqopaChpJ+blo+NiYaAfWtZVVd6jJOTj5ufoaSzoZiVlIt0ZnGTnqWlpamqp7C3
trm+xMXaupqeoZ+hn56bkYyMhoh8XT5BW2VqZ3aAfXd3cWtobXJ3hIaGhIaFhIGAf32IlJGPjYR/
fYGEa0M6Q1Nnen+IlpSWl5aUlY2Rnbi+trKxrbGzs7Oyu7iztrO1rrawqqWgnpKJhoaIhoaMiXx9
fYB/hYmFiYiGiIOAeGtYRTpBWVhOUlZXYWR2gYaIhIN/fYB8gXyChIGGfXNxb3R9lIF4dHR7g3lu
aV5eW19hXFVcYVBTYoWXmJORj5GNhn17eXx6eHmEhYuKjZKUj4yLjYuUmpueoaSlloJyWUpDRE5b
ZmtudHt4eH1/g4J/goagp4aNio2Pk5eYn5+cm5qhoaSfn6CYkYt6eHyGi5GOlJWRlZKPkZSPj4Fv
ZmRnXVxeXFlZX2JlZGZma3R0WVBPT05PVmhYT1BMR0dLTVVYXV1gZmZxho54eoOBgX+EhoOAhoiO
vMGztra6wbWsrLCqqqGbsLm4uLmxs7Gurq+sqqmlqqampqCYprKho6q7x8fFx8XKzMXDx8XAw7zA
s6ahmJiSioB3c3FvcHFuc3l7dHZ2d3RzcnmUu5N7gH16eXt7f4CAhpp9b2ttbnRkaXSNlJaRj5aS
k5iYnJeln4RgTEdGT29zcnt9en98eXp6dHNxYFBLWW96goqEhYaAfHt0enN2g4mIhoSAfHlnX1tZ
ZGtgXF5bWVthcnyLj4yNlo+NiIp3UkdHUGJpZmpnaW9xb29pa2pza1ZrVEdJT1JbfYmMjJGPlZWR
io6LhYmIiZuqrK+vr6+vqam7qZ2em5itqZiWl5aVmJWUk5OYlpGYmp6VjIB2YldQUF2BeG5rcJyP
fIyTkY+PlJWam5iYlpaYjomJiJSTgnd9i5ZrXWV7jpien6inqamoqZyPk5uq1Lywtrq7vsTDu7W1
sLKzpZWBXU5DTVxiZWZoamlvd3l5d3x6cm5xcGdXQSwjIhofJVBHQ1ZfUlBXWWFiYmFZWVxhZWFf
YGJlaGhwb2teWVtlc3qDg4CGi4yRjIqElI93Z2+To6y33+Lc2+Lg4NzZ0s3OycTBwcHDt6mxtaqg
mH1qYmRhXFhbYm5pbXR9gYB5d3Z2dHR2dHN4e4aPl5ibnJualJiejX1wbnprRUdPU1NWVVRXTU5M
SVNNTmB8jI6JioqIgX18dG1laHmGiYqMjoyexZh4d3lxYkAqIzNGUFdeYWVlbWloaWZnZWJhYFxY
ZFdQUElKU1VTU1BPV15WYYGjr66qra2zubizw7OqoZ6elY+UoZ6ku8S8s7O2trW3srO1r66usKem
p52cnqajnqCjpqCJdm58haWvr7a4sq6qp6GloY+GjJGTk5KOj5aTdF9ymLu8s62sp6ywrbGtoZ2U
hoCEhoSCgoSMZllhb3x9gXx9gHp8fXh7cWQ8Ly8vMDEyMThFT1hgaW1yeoqUmqOvt4+MjYyFg4iO
j4aLlJOMhoaDfW1fVFRdaWlpZmJqYFJMS05KT0tNTE9UVF5eXGZrb3Jzen2CjI2Fi42TlZKRlZad
npeIgnZlVVdfYmFeWFhXWVNOTEtCPTc1PGBNQ0NCSktGRDkrIiYuVUAyMjMxOVBXW2FiaHBnYmdq
aGdpYWFiXVheVlJNWF5bW11fV1dVUlRQTU46ODQ0Nzc7SnZ3cHt6haGsrqmprLCqrLG6vsC/wby7
u7e3t7a2s7OzubaxrrCxqo+Chp6yubu7vMPFvr67trWzvLq6uba8t7a3uLGysK2vxLmTj6qLen16
eHx9enNzfF9XWVRLUmlye4OAfYOEfX18enh4gICBgYKEgH2AfXp2Z1hZYmJha25pa2traGduhoiG
iImGiIyNj4yLjIF7fYGSsn9obXl9f4GGhoaKkpiVnpaPk39iUDIpKjVJYW50enp9hoCElK7CnrW8
vsrCs7O1u7yzs7evsKejoaSjoKShm5iboaSlpKCeoaampqasr7O1vsC/v8C8urm5rpeLlJianrrN
pZuhrrqvr6+vrqqmlYmFiY6GhH+CgX1ta2pnfIWMjpifuqyYl6Odko+Vj5SYnJiWmJ2XmJyMiXxw
coR5b21qYFJTUFRZXl1cYWh0dHZrZ2lpaXFzb3R0d3N0eXh5dG1YV1xeX2BkYmRiZWprYE5LS09V
TlBNS09PT09SVFJQTk9QW298hImupIyAenh0em5dXWRua2ZkYmVpdKaPaXSWgn2TnKGdnpiWmJyg
n6y2s7i3vLy/wsLCv7y+vLOhin2BjYl/e3t8gYOGhnxwampxb3NydH+DhoaJiYaJhoKCgnxqUEdH
SzQZERMiKUFYVE1NREM+QFZla3dwaWlxdHd8fYB8dHh5dHSWnpufoaOfnpiXko2Pi4GBgYB9gn18
dHp6XVBTV1lwlaeus7i1qqWqpaCRgG9pYmVvb3FqamprcW1ua2t0c3Nzc21pU0ZKQTg4O0yOi3Bo
ZWJraG53cGhndH2TnqGon56hoK2goaWmo6CempednH15eH+BfHx/gIuhqqaknqSloJqYk4+TlZKR
j4+Ff3p7f42qqaGhoaShn63Np5OSjouFcDsXEShHXGhyg5WYmpGRnJiDdHNxdHuEiIqDg4KEhIZ9
eXZ0cW5mSTU5UnSEipaWl6ChoaChoaGhpaejobGqoaaloZigtby1rKyprK2tqbO8ubCnqqytp6Sl
qqqvr6+vqqqnqqWhoJiYmJOOhoB8b2JZWFyAjpqdm5+lrqqlnJqTi4FuZ3CEi42Vl5aep6qzuLW3
xdCwmJujp6Ofm5iUk5WPhHdUQTVEX2VpanJzc3R0bWVvdHyBf4SGhoiFhYSAjYyMkpOPiIaCi459
V05YaHiJio6RmJ6YlZaSk7LFvrixsbGztbW3uba2t7e4ubCvrK+wqqedkYqGg4KChI6wjHR9mI6C
hIiJiIaOjIOCfW9fS0BCR05TW2ZiZYOJhIOEi4WDf3x9gH2BgaCMb21uc3B0cnN0dHZrYVhXVlNX
WVlZXVlEUGRpgpKSk5GMiYN/f310b3F4fIKJjY+YkY+UkY6Pm5iWmpq1sZOGcFhQT0xVVFlpb3Fw
dnyAgISCg4aGiI+NgYOJj4+Tj5GYl4+WnZ+koJydmIuIiG9zen+BhomIiI2TmJiSi4mGeWtcVVBT
T1tgYlxiZmJlYmRqcWhYU1NSV1lbempZVUpKSkpTVVZdYmVocHOAgn19f4GDhoaFhIaNkZSpt7qx
rbCvs7i2sa6vo5attba4ubq1s7eyrrazra+tqp+hpJ2doaiprrzIxcTTzsXExMC+v8K8trq1pp6Y
koqJgH10cmtpa3BzdHFzc3h3cm5ta4OahHp9fXp9fYCEfYWJjnlzeHRtbmpncoKPj42Nj4+YlZaT
mKWpgWJgV1RYa25ucXZ2eXl6eXRva2VVTExYcoaKhIiOgnl3fIV7e32DhoiFg4J9fXdlXVliYmBl
a21zd4GNjI+PkoyaloiGgmtSRkVKYGlucGtqam9yaWhra3hhVVJQVFVXXmJ5g4qOk5SdmpOUk5GX
kY+jpKSlqqqtrqynpqSelpiamJ2YmJiYlJqalJeYmJeanZubnpiPf3RhTz5AT399ZWl0iYaDjY+T
lZSXmpaSkpeVkpGJhoOIqa2GeH97dGZkaXaMoaqfn6iqqKetqpSWoaaztbq8w8TCxMLEwry7vLWt
o5NuWUtOVV1dXWJoaWprcXR0dHN0dnNwYUo4LykrLDIyRkBJZmJPUFdhYmFiYllYX25zaWpra29x
eHRzenpta2tyc4B8gIWFhoqUnJGNi4N3hamqssLZ4N3g4OPe2tfX1s7LysXDwr+8uLe2r6ifjHRr
amZmYGBnfXyCmq+Een99eHRzc2txeHF3eoKXkpGflZaKjaqOd3JicV9JTVhhYFxbV1VYV1BHWE9Q
YYGAen2EhoN7eXdzaWFZYnB0e4CBhomShXx0cmlkSTcxOkdVX2FlaWpqbWpra2lpZ2RhXVhZUEtL
TU1NUFBSTlBXXlhoj6ipqaWsr7Czt7G8rrKupZyTj5OVkqbIzryzu7m6uLa5s7KurKyuqqWmo6Ok
oZ6foaejiXJ4hqSKnLC2tbOzqqahnpyViY6Rj5SPjY+Pj4ZyYGJviZ2nr7GnpqikrKGYj5GMg4aJ
ipSGgXpdUl5teoF9fX1/enx6fXxxVzQ1MjQ5NTk8T2dyam13eYWjl5qjr7WyjYqMjYyKi42NjJKP
ioyMjouMhXFfWGFpbW1ta25nYWJVSUtCQklOT1BVVlhfYmRrb3F2fH+ChoiChImGio2VmJ6hlIV5
a1teYF5eXVhYYFxVUk5QR0A1LzAzLzJCREZGSkxnV0A3NTJDQDEuMjo5OE1SW2BiZWRlaGRiYmJi
YV1ZWVlUVFZYXllZVVhcW1BQUE1PSj44NTg7R319d3d6fIKBiqGqqKGfoaSqsLnBwsC8wL+zuLu2
t7a4tbe1s7W2t7awlpafp6yzur6/u7/Ft7a/ramwuLq/wrW1trWzsq6sqqmcfHR0e3p8eHd3eHR0
bnFpWVlYV1BXb3R9g4B/goSCgn12dHd5fX95fIB9fIB9f316XllcYWhrampraWdmYlhqfYOChYaC
houJiIqIgnt9f4GDeWhvf3x9fIWGiI2Ul5acmJeVjmo6JyYqL0Jba3R0eYF/hI6htruyxb62t7Oz
x8K7uLa1srGno6GnqqepqqSerqyhnaGlpKWkoZ6kp6+1uLi5v8G6u7O2tbOznY+aoZOVmJqho6Sp
qayxsK2qppiWioSDgISCgIJ/bWZlam5xdHNzd3+SlYmLlJWbmpWTj5OWl5iXmJacvKGAcWtudnRy
bmVWUk9YaWJcYGFwc3F0f3NwbWtwcHR6eHh9dHdzdHp6dmJcV11fZWViXl5uYlZPUFNSU1ZXUlNN
VFZQUE5OTlNPS2B9dnZ9hZypsJyPi4Z7b2lhXmJlZ2JiYmJoYmBlcY+Vj5KVlJqbmJ2fm52ho6m5
x8XAu7nBwsTCu8K8qp6GfX2JiYSFgYGBhoWEiIN8c25ycnZ7fX2Gi42GiYuGgYKAfHBZS0NDPB8R
DBEdLD5BQDs3NzU7T2Bid3hqaHSLhX9/k5F/epqAd4Scn6CdmJWVko6IhIGGgn17eXyAe3l3g4Z0
bmtwcHqMo62qsLCqpKWfmIx3aGJkaG2MmHZpbXFxeHJubW5ub3JtXEo8Ojo4ODlAUFtiYmFhYWFl
aGtra3N7gZeqpKegpaWfnpuWlpygoJ6fo6WVgXd9gXx5fYKDhoyeqaimn5aPiY+VnZuej42PpYx/
fHNyeJijoJ2fn6SjrtWqkZSSkYt8fD4vOlZdYnR9e3+MiIuTg3lydG9ycX2Cf4OEgoKBeHl8fXRv
Z0o5NERqgIiKj5SanKGlo6OjoaGfpaWho6GcnrGqmpanvLOzraWmqLWstq6ywrWsrqqmnpyeqKmq
pq2zsrGnpaGfnZyVj46KhXdoYVtXVnOTm52fqKmsqaGglpaOhnhqYGRyd3Z9jIqPlaGlsbG1pqOg
pKqjoaGgnZGSko2FeVJHNSlEUltlamp6c2BWYXKBfXl9g4WGiYWCgoOSnpGOkZSTj46LioZrWWZu
d5qbkpSYmpqWlJaYtcO8s7C1urOzuLOzuLe5wLyzsLOysa6spZ2GhH+AgoCCgYh9fH16gYaJioyP
j46bjoJ/eW1JPUJJTFNplWlmeoCIjYaFf3x5gX+BgIaDhIBua2trbW9yf3Jxa2JYV1ZUVldXVVRW
Tkxhd2trhpaMhX99dHB5gmZiZ3F6gouOjqGVjIuGi4+MjI+alZiYhmpPRkpVWWVfXWtqcHRzdHqB
hHyFhomJho+LiIyIipGUlJaVl5ueoailoZyOhoB8b290e39/f4KGipaVjImLjIR0ZlVMRklPV2Fg
W15hYGJiZWJiWVRXWVlYVlxbVllZTkpLT1VccG9lZ210fHR5fX1/hoaGg4WFhYuTm7G4s7OxsrKx
r7CuqqyjoaiwvLy7uru5tbiztq+qraqlp6ahnaChpKiqw8K8vsTEx8S/wLy2s77DtaqopJ+WjoyF
f3Rwam5xcHB0c3R0dHRya2ZlbXhzd3d6f3yBhIWGiIJ9eHx7d3JvcW9xfYqOi4uNj4+Pj4yPmJpz
aGhlYlhZW2Roa29yc3B0c3RpWVRNSVdrf4yGhoaAe3p5eHx7enyFhoWFenyGlGVZXFteZXSDhISL
j5aSj4+Pj4qIg4KBdlhGRFBkaHNrbWtyhnFra2toYl5dWVdcWVliaX+DhouPlZiSlI+Rv9GXgpWb
pKGhqKehpaSjnZ2cl5qTmpWNkpOYl5eXlpacnZyYmpugmI6AbU4+LzBNXF9qdICEkoyNmJWRl5id
mpiXmJaTjoOCgYCGgn96f3p2amZqcIauyaGXoKampqenoZufpKawurvLxcK/wsfDwLy6u7Wom4Jm
Vl1ZVWJfW11iaGpub25vcm9ydGhYQzc1MTAwMCwsNUFHRkdMUldcXmlnYmFianZocnl2dn18en2C
hoaGd3Z3f4GDgoKIjpSblpKLhouSp8Xg3dzl39rb3uDf4N/X1dHNysjFwri3u77HuaGYjIJ7dGtn
ZXB9gYWcoYuFgYSBfHhubWlrb3NzdHyGiY95dHNwb2JXWVJHREpVYmtkXl5cW1dWU05NR0pYZGVu
fYOOg3Rya2liXlxYVllnbXN9gn96fXp0cW1ZSj5KTllbaXRmb5V4Z2hwcW1oZV9bXndhTUxcUE9P
TlJXS09WW32usKemqaqpqq2trqqhqaiekZKRj46Vn8HOwrK1vLmzs7OzsLGwraqqpailoJygpJ+l
p5d3d4upvKanrK6sqqyloZyUiIaNi4mKiomNk4yJk3lZXV5lhJSkoaOkoaSho6mcl4yFhoiGjIOE
gWpcW2h2fH18fXt9gIB2bWpYUEc7O0JMV11ldHt2fImRu6idp6mpr7OLjIqGhouGiY+OjI+RjIqI
jYyEc15fYm5raGt0dGh7jWhLRENGSUZHVlZbYXRxgGtocHF5fHuFjn2Ci4+FipilraqdhmpXUldZ
XlxZV1VVUFBVgmlHPTQ1MDApK0NHR0dMSlBSU0lBPEI7ODU3PDcyPk1QWWBhXGJkZGVlYFxZXF1b
WFZXW1lZW1lZX2FfVlNQTk9EOjc7WG58f3+Bgnx9e3yMvrCho6SlpqOjrb7Fw8PBv7u4ury4tbKy
tbmzsLCwtcC5rKypprC6zsO8wbzMyLKcnqqwtrzAurexrrCwsKmmn5WBdHRyd3x4dndzdHRtbWhd
XFxZUGt2dHyEhIWAgX99e314dHZ9eXJvdHd0fXl5eXxtWF1fXlxZXmBlYl5eUF59iYR9goSGhImF
goOBfXZ7d25JNUd3hn+DhYmMjo+XjpObnZSIazIhJSovR0tfbXN4eX+Nl6y8zLu6s7e6ure1tbe4
trO1s6+lo6anpKCqqqGgnqGkpKWjoZ+gnqGpucC6tsHIwb/FuLixs7qkk5qXjpafpKOkoaqpqq6z
s6ejm5GCfIJ9gn9/eG9oZWppa29wb3Jwb3BzfYuPpaGRk5aUl5yXmJ2blJWYl4FraXF3cW5pV09V
ZVhZW3iFcXJtcXl4f3t3cW5uc3Rydnp0d4V8dHR5b1xZX2RkZGJiYGJfWE5NUlBQVVlUV19iW1tQ
R09PTklKZWtxdHmKmKOpoZ2YlJKGf3Nrd3JkYGBybmBiYGZ3goyPj5idnp2dnqGkoaGhp6zH3Lmy
usDCwby4vMOxmoV7goiIgoaGhIWGiIyVkoaCeXNxdHh8hY+aj4iLiYaKg4B7dGlUQkA+KBYRExwj
LDAzOTs1MjU+R1hZW1thbXOAf4aEf4F9lZyBhpWdpJ2YkpGSiX2BeHN3eXd/hn94eYGGiYF4fXyG
hoqdqrG2ta+qoZqOgnBuaWdmbY+ognR0eX16dHd0bWlra2VPPDo5ODk6QU5XVlhcYGJla5S3s66R
gIGUn6Cjpaynp6ajmJiRj4+Ymp6dmIt6dnd9fX16fH2BipWcm5aIeXN/j5OSj5OXi4aKj66GbWRh
aoadoKGfnKCloZ6YlY+Nj459cYtZSllmbXB4fHh7enh3cm9rZ2pydnp7enp9f3x6eXdza2dZQUBL
bZSVi42OlqChn6GloKGkp6iqpKChn6evlpSPjJrAvqadpKinqaqtrq6usbetpJORmKSmo5+jrKqt
qaSmp5+Ylo+Pj4+FcmFcUElObaHBp6Olraqnp6ajl46MgnNeUExQWGB9enN5hpiooZ2enZ2hoaGk
pJ+WkpOTjIaBWTwfGSUwQFZZYXloUFBQYnp5fYCAgYOBhIaPg3+Uk5aTl5aUj4qFeGRcdIF3hY+c
nJibnJiamKnHvLWut7m3uLa4t7a7ury3trmyrqyzta+mm42BfX+Bf32Ae32AgIGDgYOIjIqKjIiJ
iX13cmFJPkVMUFdgZHqDg4CGhYOCg4+CgZaGgoCJfXBqaWhpb3OIc2ddV1NST1BUUlBQT1BSWFxu
cGhrfH2Vf3RraHJ0V1hibXuFiY6Rk5iWj4+LhHJ7j52Tj4ZpUkREUGFlYmRnZ2ttcHR6eHuCiIaD
hIaMkZF0d5GUk5aOj5KdmJihrqmcl5aTj4mDf4l8e4J/gIOGjI+PjouEgHBXSkdJT2JWWV1iYV1c
YmRgXlxYVllfXGFeWVZYYl1fX05PWWCGhGJncXR6eYCCg4WGioqJhoaNlY+asK6wsK6urqqtqqWp
pJeTo7O/wcrAubq7urOzr6+xsqqpoZ+Yn6Sorq2oub66u8DBw8HBvr7At7OzrqqlrKCPhoR9e3Zr
amtydHZ2b3R2dHFqZmFocXN2en2AhYiDhIaDgoJ9gH9zcHBwdHeTk4WFiYSGiIuOjo2SgmhrbXFo
W01MV15ia3BvdHtuYldNTUdLWHGEiYiKiIJ8fIJ7d3R2dHuAgH17fG9iX2BiYGVrf4WJiZGYmJiU
j5KNjpGOj4t2X0ZAVGlocGtpZ2twa2dqhIlmXFdSV1tbWWBvj4qGjJGXnZaTlJOozqGGk5yqpJ6j
oaOjnaOenaaakZOTmJuUlJaXl5OXmpqam5qhn6GYiXxrV0I6LzlCVXJ5eYKTkZKXlJaUl5iTlpWV
lo+Sin15fX99enl3dHpwa3h9gZqyoZuep6eko6WcmKGosLi8wcXDwMHKxcC+vsG6tbCqkW1kbmJZ
VFNWXVldYmpxcHJzdHiBYElAOTU1NDczLC4vNTo+Q0lNU1hZZ2hcU0lMVWV4nZeCgYaKjIuOlY+N
hoZ7fZaGgY6Uk5qdmJWUlZih3+/a2ePg3OLf3t3f4t7a1s7Kx8XIxbq/w9K8s6ejyaeDf4F2d32G
i4uPj4yFf4J4dG5oa2tub21vc4h3Z2BcWUtFQj08OzpCTVhiZGBcX2F0cmpZUFBLR1ZdYmpzd5GB
b2tnXllfWVJOR05UYG58gYF3a25rd29XVF1UVF9pa2Rthm5naGtwbmVkaGdna15VVFNMUE9TUm1Z
TFJhf5umpaemrayqrK6onamqpqmloZ6gscuyvNLKury6ubq2ubOzsrOuqayuqaqqpKOgnqSoqo+W
nrO/r6amrKqpppiSjoN8fYOGhomLjoyNjo+gfWJXTk5ia4SWnJ6co6aprKamnJSJiIqOkYiGe2VY
Z3RycXl7e3d6d3JuaXRwXVZ6emZocXR6hoaGjpiyo6SuraqzvIaKjo+KioyIjImPj46OmJGIgX1x
XmJra2lqbW1vcWtiWVlKQD5BQkZJT1dYW15fYGprcXFzdoaAeXt9joaCiZquwbqGaFBQhm1XUk9Q
WFtWUk9NTV9EN0QwLyxTsYREPUVJTFBPUE1JRD48QTUxMS8uMUxkX1llYF1fX1lbW1xZV1dZXV9Z
WFhYU1JUVVNQTk9SS0A1OFWMlYSAhYWGgoCCfIKFkZ+lnJWSmKOosLnB0cC/urm1tbWys7WztbO1
ubi7ubWzsqyws7O5u7bAyKOKg5KeqLC4u7y1ra6usrOwpaOcmIaai3N2dnZ3d3d8fXJnYV5ZW1tZ
cYJ7fH2Agn16fXZ2dHNzdHd6dHBwc3h7fHt9eHpzZWFkYmBeW11YU05JaYWFgH9/gIKEgHqEgnx6
dm1rZkwnI0yBg4OCho2MkpWUmJiblZ9zLCo0KCkyNElha3J5g5SqwcW6rbO3u7O5vru3trG2sayq
p6Wnr6qnpaakrrm1sq6wsKGdlpibpqmvvsO7tbW6u7y6wrfRy5OFiI+RkZGqsKihpqezta2urKaY
hoSGfX+DfH1rZGJmamhlZ2tqbWtxcGtwgYmKkY+RlJKWnJaVmJiYmJeGbmhrbXFya2ZZYm1qZ2Vg
YnBua3B0dnqGiX93fW1nbW9ucnh3dHZ3eHl0a15YXl9iYl1cYWFeVVZSUlRYVlRVYmRhWVRHUlVG
Rk5iZnF0d4qboKClsqyfm5SPhYF/c2FcXFtZXmBiaXqNj5OWmJydo6GhoaqnpKGlrLazt7m+wbq7
wMPAvr6cgn2AhIaPjYyKiI+Njo2Li4yGj4l9goOGiZiYioWKiYaGg4B4cGpUSUE3MSIaHCcuMTAy
NDw9Nzg6RE1QU1xwdnl5fICGhoaDhYiUlI+YlpONjoaBenZxYmhwdHl8fH2AgoiLhoWEhYuLjo+c
psLotZiXkYVxaWBkaW90gpGPj42GiIaDgHh2cWprYVREPj01MzhHWFtTXmJkaW1ziKjCvK6hlJae
qKqhpKqqoaaknJqRj4yIg4F/eXR3fXd0dHp4go+UjJaMhYB0bW6Ci42Oi42MhoaBgHpuYk1OZo6d
nJ6gsLqhmpyemJWWlY+DdGZkZGBiaHR2eHd2c3hzaWViZHFydHqCgH1/enh6d21pZ2lkZ259fYOF
jY+Um56co6GmpqOhpKmmo6OgsbmblJSRktfisZ+hpqmws6quraqurKaTi4aGlqGloaWkqKinqKad
n5uampKLhn10jW8wMklrjp2hqq+qpamnoZ6Ylo+EgG9WQ0JJRlBTWV9tiKmfmJqhpKSjoKCfmJyY
l4+OnmtJRywUEBojMUBLSUZKTU9ZaHF6gH19gYF/gH97i5GSkpidm5iWioOAa2RldJyTjZSYmJaY
mJ6stbG6ubi1trm2ubu7ubq2vLi2urOwrq6wrKmgjXx2dHt8eXp9eXqCf4GIhoOBgYOBhIqIhHt2
g3BHRVZnb2p3gYOBgYiIg4OFgoKFhX+ChIZ3amlia29tbm9lXVBMTlBQUFRPTEtKTlJWWV9iYWRn
am5uaWtpXllPUFxrd4KGi4+PlI2JiIZ5aWlyd3Z7ZlNHQEJVXmJpZmprcW50fX+Ag4GGiIyGhoyM
hnJqqL+Ke4aPkqChnaavqqWcmJecn6GRhnx9gIKBiYaDhIGDfXRwYVdLRUtQVVJTVVlbYGReWVxZ
WFdXXV1iX2FdYGVeXV9eVFVeYWpkZGpvb3R9gIqIhoaEiImIiIyPlJyts62orLOtqqqko6qal5Ka
r7rBzr6zt7zCv7y5t7Cvrrq5oZacoaOqqa2ts7e6uLzDxLuzuL+7tbCwrLHr9s2JdH17cGprbnR2
dHB0dHh2cXBtamtva3J3eXp7en+Dg4WGhIGBfHh4dHiIfXqBhYiDhIKEhoaPinprbnBzcmlZSTU0
Q0VYanl0a2FWUE1FTFNmc3yFhYZ9goF7d3Z3dnR0fH17dG5rYl1hYWRlaHODho2Pk5qamJqYkpSP
joyNhXtiS01eZ2lpampna2ZqbWuDjmZZVlNWXFtcYG2Ci4mOmJaTlpiblJKSj4+PnKCcnKGhpaGm
sKGXnZqPjY+RlpGUlJWYmJicnaGfoJ2enJSIf25ZREs9MjpOdHl3iJiMkpiSl6G5mpKRj5WXmJOF
fHp8fXRxbmtpamtudHR9hqGhnJ+sm5iUj6ihn6qtsbzCxcfDx8XFx8XDu7uxsaqhhHZua2dfVlRY
YGJkaG1xd3ducG9cVEdAOztAQDMzLi8wNTg8QkZMT1JVV0s+PT5CXXaSlpGTj5GTl5ifn5qJhX99
hXuDkZucpKemnpuamKjD3N7b4ODf4ODi7ePg3dzX08vAwMjJxMXHxMC5t7fbzpiGjpWGg5OzlpqP
j4+GhoR9eW9wbmtraXBpbWpmZWJbWFdTR0JESU1SWGBiZmdpZXRqdGJQUE5KUlthYW13dmptbmZi
YF9XUktJQkBHVGR5eIV0cG9rZF1eXlhbWWFkYmlmbmtra2pqdHJwcl9ZWVlcWVNUUlBQW1JTVWuJ
mKOtqaakqqemp6Okqayvsru+w7zD1cLJy8W7ubi5ubO1ubOxsK+ur6qqqKOmqamlpaqztbWmxLeh
qKqlrKOhjG9phqeIe4OPiouPj4mIiYlvYWBNNTI3WXuOnqihp7Wsqq2po5eSi46PjI2KgGliZGVt
bnR3dnJqa2tndHRqa395dnJ4fIGRjo+UkZSeqLKzsbCzkY+Ri4+RiIiNjZGPjY2Nj4yGf3x0bWVn
aGpra2lwb2ZeWU9COjo9REZOUlZbW11mZWVub3R2dnl5enh5iYaEkbLXw2I6O0VPU1hUVFdXXldT
UFlJQD47Liw3NJ/XfT5AR0tQUllWVVVPTUxNSjwyLywwTVNZanlZWVlZV1lZWVZkbV5ZWGFfXVlZ
UlJWUlBPUFJSPDhJaX+BiImDhoyJhoaFhI6Pj4+TlZeVnqGvtry8vLu4tbe2sri5t7WzuLa3urq3
urvAsrO5ur6ylY6Sj4aanZihp62vtrmxsa+oqK2np6GelYyMlqqYe3Z3cnJybmtdV1hbYqDXn3F0
fXt9fH14dHZzcHBtaGRiZWhrb3R9goN/fXd3fHJeV1tXW15QRVOIg3t4e31/fX+AhIJ/fHdzcWhg
TSceUJOJfX2EhouRk5aXmJqTiXhPQT47LikuNU1vbXSNssrDv8HIsa64u7q8ube2s6+tpKalpaam
qqqfna23t7a3t7Ozrp2XkrC+qKGxuru7vMHAwcm8sMCzjYCGi46RmJieoKCdpsW2paalo5iEgIp/
fX9wX1xbXWBoZWVmZ2hqa21xb2Zyf4iTlZOSk5aYnZifoaGemJ14aGRpa2llXmFgXWJkZYN5ZWZt
dHF2eXx9fYFxZ2twcm9vcXR2dHd8enh4W1ddXllZXVxZX1xWU1dSUllZVllZWH+CUj4+QEA+TV9n
bnR9k5qboaGYn6SmoZuYk4+Lg25ZWVdZX2BohIuPl5WXnaGhoKOw5MqYnKWjqKqxtbi5wcHBvLzB
t5eEg4WGhpuThoyPj4yRkY+PlJyal5WcmI+JkZOPlo+NioqGgIJ7d2pZSj06NSwjJy8zOzs3OUo7
NDQ0RVBXYnB0b3F7gYCEhoaFi5GSm5qUkZKLhXxoYltTV2d0fX19g4F/hIWMjYiKi4yOkpOcoaql
np6VdnCIc2pqc3uOn6ehnpeXmJOSj4Jya3p6ZlhQRkJDRk5cZmVqdHN2d3uBl5ego6auo7uwtbuq
qKmnpKGcmpqRioB9e3l7fYKAenZ7eYGNkpGOpMePeHRra4ucjIyVk4uEhYJ3cGtZQkdliZ2hnqOk
o6OooZ2YmJiYj4aAfIF7ZWJra310c3Bxb2tnamJmYmZ0fHh3gHd5c3N0cYCBd3J2hoiGi5OWl5uY
np2anqekpaejpaOorMKlnqGfnZuToailpKampaqup6ikqamono6CgoCPnJ2hpaOkqKmgoZ+doJqS
jY+YqYCANRwjQX+am6GmrK+urqypoJycmoyEeHFMR0xEQklLUltuubeOj52fpaejo6GbnpuVk5Gj
aEc8IgwHDRouOEBGSUtNUFdhZG15gYF4fIWJfXiInJ2YmJicmpOKioJtZGt5j5qUlpWVmpucnqmy
zsS2tra5s7K5vLm3vsO7uLi7s7Otr8WzoKCMcm52eXd9e316enyDi4aJg4WGg4uPlYqGgXx6aVh5
fHRzd3qDgYqMhYWIhYOGiIaFgYaDhG9raWdoa2liXFlQSUpLS0xKS0dFREVKT3lpW11mZWVkaWtq
Z2RcWVBMVGVucn+EjpSNiIiIhn94ZWRlYl9ZVEQyRVhcYmhpbXNxb3R6fIOCg4qKiYaOioaEbVdo
eX17kpSYmKm5s6ymqaymqa6psbi8iH2GjISCg3+Bgn1za19UTk5QTlBUVE1UWFdbWFVQU1NSV11Y
Vl5fYGdhYmJeYWVmZmdiX2FiampudICJrrmDeH+DhoaGiI+SmKmop6apraqoqKWen5uSj5qsuLO5
uLy4ubKvsrW4sKmor6ebmJudoKSlrLWlpayuwr+pnJ+hoa2xr6qqt/f+7I9xdHuBa2VtdHZ0cnB5
eY+Aa29ybnRwbnR7e32DfYCEhIKGgIB2dnZ2g7eGZ299gX19g32DhIB6aWprcXJva2dZLiApNEVY
WV1cVU9NTE5UaHd9fYOEhoCDgoB6eHl7eXRveX1tWFl9dGltbW9vfYaFio6XmpqXnK2XlJWVlI6G
fXNhWV1obWprZmlqbWpmZWZiYmJkb2JhXVdceIKGio+SlJWWlJKRj5KVlayglZygoJqfoK6xqJOP
j5iYj4qLjZKPlZiXnJyWpp+bmp2clYqAcmJWX0k4PEdmdHuCiYmRlJaRlp6VlJSaoaaTiomEeXRv
aGtpYmJkZnF6fHmDho6Vl5uamH1zrqyhoai1w8G/xMDCxcTFxcC8uri5raiMd3N2cWtiXVlcYmhq
b3B5fX90a1RNR0VDQ0NPPjQ0MS8xMjlAQEFCRURFPj08OkReeI2TlpqfnJycm5qcmJGGgIB7hYqP
m6ChnaGopqGhp7nJ1eDc3uDg4uLe3dzc297XwrXAxMHBxcnEwcG/v7iqm5qns5SGkqCWmJiXlZSV
i4Z/d3RuaG5oam10fXpwdnFybWJhZ19fXFVZYWdoa2hra2tnZF9VS0pPVlxmamttb21xa2RhW1hP
R0A3MjE9S1tocnFzcG1rZmJhX11ZW2BmaG1rbm5raGFrbmRiX2JcWVJXWVZQS0xMUFtvdpGbnaOm
qqqnoaGgmJ+ptsXM0tPO0MzKx8nMy8W5tra1tbm2t7KtsLCqrayqr6qmpainr7OsqrO4r6+xqqak
m5JtWGubx6N9gImIjIuOjYmPf2lmZ1Q1KikwVHycqLGssK6wrK21vKOps5WKkpaPd11YW2Jqa2tv
b29vbWtucXJwcnd9enl9ho+NjI+Um5+lqrO6r7CLi46Ni4qMj4+Ni5OPjI+LjIqDdmJmaWVnam1r
aWtramVcTz03NzU9UE1HT1NZX2iDcGJnb3R0b3JycXB5dHmRt+m/Pis1QU5TU1ZSUlNgV0xJQUA5
MUNlNBwecWdHRVNPTk1QU1VcWWBeV1lSQTM1MjdHOUJUUE9WU1Rdal5eWV5ia3aEk5iRhWlVTU1M
TEdHNTExPl53eX2Ig4ODhoyIiYqKj4qFjq6dk5OYnqOqtbu3sruzsbCytrGwsrazsLG2uba2traz
uLq/uJqPj4+JjYmFjJSdqK2wsb+3rKiqqqempbXEzaiYmJGIkpJxa2ttYllXVmR3gIaEfHt9e3x8
eHRzdnhzcW9pZmVhZWtrbnJ0eH93dnd2cG9iXFRQUE5FUJSheXN3ent7e3h9gH19c2poamRNLh4p
VXl8goiNjYyRlJOXk42Ig3ZKS0E+PjEyOVBuf6rIxby2sLO1tri6tre3r7Czp6WgoJ2mqKqqoaGn
r6qvubm2tayzu5WRkY+gqrK6vLi2ubW5trKno5yRk4yLjY+jo6GkoaGjpqinqqamm318hIB7cV9Z
YGJgbXdrYmlqZmdqbm5paW10gY6ep56Yn6Ofn6Gfra2CamZpZWtra2hdYWVlYmJmaGZmb3N2dHl9
gIV/fXhyfHtybWtxdHFyc3h2bWJba2RhX1tdYWBZWFtZWFtdWVlZW2BiV1dVVURCQkdSW2Jrb3ya
pKG1rqGdoKCmpKCjnJeatZOCd2tmYmV0hYaUmpubmKCenZuhoKOlpKqurrK1trjCw7q8wrqfjYqI
hYWFhoiNlpSOkpSTlJWdnKGhn6SjoaSSio+RkY6Oj42EgYaJrrFePjxBPi8pKzA6QTo0NTk0MzIw
MUlpbXRwc3d8gYuJhICGkZeWlpeWlaGgi3FYRj5AW2p0eXZ4fYiIjJKRj5KTm5KOj5eanZSUj4Vz
b4VzaHGAhZqtuK2on5ubnZiXl4J6cXBua2hmYVdecmudtoNudHh8fYKLlJ6lrbCst7Kusrmsraqm
oaCbmJOKhIB7f4KJj4p0bm14ipaVlpWSjYqGfXdudIiRl5aJg4WBgXh0Zko+TXeSlJyepqqnoZ+h
oJ2YmpiRj4l/fXNiYGRqa2lucHBramdiZF9cYm5zcHN0dHB0d3h5eHl2d4KPjouRj5KYl5iYnZ+h
pqGjp6ipqqyur62qrKq80pyap6OkrKyppqOhoJqgn56ViHZncpKXmJufoaGfo6WenJaVj5WPhoWM
ZC8lJyhCfJedoamysLOyr6qenp2bj4mEeVtSbk1BRUdPV11zhpOWpa+jo6mjnZyempiSk5tcPiMR
CAcKEys8PkFHcWlSVFtkbXJ0e3yAgYaBhouYnJ6empqVj4uLg2llbnuFkpidj5OYl5iksbHIxLWx
s7u5tba3ury7t7y+vLi1rK673LWdmIlwaGhxdHd4dnl8hX1/f4KFoJ6IhYqYrI99fXpyaGtrdHt7
eIGAi5eIgIKEhoKEiIR/goqJj4J6bmtpZF5UR0NGR0dHREVEQz0+PkRLV1hfZGRiaGhiZ2teVVBV
Tj5DXmt2f4qYyJ19d32AkaZ0YmlgXllVSjpTXl5la2twhn9zd3d8hIWGiYaFjI2KhnltWE9ddICJ
g4mXsMGzra+wsq+1t7i3v8WehoSMjIqIgouIgXRrYWBWVFJSWWJZWFhZVlBVVVNQU1VZa2JeYWJk
ZGZoamVgX2dwc25iZGJia3BzeICgs4V5f4WDjImEjZGhqq2mqKelqqioo6GYk4+PlJisuLy3t7W4
trWzs7WtqK2koKOemJqYoZuhqqGhoaSpoZiYmJGGjbOyqqW8+/7QiHN0enxva2txdnR9fYB9gHhu
b3RraGhydHJ3fIF9f32AgH19hH15eXiAhHZxc3R2e4B9goN8bmhycnN0b25rakcqKCcuO09XX1lX
TU1UUl90fX+FioaIg4WDfXt2eXRzdHd9b2BdZ4uKfX17fX2FhoqVmJiYlJ6hoaWgn52enZWPd2hf
ZWdrbWtmZmdmaGloaG5wam5oZWJlW150io2GjJOVlpaVkpGPl5ykqZ+VmJWcoKGgoJ+fkpOPnJKL
j5GPj5KPlJaYpJ6YmJ2amJ2Wi3xxa11HQEE+SmJxe32FjY6PkpiXk5KYlpORk5KSk5Z5a2hkXVlc
XWVqbnR6eXyEho6VkYZ/bmSBlKeurrG7w8LDxMfHyMLEv8C7vLOwnomAgYJ9dGtnYF5iaW5zdHR9
enNwZldQR0ZBRkc6MjU1OCwqLjQ4NTg+OkFVQTs9SmJ8j5eYmKamoaWopbmjmJKMgoOGkZWapaaq
qq2wpKOvucvW29/f5+Xn4uDi4+Dc0cq5r8HLycnFxcrLwtTQuKagn6emmpGYlpagoKSdqqiYmKWY
gXRzdHRvdoCKi4mGgXx5dnKJcGVkcGVeZnFydnRycm9iZWFYTUtXW2FrcHJwbm5wcGlnYFVHQSwp
KTI7RlhpbXNycG5va2ZgWVVYXWVmaGhtbWlxb2RiXltgamJZWVdYV1JNR0ZMXYOOjpGYoaOqqqSd
lZefobLN193d2tnc29PW0szMzse6srO1tbmxr62zs6+wrK2qqKimqrOzt6qfp6qvu7eurKOfkX1Z
a32JjIWDhIWLi4+Oj4J4bnBrTzIqKy5Mi6anpqWquNq2rrK8r7G5qZiWlpKRg1lWW2BiZGpubnRx
b3Jzdnl7eXyBfH+Ii4qPl5aeoKWpsbyxsoyLjYyRi4qPk4mGhYiPj4+Pnql4W1xnZGloa2tva2pl
YVhPMSMjKCs4Q0pJT1BXYm9qZmllZ2twbmtqYlVJNTFOaUo1OENGSk1VWVZ0YFBJR0VHQjsyLisi
FhA1Sk5JTE1LTldZVV9cYmJdWFlSQjIsLCsvNUdOUFZiYmh9hYKDnqCkpbihjoaJgXRoSUE+TTUy
MzBHaXl7eoGChYaGio2MiIWFg4mPko+LjJSXnamvtbq1uLW1srCzrLrBs7Gxsra5tbWzrbK7xMC5
nZOVj4+OiYaCgZOmrq2ss7Gtrq2pqq2qr62qsKqmoZ+hsbWEXU9MU1ZlenmBhYB7dnR4dHl4eHFw
cHBub3FuZ2loYGFocXB0fH10dG5wdHRlVVNSSklCWHJ0d3l9gXx6fX18gHtvcGpeXFRAICVMc4GI
hoaMi46Sj4+Tk4Z6U0lCQ0dGXUIzSmuWwMK6u7u2s7ixsry/ubOuqK2pmpiaoJ+lqKahnqmtsrW2
s7Ktsq2okYOCjZ3TzrOys7a6vLy2sq68mIB9hoaGqMuqmpyhpaWlpqqup62Re3mFjH9eWVtbWWFi
ZGdgYGRiZWtlZmhlXmJqip6fnJ2ho6mnpqmoppOCaGBeZ25tYmJkYmRiYGJhYWVma3Bzc3l7fX18
dHByc29raHBtcX10dnJ3XFBVWFRZXF1bWFZVZ2FXVVhXWFlZV1ZXUFJQQDc9PkdUXF5ogJWan6Oo
zaiYnaGnv6+enaGhm46BfXt6a2lxfaW5nJSYnaGnqqmppKWnqKqqqrCztru+t7i5qJKIhJKVjoqS
i4uOjYmKi4yPlpaq1aqcoaeoqqyci46NkZSNjY2PiI2yx21CPk9JNTAxODU4ODk6OTU5ODU5SVNg
c3R3gH+CgoillY+KkZaVmJiVkY+FdGFDNz1KX3B3eHyJio6WqaGdpKWzs5qUk5KUkYaBf3BiX2J2
enyPoaqus66lo6CenJibmIR0dHRycXR4fYzEt5KCfYKChYWCg4ubqKmpraqmrLCusLGtpaOgn5yX
k4+LhoJ9goWGhH16cn2YmJeVk5GPkYiCeWlngZiYjoiFhIaDe2tbQ0BdiZigp6OnqqiqqZ6do5+f
oKWPgHx6eWdbVV5kZmpoZWtoYmViZWJlamttdHJ3eo2Ce3+ChH+AhYOJjIyOjpaYlZicm6GloJ+h
oaGqtbaztrKysbO7vMClnKShoaSln6Gfl5WYmJaBbWRif5eWmpugnJ6goZ+emJSSjIiEfXRlNCMj
J0V0mKGhqqqxs7OwsK2knZ6Yj4aAe2FGPkZHR1JXWXB/jJKXn5ufo6Ohn5WVlJN2WEQ1Iw8ICAwY
Mj0+Q0d4p3tcUFteanJ0f4WJlaClrqadnKOelpOVjo+PaGtud4OOkpGTlpORlqi1sLC5ubm3trO3
ub6+uLm5ury4trOzrLCuqKq3lW1pcnx0eoR8f3p5eoGCgISLhoWLi4+JhoKCgXRvaWt6hnx3fYCB
hIiGgoOEgH2GhYaChY6Xj5WNmHBeVEs+NztEREBEQkA8ODU8REtVYF6Fa2FiYGJbWVxZVk1BMTNQ
YnJ2fYyYj4R9fYGDg3l9k3xiVU5HR1dhZm1ua2prcX2EgoWFiH+BiIaGg4iGeGlNRk9oenh6hY6j
u8G8uLu/v7y8vMC8vLOYiouLl5GLjpydjHlxb2lhWVlcXFx0YWJYUlVXVVJSWFxdWV1gYWVmZF1f
XGJiZmtya2hiWVlia3J0eHqAgIKDf3yCg4KJjY6aqKqkpKampaCjnJqWlpOUk5q2vLa3r6yurK6x
qqqtqKGbnrihkZKSl5ycn56foZ+alZWtn4uFj6Gdn8T98Zt7eYGEf2t3fXh3c3N8hYaFfHR7fW9r
aGttcHl8en2Ae3p9e4OTfXh3dHFzc3Bxb21tcH+Ca2dpam1zcHFvdm9nWT4rJyw1VV1hW1JTU1Zn
d4GAfYOOioiGg4J9dHh9f3x/f4CBhp6RhH+Fho2LiIyUj46Yl5KYmKCno6i7saafm5KDbmVna2tv
Z2RlYWJlaHFucHFyb2ppYmRlaW16hYaJjY6Pj5OUlZacqrOYj5ahqpiSlpucmJeUlY+PkY2Ki4qO
ko2OkZiboaCcm5iXk46GgHFoW1BNR0NDYnF2e4KMjo+MkZOSk5OTj4yOjZKYfHBrYl5XV1lbYWlq
cXZ4eYWFhoaDgXtoW26Pqaqwv7y8vsfFxcS+x8fDwbq5ubGgi4aLiIN/fHNuaGZpcXZ8dnd0cnx0
Xk9KRkZDQkE3MzIuLyUjJi41N0tGQEs8OT1MaoyNlJqaoKGnpKSmqZiVkomGjoqPlZygpqGorKWm
qKqzxdTb3uDj4N/g3Nrd3tbItaShs7zFyMfHzMW/5/vHo6ClnpuUj5KXm56bnpulqqqxvKydmpGN
hICAhoyLj4uEf395fXl0amlraWdreoCAd3t6e3RwYVROUF9gZGtrb3Bra29pa2ZbVEY4JygsMTpH
Xm5vcHF0dnNtaGRgWVZXYGBiZmZkZG1wYmBfX11gWVNXVVdZU01COj5Oc5WPj5SYnaSjm5qXm52n
wtDR2t3f29nb29bX1c7O0MS4tbm6s7i5t7Czs7KvrK2urqytsby5sKGfr7HC5LuhpqaTemV0g4WI
iI6JhouMjIaLf3t8cWVZNzAsMVSetqGfpqmy0bOorLOztbqvn5iYl5OKYlRXYmZiZ2tpeYJyc3Z0
d3R4e4CEhpOMi5GSkpyeo62ur7OzjoyMjIuNiouPkpSXlpGUybyfoW5eYmVna2lrbXJvaWhfVEcq
IiEiIy9CTFRQUFlfXl1eZWZnZF1iZ2FPKyAlKy8qLjtASUdNVlZSU1dOR0ZHR0JAOzEvJiAREThO
TEtQUFJVWV5eZmJlbWBiX1ROPi4rLi5CYldcaHd/hIiYoKy/t7CqnJaSj4uGgYB0RzUpHRoZI1d5
d32BfX2Bf4KMjY2GhIaDhoaJiYWIho+VnKesrrK3sbCqqq6urq+urrOyr7GwuLm3uby4ubebmJyW
kZKOi4N3g5ejrK2op6itucm3qqyvs7Wzs7OvqrfMzqNfS05SYHJ3iYaGfXlza3F8d3h3c3BwcnJv
c3Nyb2lmaG1rcHR0dHh4a2dtemJWU1lQREdYcHJ0d3d4c3R4fHp9e3RqYV9dVkAjHDOGgn2FhYiL
ioyOjY+OhGtOR0dHSUxQVTlPe7O+wMS+srKwuLy3r7W+sqyooZyem5ebm56goJ2hoamusbGxs6+t
rKGVj4KElKaqrqqwt7aws6qmoZiKgICBgoibpaehoaepqKilu6echXt7hYmKgl9VWFteX21oYl9e
X2RiYmFeXFVVXmZ9ipWhpaSkqq6usq6qpYZlXGJnaWlnZmRmYl9iZGRhZmdrdHZ5d3d/fX1xb3F4
eHFtZnB8dHRzb2FXVVhYVldbWFJTVFRWVFhZV1lZWVVYVVJQWFNEOj5NUlNUWWuGmJuYmJuen56g
oaajnKOlpqSfkoV8eIN4aWt9i5ONlp6coaGhpqOfqKausqiqsLGzt7i8s7CgjYmTmJuYkY+Tj5OV
j42OlI+UmJicoaSmrKqurK2VjpaTmJSSjYuIhoRzWU9LT1I+NDI8RDg1NTU3Ojg8REdMV2JqcHB0
eHl/i4+Fj5OSkpaYl4+LiYR8YkU5Nz1MXW1ygomPl5qlr7W+wLmxrKicp6WOgHt5dGJbZnF6iZyq
rrGzrK2op6WlnqOai314d3t8eYGEiY6PjYWGk46GhIGFj6Gop7Gwrq+ztrawt6+tqaGhoJiTkoyG
jYyKiIR9f393gZiloJGPk4+PhHx2cGqktZeKjIyGg4N6Ykc4QWSMm5yhpqOhqaWhpaGbmJial4uM
g3lxXlhYWV5naWtnZWttZWJmbWlpa3F3enZ6ent9gYF/hISFiIiNj5KSmpeasKWhn5qjpaGjqbfE
vLWzsLKzuLi2s6qjn5ial5eVl5iTkY+PiHZmXGmDp6CTl6CenZqbnpqSlpKNjISCe3JHKiEiQYaa
mJ+msba1s7exrKqmoJyXioWIbUQ+QUJHUlVecIupsZyUlZeXnp+cmJaGd2dQPjMaEQgGCxUsNUBC
RYbUpE9HU2Z0eYCEiZWfpq2opKmooZuVlZKKhoZqaXR9hYqPkpGWmJeaqrCwsbC5vLe5trm6ubm3
tba3t7GztrWzqqqspqGOeG+Twn9ygI2hgXt9fYSJiYqOlNCphIaChoWGfXNpbXR9gXx9fX2FhIR/
g4KAfYGCg4SGhpG1qoKCg2JSRjUzMzc+Q0ZJPDMyMjpER1BdVllbXmFbXVxWXFdOSTguLDdQYm57
hYN9fXp4gImGk5WXiHNZU1hfZmptaWlna2hugqmGe3uAgoGDhYaBfX10YFBPYmJlcHR9kbXEwL68
ury+xMfEwMXDuq2RiJKYn6GmoZ2VjoaCgn1yaGJdXmJdXVtYVVRQUlVUUlZbXVxfYmFfYV1eW19i
a29raVxUUlVdZGVqcXR5fHt6enx/fX+Ci56ppKGbnJ6hoZSNj5ammIuSmKGzta2vr6mkqKmfoaGe
n5yY5NCGfYaYlZ+hl5eYmJiXjo+Li4qIj5iYufvJjYKBhYZvaHR4enx8f4mIlZSNiqeacWtwbm1r
dHd0dnmAf3l7eHp3dnR0cHd2c29rbW5naWFcZnBvdHd2enFycWtkW1lNMjlQX2RhX11cYnR7eoKG
iJSniX2DhH1/hIiJjIiLkY6WoZqPj5KTkZOPk5KPmJqXmqGjrq2oqaylwbmglIl4cnBra2leXllc
ZW5wbXN0dHRwcGtna3h8fX+DmIl9g46Vk5SanZicpaOdnqGjnZiWl5eRlZqYjYuKiYWGiIuRj5KP
kZeWl5aXnp+YjomBeXp0V1NZTlBzeIR8gIaJho+PkpSSkY+Pi4aKiX12bV9ZTkxWXV9gZmptb3R5
fYWEf4B/fWVWb46kqrGzusLIw8PBwsjMx7++vLyzsaCJi4yXl5OKf3l0a2pyd3x7eHhzeHRrXE9K
TkdBQ0I5MSwnIR4jLjU7TEU6OTo5PUltjY+UlZedsayhoaWln5qViYiajo+XnaqypqitqqSjrLjJ
1t/g3Nvg4t7d2dnXy7asppWhsLzEyMrIxdny/tKho7GqmJOSlJaan6GlrrCzuLm1sK6ytrKhlpSO
j4+Ni4iFhX1/fH10cHFzc3qLioODf4CCgXxya1lZdGRiaXBta3F0dnBrZFtQSTUqKyo3QFJncXSF
fHl3eXRta45yVE5WX19hZGFiaWdhZGJhX1xZXFdUVFRQS0A8REtqhJiWk5ygmJykn5qYmLDR1trd
3dvb3uDf29fX0s7OysO6s7WvsLK1s66tr7Kzsqyss7O2uLmwqqmkp627sKakm5eMj5eKhYmNjZGS
j4uOiYZ/fXRvalk7LCs4ZpGko6Oy0bOqqK6qsbe5t66koJ2blYlrW11gZ2draW54fXZ2dHd6fH18
g4OIjIuPk5eVm6Ojp6qysa+Pjo2MiYyNi4+KlJaPk5ejo495W1thYmRoamt0dIa8i2hrX0xEPl5c
UE9LTlVUV1lbW1tiX15eXllSQjAdGh8lJSo6cVlHRExWVVJQTk1LR0dZWzgwKiMjHwwPLEBGR01Q
VVVbZWdwbmprbXZ6W1VJMSksN0VZZ3SEhpWhr7a7s7KxrKWdm46Nk42Fg4BdSTMjGhgzdHdye31/
f3yDhIWDg4N9fYGJl4WBgZGLhoaMqa2lqLOqoaqqn6mlra+vr7CsrLG2t7a5ura4saGYl5eTjoqC
f29rgZakrK6urqqwsrGwsLW2ra6vsrKysb+8qJigiWtiaHuBhIB9eXNwcHBzcnR0bnJ0cG5wcW9u
bm9ranJvdHd2eXRydHJ3amVZaFJDPFZxdHZzdHp6eHt8f3txa2hiZnRzYU01SWR0dH2Kj4+PkbXI
mIB0a0xGRUpMR0U3R3Khubi3t7i7vLu5uLOvsrGzr6ignJuYnZubnZ+ko6Glqa6zt7W2r6enoaGM
f3+JmKG6urGxqayvqqSqmIN7eHh9o6mcoZ+kpKapra2nnYuAjIaFk4FrT1RZW1ldXWBgW2B0jmdi
XVlVQjU+V3GDk56hpKalrayvsqysmHRhYmhrb2lmYWJiYmVmYmJnaGtvcHZ3eH2Gl4J3enp3dHRo
aGtra2ttWVJUUFdYV1lWWFhVV1dYXFdWXVldXllSVFRQUFRgW1VWWV9hdI6Yl5WSmJ6dm6ClpKWk
pKimoaGYj4R6e318dHmJjpSXnJ6bqKShqKSjqq2lqrixsrO2trC61amJlLO4qaSelZOampeTlI+T
nJ6kwqmanaaqqq6xrqqbnJWPlJqbkaGziXBZT0VKXkc6NDQvMTc1NzQ8QkRHT1BXYmtrcXt8fIaJ
k4+GjJOXmJKPj4uGgXt8aFI7NUVVaYult5uWp7rAw8XEvLiysK2sno6DfHFlW1JecYOPoKitrbCu
rqqlqaap182TfHF3gYOBhIWGjouJjY6MhoSJiIqbt6ipuLOws7mzu7a3sKWkoZyYl5ePjIyPj4WE
gX12dHqDlKGflY2MjY+GgX2RZmuJj4qIioOCgXhcQj5Nco+epJydp6qloaayqqmcmqCTkoZ/fHBh
V1BTWWhzZ2JgZ2ppa2trc3JzcnFzd4B8eoOEg4aIhYWGjI2PlY+WlpOanKGhoaGptayzwbyzuLy3
tbO2s7Gxt66YlpeYlI+PkZGJhIR9d2VeaHSXnZKPk5aYoZ2cl5SVj5yMgnt6cmhHLyY1jJqcnKWu
sbW3sKyup6aln5iYjX9tRTtFREdPWWqClp2anZiWl5ucnZyPfW9mXEs4JRMKCAgMDyM7PURJebNd
QlBieoWDiY+VmJqeqq6hoJ2foZ2PjoJ6b2tweoqJio+Pi4aNlKaxrLCyrrO2t7a5vLi7u7e4urez
tbOus7OwqqqkmJSluYF4a3F4eHd6g4uPkZSTmKOYv6iBf4OGhoSYemJobXR7fYCCeXh8fYGGhIB/
hYmIi4yOjJOVjYZ4ZVI+MSwuMzVGSlI+KyojKDtHRElSU1RZX1tZWVNQUExUe0crKjRGZXSCgHl5
eH2Fjo6Sk5iPhnNgX2B2d2hiaGlmaW10dHJ3dHZ6e4GKhHp5dG5hVFJSWWJtdIScv8G+w8fDxcXL
ys7JwsTHwKqqpa2xsqqjoZ6bmJSTjo+BeWlnYWJdXllcW1dUT09QVFdbXmVlYF1dWVxZW2JqaWJh
W1BJRE9WWGt6cHFzeHp2dnZ0eoqqsK6soaeqo5+glZSUjI6XppiPm7e4s6+ln6CeoJqYlJeTj4ul
t39weX2Ju8WRiIuRlZSSi4iDf399i52bx6+GhISDjIRub3x6fYCFj5WXkoyIgXdybmhrZ2twdHh7
gX99g419fHt2dHuDeW5rc25oYmFfXF1li6GBdHp4dHR3c2tmZFVZU1diZmJocmtrd3R8gYaJjouC
ioh9gImPi42PlJqampqdm5+cn5yam5eanZuYkp2mvLW1r62uqqapsKqlmo+IhoWCgHNpYl9oaG9u
c3NxcnZ0cXKBiIaKg4GCg4CGj5OSlpynoaeqoaGgnpiYlpSVmqeVlpiYlIuGgoWGho2nmpaUnpiV
lJObm5eOiIB0gpZicnNPUmB2sIVxf4uMkpWalI+PkqOWioaEgHJpX1NLPkVZYFlfZ3J0dnd7fYF9
fYGIYlBniaats7W6v7zAv8DEvsLIxcK+uby5qpiPmKChn56TioaAdHR0cHR6enR2g2pVUEtHS0pK
Pjo1MCMaFiM1Mzg8PDk7PTxAS3GampKVmKGnpaCeoaelnZ+XjYuKj5edpKqwsKiqr62qs8XN2+De
3d/c393b2tS8qqqvj4ukt77BycPI6f79x6aksKmSjJKbl56enqy6urO1ubu6t7m2sq+up6CXj4+X
rpiKhYmGgX15eXyFkZOOi4yGgoOFhn94ZVdiXGRrbm1wcG5vbmdoYlZJNywsMzxCVmdtfI59cW5w
d3RremhZVE9Xa2RdXWBmYVteXl1WWVhWUFBSTUdAOjtATXCBjY+SjZOWlpuPk5ihtdTV19/g4N/c
2t/d2t3c1c7RysO7s7e3tbe2uLa1tri3r66vt7i1s6ynqqqtqq2oqqmcnJOOjo+SlI+Pj4+Xj42J
iImEd3JpXjwrLEV2jpihpay1s7Ows6+xs7GysrChn5uVjHRYWV5gaHhubWltb3R7eHh2en2DgIWG
jJKVkZOaoZyco7CwrJaPjYaDhpGYko+PjY6Rj42Rk4hzimhdX2dtdp+akYyGf32OinZydHNuWVNZ
WV1bXVdWXVhZVlRUSkM7MRweLCIjLD1DQUlJTlJTVFZQTWJWS0k+OjAoJSIXBAgsPkdPTVBSVVlc
c4J4d3dycGZgYW9cOTpNZXaCkqy7uK+tqq+7t7GqpKGfmpKTjY+LfXJXW1dSSTBZcXeGhoB9fXx9
hrmWdnR7f5GWgIqYiYaIjI+OlZiet6SbmJqxzqmbo6eprKyoqre1ubm8trXJ1qGPl5iOiYOBa2Zw
gpWhoaalrLauqbKusbO2rrGwqrG3u7qqpaOahndtcnR7fYF/dGhobnNydnp2eHJ0eHN0dHJycW1r
a21ra3R8gH17e31zZV9SR0A4VnByb3N5enl4d3h4dHBub217g4GCfXJueXp0d4CBio2PmI+Df3pP
RWdqa3tfX26bqKessr6/vL65v8Ozs7vRy7GbmqGfnJuWlJeYoaSYnqSqqq6yurWtra+poZiFd3+K
j5ijrsKwpKGhn4uJgnh2d3mSp6ynoaShpqqsqqSMfXt/fIiOdl1PUFJVWVdZXFtcWV5fXVlVXE83
NTVDYYaVnKGkpaapr662sa2mlG5gZWpoa2tnYmJhYmJgYmRmaGtzdHx9gYWIe3Z4eXR0d2tmaG1t
a2BST1NTUlJOT1NSUFZdW2JqcXRuYl9tWU9OSUpbZF5XWVdbXmR4i4+Rj46UmJibnp6jnZ6hnp2e
oaCYi317fX+GcnSIj5GXmJukoZikp6Oop6mzx7yyqrOzs8XpwKaqrryzqKGhnZufnJSTj5eUl56h
paGgqqeloampr5iSlo2PkpOPko+GeWJUTEVEPj04NDQyNTU7OjxCR0lNU1lhb2tudn99iZGLj4+L
iZejk4mGg3+Ii5O/xHQyNVBrrfXDj5euvsPFy8nFvLOzsayooIt5aF9ZVF5zhJehpaqvsbCurq+q
oZ+cnIuCfXuChYiJiYyRkY6Ni4+PhoGAiJyyr7WztbazsLa6urixqKOmoJqRj42LioaEhYGAgHxy
aXqRk4qKjIqIg4N9cmFSYIONj4yGhYF7fWVeXnGPnKGvp6Snoaepo6qjmJWalo6TjoZ4cGBPSUto
queYd19kZ25zbm9wc3R2f317hIqBhIOEhIWJjI2Gi5qRjo6Tm5qYm5+hobfBs8TFubO5uri1s7Gz
traxpJaSj46PjYyLiIJ/fHhwZGFpcnqLmpaTk5Wbm52ako6PjImDgH15cWJGMDFSf5ehpq6strmv
raqoqaqhnZ2TgWhDPkFHTE9ffY6bm6Whn52er7+hlHFnYlxPRDQgEQsICAoRHjQ+QkdOV1NTXnqG
j42PlZuWnaOlpqCfo6+nmpeRiXRraG90e4aNkqieioqVp6ynqqqvsLGxtri3t7y8t7OvrrO1sa+y
sayopqSXi315bWlqcnR6fIWLj5qYm5ifoZeJhZ+dfXh8gX1yZ2tvd3l2en16c3h9gYCBf398g4iL
jZSOlJWThXpnUD40LCouLDAvKyghHB0nPkZGS1BQTVBWVldXWFdQUFJfRjs3OEBOaHZ5e3iJiYaO
lJqYk5ORinpoZmJiaGdqZWFiYn2ac2Zxb3Z4d3x3dm9lXVlWUlRiZ3F/jaXCw8LFxcXCwszExMjH
xMXFvLCsr6yvrqypqKGgoaCfnZiShnRwbWhraWtwhGJUVE5TVFdbYGJdWVhXWFdZYmRiX15TTD0v
MDVCWXdqZmtqaGtqbnN5k6OqsbOqpKGmpaSVmKqOiJO4n5GXqq+xr6mhnZWSj4+OjoqJhnp6fXZw
cXeMlIaPjpSOjJKOhYSAd3N8hYuPk5KRiYWGjHtwcnB6hpKcmJeYmJGIgndvdIJtaWhzgYaKj6Gt
ro+DdnJxeYp6cW9pZWVfWVlianB8k4CFfHR2fX92cWplaF9eYWRpZWtwcHF5fYKChIuIiIaIg3+B
hoqUl5iboKGhnqGcnJugoaGhoZ6gnqCfrL7Duqqosbazqaq3ta2nnpuWlJaTjXxwZ2tqa3p5b21w
cW9ye4WChIqUiH19fH+BjrGlm5yhoaGkoZ6doKGbmpahvJSGj5qVkoqAfYOGiI+NkZeUkZWUlZWW
j42KfXBrZVxeVVNUUGdwdHZ9f4iPjY6Pj46Uo5ONhoB8fW1iWUw4MC88T1xpa294eHt/gHhyb2pV
WWqDobKzub/HycPCw8XFxMO+wb++v76zp5yhpqGfoZ6alYR/eXN0eX16dHuVcldSUk5OTktHR0Eu
JR4TGCsyOT5QREBAPkJScoiNlJSbqq2hoKGqqqGgmJeRjIGFmqiop6mssKyqqrW1vs3b393c3N3a
3tvXzbeqppF8gJSsuMXFw8DT4Muvra6noJuRl6OcmJ6hsbm6tsTDur68t7m8ubezs6GRjo+mmI+F
iomDfX2CgZudmJaSkZWLio2Jhn9xZFlcZmppbW9tcXFrbmJZUE1FQz46PUdcaHB2gXp3cXR5dGVi
YV5XVFJZVllZWV1eXVtgX1hUVVJSUE5QTUQ+PkVTcX2EiYqOjY2MkYyLlaCzxdfd3ODe4ubg3t/i
29bZ1M3MxcO1r7KztrOusbi1sbCytbKvs7i8raChrKilqaGjoZuXj4aFi5GVmJ2zlIqOi4WEgoWB
dG6CVkw+UneOlp2hqK6vrLGzs7G3s7Czs6+hmpWfjFtZWWJ2eGhva29xcXd6enp9fYKDgIaFjo+U
lZKcm5qorK2oi4aGioiGj5KTj4mIjI2LjpWSjX1raF1idIqVj5KOjo+PjomDhoaIhX9wYWddWWBh
WVxZVFJTUlBHQDs0IBgZHig5PUFFR1BXV1RbWVlWU0xJSkc3LiUiJSELByhAT3FeTk5PT1tzeHd7
fX+AeGthWVlZaHOAkqqwsLOurrOztcC7rqijn6GcmJWPiIaDgmdST0pAPWJzhJGOhYB9fIF5eHRz
fI6AenmGioGChICFiImPlZOYnJySmKqgnp6gn6Cvvq2hqrW5s7Wys7Kjm56bk5KKhHpnZ3B0iJih
pKixraqpqq66t7KssLCzsa61sa2tr6qWf3Jxd3h9fYJ7cWtrcHR3d3p7eHd4eXd3c3Juamdqbm9w
dIaKiYmIgX1wZVdMPDhVZGtxcXR3d3d4dHaBc2dpdoGLjY2Sj4yOeXR2eoGJg4CEgXl0b1tZaXBz
en2qupakpq2ztbe5t8Xkwa27xcS8vKiTj5WXl5GSkpidj5WepqqprrOzsK+zsaqpqaGWe4GIkZyh
oZybmJaTiHd0c3N0dIWcpqOhpKSlqaaqqYp9fYB/e3p2XlBSUldXWVtbWVdZWVlcWVZPNzAzNDth
hpGXn6CkrKytsLGurKyhimRha3N3eGtgXl1hXV1fa3BnaG92d3p7j496joN4dnZ6aGRiYmZ0WUtN
TE9bbmtnX2KJiIJ7goKCe3h5d3twXVJMUF1bW15fXWJiZnKFjo+Plo+RlZ2WlZuWn6WdnaOstZ6J
gHt7e3RrcX2NlZiYnaCcnqGhpqmpoaWqrLGzuLetqKytrbGzub63qaGco6GmpqafmJahoJ6gpaOl
oaSsqKaspZSSkYySk46Pj4V8aVVQRUE+QDw7ODc1Nzc7PkRHTExXWWRrcXN3gYKPj46RkoyKjpOP
hoCBgoGJl8vvwEksQ2GPs6qdsby8u8XMxcPOvq6vrK6omHtvYVVKW3qPm56ooKSqr6+uqqahoZqO
jIiBgIWGj4+NjI6Si4qKjomDhIaJkaO4wri3uLa1usC6ubewrp2XmJaSjIaDhIOBgISGiXxqZ3+K
jY2LiIOGgHx3ZVtffZSSi4mFgXx6dHpmhqWhn6Glo6GloJ+gpKObl5iYlI+IhYRyWUZAU2KX98Vi
WWFuc499bXB0eHh4jY99fX2Cg4OGhoyMi5GSj5GUlZ6gmJucoKGlpK68xMG7uLy+wLu+t7ezs62m
lo6Pj42LiYmIgn12ZF9kZ292e3yDlZSXl4+cl5GMlY+JhouGiH98cF1AOU55mKGhrK+zs62tqqml
nqOej32Ff0kyOkNHTmKEk56kpJ+eoJqfpI1rZGJgV0o0IBcZFQwKChEgNThAREdqYllyhY2Plp6c
mJicn6mknaCfmJiYk42Nhmtqb3l/g4iVk4+SlJanqKaqtbq1rra3ubW7ubO6vLyzs7O2srOys7LE
rpOEdGZlbnR0eIGJkZefoaGhpKWbl4+JhIOBf3x2c3BvfXtxc3RzenZxc3d7f3p9gn2AhI2NkZWW
kouGeWlWQjQvLCwqKisnJiMgHyA1ODpBSlBSUFVZVFhZWVhYUE5KSkZBR01ldnl6epiPiY+YlJee
m5WPiXNmZWRlaWtrb2dcbnRha29wc3NyhISJdGJgX1xZWWlzfYaPpcTDxMjHycvLztfLxc7OxcTF
sqq1yruwsrKzr6ymp6yppqCek4mUhm5re3p9bl1YVVBSVllZWV5YV1ZWVVZdYl9WVU0+NScjJi9H
aGVfZmVkaGdocISVpK6xrqqnpaemo5ePkomGjI+Pl5uhsrWloZ+cj4mJi4mKhoJ8eIN4bm1ranKN
fYCOioyOjY+GhYR6hXmEj42Sk5SWj4uNhntycXd9kp+gmJubk5GFhXtzaWVncIaUn5+lqKqnn5x9
bW9waG1oc2pbWFlbYGl4fYKAgoJ/fX18eHhycGtkZH1rZmZpampudHx9fYaGhYiLioiCfIiSlZKY
m5qen5yYnZqfoaWjmpyho5qWkpalt761s7Kzs66us7qzrrOwpZiVmJiOj6h4Ymppdnl0b2ttcXaE
homJj8Oqf3l8gImWqqOdnZ6foKigpKakoaGgvLCVi4+Vl5OLgX99fYqKjpGVlZiXlp+blpGSjo+C
a2ZmYl1XU1RUYGJmb3eCiIuJjYuPj5GWj4aDf3p9eGtiVU9AMkFEVF5oa3Z6eXR4cF5UUlJca32T
qru6vMXFwL/Fx8TCwsHFycK6uqiqoaSgoaGhnqChjn18dnR4dHR2c25kVk9QUE5HQ0FCPiwlIBQP
GScwNUJBPTg6RlVufYuPlJigoaqopamnpKOloZWKhYmToKitsLOyrqqsr6yzydPa29rW1dbX1sm5
qpuRenR0fZStvsHCv7q5rq25sKSgoZibnpeepqGltsO+wL68vLy/vrq5srWzqqSYlZSRj4yKjJ+G
g4mMnaGgo6CbnZuYkpGOjINqXlxla2txa2plZ2plYl5bVExbXEdCT2Bqc3J7fX10c3dwcGlpZWJX
UlBNUFdZXF5cZ19bV1ZTU1BPUEdDQkJESVdqeH+JioqNhoiIio6ep7jR29/g4ubn4+Xi3dzd3Nrf
2tHOyL6zqa+zs7WysbO1tre7s7a3xbyln6mvqqajpKGelo6PjpGSkpScnqSVj5eOi4SFhIF2b3d3
YkJhiIiSnKShpKqqqqezs7W2s7OzraSalpqBVlVeZpqjcGBkcHRucnR7eXt7e4KEhoKOj46SnJyc
n7CgnqOLhomLk5ePj46Ojo2LjIiNk4uMdG9va4aWj4+Uj5OVj5GUjpiTj4qLi4JtXmBfYV9eWVZT
UE9HQDk1ODk8GhEVL0FFQUJJUlVdUFJWVFVQUlBPTkAvJRoRAwEMKT5GTVRUUFVZYnd/f32Dg4SC
fXxxdHaCqrquqaews62yucW+ua+xsq6mo5qfmo+IhH13aFZUU01Na4SPkY+Ni4p8d3Nta3RwbW55
j4Z/gIWBhIaMjIuRlJqXlaCso5ianJ+fn6CkpK3NtaiqsrOsoZiYmpSVjoh/c2tmZGt6jaCho861
oaGpr7Wyrq2vsLO5vLW50bypqKOSgXlxcXZ7gIJ4cHB0d3l9eXR2e3Z2eXN2cW5rcGtranF/hoaJ
joqIiYN6aVg3NVNueHRzcHR0dHR3b3BmZnqFjJrEmIWDi4yGend6fHx8fXx6f3BocHh0dHmGj5aP
oLO3srC1s7a4ube1vL7H2cSzraSclZaYk5GVl5WTlpqdpa2xrq+ytrOzr7Ctr7CkfXuDjY+Wl5qU
jIR8dnBtcHBwfJimqamopqmusLOomIR8gYN9eXRxUGBYUFBXVVVTU1ZWU1VYWUk1MDI4R3aIkZah
oKGmr7Kusra3rqmYf3J6e3x5c2tkYmFeXFlAZ2VpcXR3dH2AgYB/e3t7cW5eWWBmc1hOSlRZZXqB
gomOho6Gg4aclYJ9hY2GfYCBf25kYVtVWVtcYGdtd4iIhIyOkY+Tn6G4vKGYm52sqZiYn5iIgHp4
dG9veZG3oJOYmJ+koaGkqaWkqqqtsq+vsrOqqq6tu8TAwbevsaqmo6WlpKGgnqSqs7OgnqWlpKSp
r6qkmJKSkZOSjo2KhoJ5Z1NHQkJARURAQzw0NTU+TE9QWV1fa3N4d3+Gio+Vlo2Kj5eYkoaGgYN9
fYWFqODFXjVHZnh8i6q4u7+/wcHDx8XDwsi6pqSchHRnU01bd4uWnKOlp6alpKilpqGYkZSPiH1/
i4iJlpKPioyPj4aFiYmBgoWNnbG+ubm5uLm8u8G3sKqon5iXk5WPjIqChYWGiYaMn2VGcn+AhIWG
hISFe29tgHt3hoyMipGNiYKAbm19k6Cho5+doaOkoJ6hnpyXlJWYkouFfW1ZRz5AR2nf/JpXWGJr
bnBzeXR0eHR6enqAmIZ4fIWGhomPkZGMjY6hnJibm5yfm5ioxdHKwb64vLi8uLi8urWzrqWXjImK
hoaFgn14b15TYW9ra3B7kYazpI+IlqWPi5KRj5KNjYuLiIKWnlM6UJSonp2jqaajpaOjo5+ek4uG
gnl0TjpBREJGXYKKj52cnaOampudkWtnf2JVS0UmGhwcGhYYHC9UR0FARUtbaHqEhouVkpeYn5+d
npuemJiYm5OTjYN9l7+Ga3N8hIiKi4aMkaOnqa+vtbO3y7Oxsbi4urW2u7y1uLavsLCxs7CknIp0
X2JvcHJ7hZicn6ClpKOhnaSciYCBfX92dHiGd2pqcG9yeXZ4dHhydHN3fH94eIKJiYqPlLKjioV5
bl9KOC8wMDAsJykvJyEgGh4sOT5FTk5SW11cXGZfXVtSTUVFSUxQV2Jtc4+XiYiSkpOPkpiYm5eP
gWdeYmpqa3RnX11dXFlhb2prbWp0e2piX2BfXFtfaHSJiYyjwMjCx8TK0c3KzszFzs7Ivruzr6qw
s7fCvLezsbGwtbWzqKetoKCTj4h9cn+Xc2JYUE9WWVVYWVlUVFJVUldbW1VMSz4pHx8iJTRKWV9n
bmViYmh0jqGqqq6qqqqoo6GooYiAgIOEiJ+qnZipta6nn5eShoGAgIN/enh3dG9pZVtbXWludISM
ho+SjYuKgmtwcouSkZaanJicmJWmkW5qcnaKlpualpOUk4uFgHxwZGuEl5uepqiqrqqloIVwbW5q
aGlualhXYWRwfIGCiIiGhIOAf3x6gXZwa2JeYGJrbXFra3JycXuEiYaAf4B9g4CBiIiUmKCboJ+k
n5+ko6GhoaakoKCgmJWYobPFvrG1trazsLO8xbyts7GoqqmmoZaRi3ZraG1tdJWBaW10gYqNj4+T
qox/eX2AipWempucn5+an6Woo6CfoaHBxZ+NlZaclIZ/fHl8gYKJlpyUlJidl5KVi4yJhHhra3pq
ZF5qZmJeXFtlcHmAiImJiY6Ni4yPjYqCg4WCdHBoWVdZeGFWXGVqcnNzeHRiVk5OWGZwdIOszsG4
wsK7vMDBwcPFwsXFv7y3p6GhpKGhpKCdmp2Yf3JxdHRxdHZ2cmRVVFNQTERDPjk1Ih0eEw4PGCMu
ODo7Oz1HVnB7hpGVnJqepaSmpamnpaShn5yLhIKVsLWopq2qpqWfo626ztPa2tTV19TIvq+kg3Fr
eXJzhp6qtba1ubetqKiopKinnJiYmJyfoam4vLu7vMO/w764vMC6s7KpoZyXlI2Mi4uPl42Fi5ij
qKemoaGfnJuam5uTi3prXmdlX2RhYWRiYV1ZW1tZUlVPSktPWW13dHl7dnd2bm5rZWJiX1lVVFJT
VFlhXV5gW1hXVFZVUFBMTEVASllPUmZ0eoOIjYKEgYCAgo+os8XX4N7k5uPe3t/i4N/Z19zW1NTJ
x8KlqK+1ubezs7Wzs7W1urKupZycoKGhoaapqKWfkYqIk5iVl5acuKGPiIqNlY2GiYSEhot9Z3J7
hZWfm5ujqKiqr7Kysra7s7GvpZeUjmpUVllfcHJoa2hrb3FubnR0dHl6e4GGk4+Kj5GUl5eanJiW
nYaFipSolI2Nj4mJhomFjY+ejX90cnedoY+Vk5GSj5SXlJOXmJSYnLychnZoWFxdX2FfX1hPSkNQ
RTgxLicmKCo0RUlCSlNQUFZQWFNTU1BPS0tHT2dHEQULGR0sQUlHTFRVVFhugHx6hIZ9gIaCg4KA
hJO8vrOzsbW1uLfD3buytbOuqKijmpKRj5GGf31pXFlZV3KWlo+Tj5GPjIV7b2Zmbmtman2DgH99
f4J/houLjYyWnJubn6Gcn5uYm5qcs9Gooaqtra6usbKqnp2YlI+IfXpnYmZmYm6Fl5OTo6exrq2o
sK+xs7aurrK2ucLZtaWkqZ2PgnRucn17f3hzdHZ0d3h2eXp7e3yAenZ4dnBvam5wd3+JjI+NjYqI
hn+Bako5VGR0dHN0dHd7enRra2p4hYySlqGYi4iJjImCd3t7e3p2dpuYbmFrd3qAi4mLhomLn7Cw
s7i7uLK4vLy/vMS/uLi8saGjlY+PjYaAhY+Xlp+kp6yvr7G1ubOwtre1sa2Jc3yEi4mOvpiBfXN9
jGpmaW1vhpympaekqqyqqaWUg313enpyaWpZUFVWUlJPVFhUWWJvc3Z/d25iYHyCjY2Rm6OkpKSn
rLO5uLesp56ahIGEioiNhnqAa11UVj0rRGRqcHR5f4GAgn18g31vb2VbXFZSWGlyfYuFgH+AgYKN
wJt/g4mKjouJhYyOiYWGiYaEcGhfXl9iZWt/iISDhoyPjIuPj5uflpiYl5icpLOlnJKMdHhvb25u
ipiYlpu3qKGhqKmjoaetrqqwsLe5sqqutrrAtbu4ura1raSmqKipo56gpKqwp6Gho52jpaSfpaCU
la+kjIyNjYiIfXRxWUpBPj5APkdxTzEwMj1FTlBYYF1rcXJ8fYOIi5SRjo6Sj5eMhYV9fHt7d212
g3NbWF9td3eBmLXAwb/BwcjMx8XUxaqmnZuMfWhSTWGCj5yfnKGvwKahpaamoZyXlKGnfHiDipST
ioiKhoaGhoqOhomGhpGYpba7ubu8vMG/ury3sa6lnpiTk4uIgIKFg4OGhoaOckdHXHyDf4CDiI+P
gnZxdHR/hoaKi4qCgZ99boWbnaSmoaGknZ+goZuUl5iRlpSMioN/cF9PQkBLnPj+u19bZ2twdHdz
eHZ5dnl8eH2Bf4OFg4iJjIyPj42Mk5OUlZaam5+joa/L18S8xLu+wL68ubm1t7Osn5iYlYyLjo2P
g21cUFlpb3R7e3d8fYOIi4yqk4KJi42Mj5GVl42GiIBxW0dNZHuYmJabnZiYm5iYloqNjYN7dG5U
PTw+QUZVeImPm5+fn6GhnJWPhGRYVFNPRTUlISMlKTdBR0RBQ0VKVmt5ho6PkZWbmp2doaSfoKCd
nJ+cl5eRiI3v/td/anqEhIOGioSJnqqqqq+qrbKvs7O2uLW4ur64ur+5trOzs7W2raWbhnFZWWZp
b3uLnZ2fpaWqqqqloZeIenl7d3J0d3Z0bWZmbXFzdHZzcnZ4e397fH2DhI6Oio2Xm5aPhnxvX0Y1
LzMvLyspKSkjKzEuIygwOENSVVhVWF5eaGZiZVdMT0dHTExcbXN4iI+NmpORlZeXm56Yjol9bmZl
YmR0dF1UUFBQU1h3aGRgYmJhX2BiZWFiZmhudoiYlJy4w8XJzsXLzMjKzsrNysXCwrOur7Wzt7u3
uLaysrOzsrOzr7CmrJ6amIuFgIGGhHleUFlYVFJTWFZTUlRYXV1ZVE9AJhkaKTAsNUdXYWhxcWdl
aoGRnqqur7CyrKyjoaOUenh7hYWMvr6Uk5eaoaahkYuFenZ6fHl3eHZuaWlkWVBTX2JwgoaJi4mM
jIlzYmJ9j4+Pj5ianZ+bmJaIfXRtboWSlZSNjYyOioiLr450f5GXmqmvra6vrqmjknprZ2VgV1NS
VoSgeHF2e4CDhoaFjYuEgHx5dHJvZ2JfYmJlbnNqbnNubnx9fHx4hIF7gIKGi5SYnJ+hoaGem52e
pKinpaWfl5eYlpOkuby7tb+1srW4vMHBt7a3sa+srLaelZSSfWtkZmuSvoZmb4CSl46TmJ6UhYJ8
eH2Gj5WUlZ2gmp+fpKSfnJybnJ6ooY+Mi4ZrYV9gbYOBg4ulmJSVmJWSl4+OlZ16a2pmcWtta3t4
cGhcXmtyc3mCiYuPlJGOj4uMj4uJhoR7eXhya2t0amlrbXR0eH+Fgn2NeWZoeHZ6gpStusK/wcC8
wsDAvLzDwre7s6ihm56goZyWmqCbl5eNem9rcXN0dHZucWVYTkxJPjs1MysgGBELCAgQFSEsOD5C
OkBQa3qEj5OUn6Ghp6mnpqWjo52jqI6EgYuvqaWpwrelmpiaoa+5xdHTvLW5wby6sJ19Z2tuam2B
l6iqp6mqqaqlqqWkpKGempqbmJSfqrG6wcLAv7/DyMfBu7zDuLGllpebl4+TjoaIhYaVqqyqrKqq
qaqnqKGjm5iPf3ReYmJdXmFcXF9eW1tibmFgWFVOTU9caXR2dHyAeHlycHNraWtlXFhXV1lZVllZ
XFtbXmdVTVBOTU9JSUZER0VPXGt6g319fI6fgHSAlam1wdbj5efo5eDf4OLk3d3d3tzW0czJuYCP
nK23ubays7Kzs7OtoJeTlJqepJ+cpKinn5uVjoaLj5abl57IqYqOnp6cnqShoZqcmpydlY6Pr5+P
lZ+lqayvra22t7ezraWkmJKDX1VZYWFeZnBobmtocXNwcnRzdHZ4dH2LhIOGho6PkaGej5aVeYOL
jYaGjo2Nj4uGjIiKiIyEf4W8uZOMio2PmJKTj46Oj5OWmJOWmJKOhnReWV9fX19dYF1GPDk6OTEw
LCgsLi41PD5CSU5SUlBZVFRUVE9LSUUwFA4eMktST1BXVktJUFJZV3CCf32AgIiIiY2KhIapt7W8
w7Oztby5uby8tra4trKxramemJWPiYmDgX92YFtyi5aUj42c1aR/en13a2qCa2FugoF/e3+EhYaM
iIOCjJ2hmrqqnpiamJecm6CnoaqqpqWmpaWsqqihmJGRkYp/aWRqbWhmb3+JlJWWpqykpK6vsLKu
tbm3wcK2s7izr6qtoJSGfHJzen18enZ4eHx8fHx4fX19fYF7dHZ7e3Rzb3B9hoqJj4+RkoyRpo94
a1B3em92dnd5eYKKe3BwdH+Oi4mNj4+OjouIj4V9dHJ8hnpydnBraXN9hYmSkomIhYmXs7Wus7e5
urK4vLy6vMC5tbW5yNaYfIKJr4qDiJGYnqepqrC4uba1s7m6vLevn4R0hoB9hYWJhoN9gH9raGVl
a3KYraihoamlo6OjoZaAdHRzbW5qZmhqf3xWTUlLV3iBfH2CfX+CgYaero+LkZidnqGqra2ysri4
ra2npqSYlJSUlJKnkX1kW1RUNSg1VmRxdnp8gImEf3p9f3NuZ3BeTmSPg3Z6fYKEhYaGiIaFhoaJ
jIyKjo+Wk4mIhouGjoiAfWleYGVteYB9fICDhICJiY2VkpeblJaYnpyfn5ujoYSDem9oa2VrfY2U
lbDBo5efpaGhpKmtpqauu7mtra2zvLm+vr6+uLW1rqqsqqano6iqqq6hlpilpKGdn6Ohn5yXlJGR
j5KPiYuAeW5bTUNAPDk9R0s+MDU6RUxNVFhdXmpzfIKCiIyVlJKLiY6Ng4SEgXt3fYGDcm5xZ2Jk
a2pkcISXrbzEx8LFx8jFx8XBtqiflYuCcllSaIGMlZ2oo6WjqKaoqaOjo5WOhIKDhoqPk46RjIiN
jY6KjI+NioyKiY2ftcTBvLq7vrm8uLCppKCelpOKhIJ9gYSChoiAenpyV05ddIOGg4WMkqOcgXh0
cnR7jIt/fX99eHB3mqilqaWjoKCgo6Clo5iVm5WPiIqIgoFvXFNNSWi47+l6V15panRzdo+Nen2O
gI99doOFhoaFioqLjo+TmJqWlpabnJianqGlp7rOysW/wMPCuby+vLeztbKoo6Ogm5KPkYiBZU9X
ZGhtcnN2eX18hpGKioyBhIaGio6Tk5SVi42GgnReREVdc4CNlI+PlZSOi4yKioN9dHZ3b1BAPTgz
PU5zm5+PmKCfl5eYko+PfWBWVURHTUQsNT1DRkZLTkdESlBfeX+CiY+dk5GSl5qkoZudoaOgnJaV
ko+Gj+L1mGtveIODhoqPkYuSwbipqLWzqaW2u7Wzsre1t7a4urmyrra4t62qo5ySc1lSX2pwfIGY
n5+jp6akpaGhnYx3cXBydHZ2c2lhYWFmbnFtb3J0dHR9hYSAfIWMjI+Pj4+LlI+GeW5fSTs0MC8w
LywpJiknNT4zMjU1QU1YVVddYmdmYmJlal1OSUlOUFdrcnR8lJiNjouRmJePkY2JhoBrYmVpbW5v
allQUExKT01QXF1eXFxgaGdiZ2pqa4J8gYaPn7zExcPDxcPHx8fLxcnFwL68sayvs7m4ur/BvLe3
uriztrKssKOhmo+GiIqNjouEfHNYTElLT1VYUFNTVFRVXVlURioXFhksOjhMXG5zeXyRhnJxgJiq
qqqwrqawtbCknYFkZHOCjJKhnZOVlp6Yl5KMhHh0b3NzdnZwdGtiYGZQTU5bZW99gYKGiYOId2BZ
Z4mTj5aamKCqp6OgmI+KiH1zhpOPi46JiYWCiIaflpKPj5ShqK6qrLCwqqGfimpgVVlTVFBVdoN4
c3mBg4qKjYuGiImIjo56bmptZGJnZWp0eHJ0cHNygIZzcHGGfXZ6hoWNlqCjpaSjoaCem5qeoZ+a
lpWVlJGRlam+t7q6vLivt7e2u7m2s7KssK2mpKGfmLOobmZuf5SejIiYn5ienZycoZyOfXR5nouF
iZGTl5qcoKCmqaihnp6fnJiWl4h3XUtHRUpZaXZ/ho2Jj5WYmJaVj4yKjniBa2ZtbW5zeXx0b2hp
cWhncX2Gi42PlY+OkY+Sj42Unox9eXh5dHZxc3h0fH99g4uPlqOgpY2CiomEipidtcO8vsDAwcPF
xcTBu7Coo6OhoZugmpaempeYmo56cnBvcHFwcXZ0aFtOTEE+NzcvIRoYEQwMDQ0QFyMvOklJRVtz
fYiNj5Wgo6WoqKqqp5+bnaGel5GShoqBhqS6qqGamqChpa2zs7eqpqmusrGgkoR2a2Zrc46joaGl
qa+vs7asramppKGdl5KTlpSjsMTAv8LFwMTFw8G7urq5sq2fmJiSj42IiJWNiaGvsLCws7Oxqqqt
pqWblY+AclZJVllbW1lZWVhTVVxoZltZaldJT1trioR0e4GBf394dG5rb4ZiXGFZVFZVWFlZXllX
XVlPT1BQS0lMR0RER0tTZXR5e3xzlKZ0ZnqYr7e/y93j5+3m5ODf4OLk3NnT0tfXy8Cncm96jKGz
tbO2ta+koZOJiomMk5iVjo+Xl5aYl5SSk5WUkpOVl6SblKSvs6+zubmwrqqwsrKsqKq6mI+YmJ6h
qqqssbGxuLKsp6CYkoh3aWl3gG5ob3BvaWlwb2ttb3t6cX19f5aDe4SNk4+Jm5eJgoaAg4SEhouK
j5KPjYyPjI2NhIWSmMmfio6VlpKPjI+RlZaYk5aWl56bl5WReWdZX2FiYlxZSkA9PDgzMCoqLjAv
NDU3O0BFR0pQT1BTTlBNSkpHPBcILj5NW2plYmZxcVBHTVJWWXKFhoSBhoaJkY6vtaeqrdrWsbu3
sLjCubC7vLmyr6yjpqCUk5SMi42Jg4qIe7Cnk4+Nj5OYjYaCgI+FZGBdanN8fXp7gH2CgIaJiIyR
oKWur6GYm5+jn5icpKOYmJ+hqqehoaqusKysm5eKe2tiYmViYml9louFj5aYn6Cmqq2tr7HFxLKz
ubaxs7axrKahm457eHR6fHt5d3p8e39/end7e3x6f313e3h5eHFtdIKJj4uJj5SRkaDZyH9remdc
anFzeHx5doSBjZ+jk4aIiYuKhH+GiYqvoHxvcXJ0d3R6cmRkdLvSm4iEio+Kj5Sou765usDBvMTA
t7W5vLu2s7i8rY59faHgkXCBkZihqaeqqsLOsrK2t7e3tbeznoN5e3h8f4WPhX10cWtbXmJkYm6W
qKCfpaSppKelk3x3c3Bta25vo5eehj41RV57gn2AgoSDhoyJne3+5JiNk56lqq2wqqqqv8C1qqyq
o52Wl56VlZePgGlXU0c1LDJYa3B2enh3fX95eXt3a2hlYWJibnd5ent9eoCCfX+Fg4iIjIuSoY+N
jJOWkpGRjI+Rj4qDemRpdHt9e4OEgoJ/hoaJio6Rk5KXo6qqpqGfoJ6WgHhycXRtZ2iAjo+VnJ2f
m52koaSjpamtqrKxvLuqs7q2s7u/w7y+vLe2r62spaSoqqmnpqimnJudoaCgpLChoaqckpGTjo6K
hISCcGBQSUI+OT0+PkY9NTxOXlBSXF9nb3R5gIiIkY6Nj4mKhYiKi55/c25teIh4bW5zcGtra3Bx
gJWtvMLEwsnNy8TCzMKwqaGbjIFwYlh0o42Gl5qeoZ+hnqGem5ial6COen2FhpGOjYmJi4qKioqI
iouPjYaKj5+yu7+8v765uLivqq2pppuOiYaCfXeCiIWEgnp8e4JtYHmShIGGj4+Sl6CTf3hzcnqa
i3t8gIKDho23xbahmJqdo56ampedmpSSlY+GhIB7enFgUk9Qku/0gE1XX2drbm50en14fXl6eXl3
enp9hIiGho+RkpSVlZabl5iWmKCgnpykt8XFwLzCxcPCvsG6s7Oyqq6nn5yak5SSi4VqWVllb21x
cnt7fYaGg4aVhoKAhYqPlJOUlJePj6OGdmBBQ1mIg4CGi4yLiYSGhoiFfH16d3FqUEVBTD0xPmJ9
ho+Xmq+8nY+Sj5OOfWtTRkJJTEVGQkZHR0pLSk1NV219goSGhIqNkZaYlpOdnJ6eoJ+bmpiTiYSG
hoB5eHh9hIuNl7izl5KhpaeptayqtbKvsrKxt7i4saqyury6ureztrCsnZJ8XVRcYmlwiaygnJ+k
p6ikoZ+Xg3Z2c3RycnRubVxYWVtmbW5vb255ent6goZ9gYaJjo+Oj4+RiH97d2ZQPDMzMjQwMCos
KCgpLC40R0ZDTVNTW19qaGRiZWppbXBTR0dPX2l0d4CmoIuJjZGPlZKPiH9/eGlmaWlraWpiVFBO
SkpHSVJbaFlgXmJpaWtraWtweXl9hpOft8jFysrIw8XHxcfFxMnCusO5srW2t7O6vry/u7u4tre3
sq+yo5yVj4+Mko+PkYt8bVtPR0dQX1lbWVlbV1JQU0s1HRgZGSk3RFx2nJ6PjJ2WhH+Ko62wtbCk
obGxqaWjgVVTZIKLjo+RkpeWpqqUi4Z/dnBrcnh2dn1tc4ZdQz5KS1ZnbnR7hIKEiH1dUlt0j5qh
mJqhpaalpZ6blZymfW13hoaEhYSCf3yBf4CPkpiWmJyqsraxsbCts62SaGJZVlJbWF5td3+AgoaG
j4+NhoWMrpi4yoJrcWtokpt7e4GAdnpza25zcWhrfXlra3ODj5KYm56ep6Shoa6lkpKWlZaWmJ+X
i4mTsbq2usK8sre8vr6+v766uLCsqq6mpqGdlpqMhI+hqKOnssmwqKelqaaonpiJdG96fYOOj5OX
l5ygn6G1qKOhoZiXnJKIfXFUUExDREZWanR9i4qOk5OKjIuGgIJra29rbXBna3Fxenx4bmdgXlxp
fYaMj5eWlI+PjpaTlZyqj319gYN9fX9/eoGCg4mNlJegpKeqoZ+bl5iUoaOstbzAwLy8v7y+v7Oq
qKOfoZ6YoJiYmJOWlJKRmIZvaXBvbm90aGdqZFJHQTk3MCgeHBgPCwwICAsXIzM4Tk1HW3R7fYSO
lpeepKitrKShnZyfnKCfmph8amlyf4uWoaW7raqvu7esp6Chm5WanJeJfXFuamtti6GjoaOlqa6z
rKqqpqSopZiOjpSWl5yuxLy6u7y8uLrDwLy+urOvqp+euqmSlYqMmIuTp62vr6+ytbOztbCsoaCY
kYJrSzxHVllVU1NTT1RWXmJlYWJnVU5QWW2IiIGJio+OlouDfXRvgGZic2BZXFlZYGFZW1lYV1ZS
TktMS0dEQEZDSU1bcn98cXJ0cWlyhqCvvMPL1eDj4+Lk4uDg497f2tvZ1MrKv6WBcHN8hpSjsraw
pZuKfXqAhYqLhoyPj46LjIqOlamkoJeTkZOTkpitub7A0My/ury3t7W6ura2vLaei5GWnKGoqLGu
qqyvqqqqn4+SkoyKkpibhoWFhIWChYZ9eHBrioVweHJ2gn17goSYj4aBhIN8coGCf3+Di4aGjI6L
j4uMhIJ9eHeIlpWYlpSPj5OLjpGWlJGXlZigl5iYmJGKdGJcZWtpZ3BVQ0Y6NDQxMDpdQTU1MjpB
REdLTk1HRk5KR0tHQT44Iy9HYGBia2plaWZoYlBXVFBTYnuJg4OAipOdoKGhpLCwr6+zubuztrW1
trq/vLCwraidm5eSkY+Oj46SlZWTk5STk5KSj4mIhH2Chm9iYWtxfXt7en9/gIKEiIaIjJylrrCn
o6Cem5+cnqGhn5WVnaSqqqaqqqeqra+kiXhlYWJpamRlaHCJiY6UnqGho6emqa+5srfKurW5s7Ov
rbCtpZ2VjHx0dndzd3h3dnh6gIaIgYKDfX18fXx9gX1zdHB7hI+JjJGUkpKUkpKOiYJ4al5la3Rz
d32SoZuVl5OKhoaGfYiFgoSDhYaBcnBvdG9qcm9naGqIo6eclpeYlJeUmKq4s9PXzsXAvry8u7u8
ubO4s7GmlIR3eXp2gI+XnZicqbKwwMK1s7u7ubezuq+lo5R3dHyOpKOSkYh/cFlSV2Bra3ysqJug
oaSfoJiDenZxcW1qaWdiWUc6ODhbfIaFhYaJio6Rlo+JrPLvnZGkraitwbWvrrK1s7Ozsq2hpKWk
m5ycmJSFallQR0RUU1lla3R0eHd2en2AfXxyZ2B0eWtwbXB0en18enyDg4WEiIuUko+Wk46PmpqR
kZKVj5aSmJKcfXJydnp5fYF8eXyOkoKGho+Pl6qmqKiusLOwp5WGgnxycWhld5iRho+Rmp6doaCf
o6enqKqqqaytqa67vrO1tru8u7q7ubOvqq+tqKmtqqqlp6ygoJyUm52amJyamJydkouMjY2DiKSA
Yk9HQTs7Oz5AQDcrMkRTTlBXYHFydHp7fYmLi42LhoKAfXhycHR2dG9zdnZwcXB0cWttgZV/iqW3
vLzExMjJxcXAvLeqpq+jf3l6ZGmGjpOWlpGWn5+hoZiXl5eJhYF8fYOLioyJiYWMjIaFhY2GiY2G
g4OClKW/wb63trKvsKqopaCblIyBg4l4b3eJjIJ8fXqAu4thaYSJhYuPk5WeoJiPg398c3uPhYSM
namytbW1srOppJ6dmpiWmJiaioqJiYOAe4J8cl9XXV5cZWBWXGBocHZ9fHl4ent7e3l7d3p8g4F/
hYaLkpGTo5yYmJiTmK+4mJWjoKa1x8W8v8C+wr+8vrq2uLWwrqynpaGhmJeUinhoYWt5cXiMfXqB
gYSIg4GDhH2Bi5GYnJWPjYqEgX1uUEJCSmZ7eIKJhoaFg3+Bf398enZ0dGtZRzw1Myo4YHmFk5uX
mJualZaXkol9bVhKR0dFS0lMR05KSk9JTk5bcH1/hIaJjpSYl5eYm5ien5+koZqXlI+PioaJf3p6
g4mPmJqasLOjnZ+cmJqkp6eorbCtsryzt7O4srOwt7ixr7OuqqWYj3lianpqbnJ9mJ+eoKOjoKGh
npJ9eHRza25xcmtqXllUV2Fobmp4eXN2eH2OhYOGg4KIjY+Uk5WLf3ZvZVU8NDIzMy8xLC8vLCop
MTdDREdKUllhZmpmZmtpa2tzb1BJSk9Ydn95dHyBioqNlZKPkoyCgIOYcWJmaWpnaGJVUE1JRkVE
TVd9Z2FgZGdnbndvcHB6fYCGjZi1wsK+vsfIxcLFxMG+vL67trC1sbi8vLa8v8C6uby1tbW1qq6l
rqWPjY6Uk46TlIVxZ1hMRVSNfWJmbnRoYldPQCwaFhkiL0Rlj5yjn56YpKGYjo+ksbO1srG4trGu
p5+AVEVro5eKj5OamJSYlpWRhXp0aGZmZW1vcWdli1IzMz5NX21rcnR7eoKAa1tOYYaYoKOhnqWk
paimn5uYjYV5cX2CgIJ9fXp5dHd7f4mTmKGfnqSttbKtqaq6qo9xYl1cVFNebnN2gIJ/hoaJi4iG
iYyViYyNenRydIGRj4qGg4F9fXtvcnhmXl9hYGFpbpitlZabnaGhn52hpKehnpiWkYyMnY96c3yn
t7O4vMC7vs68s7W/uriys7Otqp+goZiWnqGqtbOztbO1tqysrq6pqaCdm5F0Yl5ge42OlJeYn6Gc
oKGhoKGenJeTkop6aVBGQDw+QkxhdoODhoaGjI2Mhndta2JpcGtkaWloa3F5fXdxaWJcYWl6iYmK
jJGUj4+UkZGTlJaUjIqGhIWDhoiJiIyUlZOSmKCmsLGon5uaoaOkoKO3wLm7vMG+urOwr6ijn6Gh
nJ6Xl5iWlJOWjoyVj2tkZ3Jwa3BpaWphTUE+QzkoIB0ZGA8KCgwODx4sNT5CRUdQdH1/iJGfm52b
oaenoaGjnZubm5iXkn9tcGtqcoCWpLuvrbO5vrOqoZ2XkpGPjIF3dHJ0cHqWmp+hpaSqrLCxrqqt
pKCgmIuJhouYrbK5tre3ury8vr+5vLy6urawoJq5qZWzm4WJjKizsrGzs7eztru4sLCopKqehmdJ
PERUVFBSTkxQVltcbYVpXlNTUExXaYGRlZacl5qXj4iGfHJtaGtrZ2RiZGRiYl1VU1RWV1NQT01P
SUdLTElHS1Jihn9uZGBhb4CXqb/Cw8rQ4OPg5OXl4+Lf3Nzb2tbT1sm/oXdpdIKtoYaJmJ2KhoCG
hn2AhIiIhIaKioaGiIiGjpWkm5OYlZOYscfJx+D207+/wsG8ubq+w7y7uKiYiYaVnZ+ssKimrqyn
p6ial5OYlJOcoJ6YlpaXko6LiImFhHd4b3BucXt3e4J9f4iIhIGGgXxtiYF6hpaLhYqUkYySkouM
hYaGeYiem5OUkpiYlZGPkpSVlZaYm5iYoZ6emJaEdGdrbXJwdGBLQUU5MzEuNTk1NzU1ODo9PT5E
QUJHRkFAQD47Oj5DVmRmd3dobnN0bWpiWVtVVVlbZoOPjI2dp7y4s7O4xMKqqri4tra1sbK2trW2
rqips6iYlZiTmJ6anJqWj4+XkY2Sk5OeqYqCj4R9dGJlZnR5fH18fX+Dg4GEhoiPoaqtr6Wko56g
m6GhnqGhvqGeo6qjo6qtqaqtpaqLYllhaGlnaGtpdoSEio6SmJyeoKSoqqmxvtm8s7y5s7Gtqqml
nJGDe3mAfIJ2dnp0en2BgoGAhoSEg4GFjoOkhnNvcXl/kYuPk5SWjY+XjouLhoN2X2SIeW1/lI+M
jI+WlpePg4V9f3l7eoCGgoN2amlog21hZWR0iZWam5qYk5qcmJSSs9/FvsDCw8S8tbu3u7Wwsrm/
sa6afXh6dlt4kZaXoaikrMeyqrC8zsKxr7G1rp+VdGt0jJ+foaCbkYyEaEdXYGJlbXeOnp6eoKWf
lIV5cmtpbm5rYmJOOjU7W3CFgH+GhYaMjY6Ti5GWlpKYn6Worqqzv7i2s7O3s6+3vKOYmqOlnp2Y
lYhzU0pCUnhkYWZucnR5fXx8gH16fXllX15qcW1vc3Rzd3eAgHt7f4aLiYyRj4+Pj5GPlpaTjo+R
mJqYmIh2c3l6fISDg4N8f56Ren+EjoyWrrqvsLOzxcCtoKGhlaV9a3h8i4qGnaCXl5+dpKWqpqOs
pqqzvKqksdXEs7W6wMPBwbyzubavrrC1xLOlqa+opaGjnJWXnZybmp6enpqWj4+Pk42JgnxpV0pG
QEBBREA6MSwvOkdOVlZbam90dH2EhYmLjIiCg313aFxhbXJwcnh5fXdxcnqdfWtrbneKprO2vsXH
yMXO08O3ta+lwbd3bnNxd6egioqRnJ2Ym5eYmpqVjYN9en19g42NjYqIiYSFhoqGiImOjImGhoOL
mrXHvLaxt7Cnp6ScnZubhn15nZJzd4aCfHl5dHFzaF5xhIuJj5Sbo6Cdm5WUlHZvdnuNsLOwvrqz
r6+vqqiqoJytlo+WjI+LhYKEgIGDgnxvX1lbVU9QS09TXGpyeHhzeHR2dnRxdHZ4eHR9fIKKjY+V
lJWonI+Pj5SXl5iVlpufoay1u7y6vMHBvL/AvrOytbq6uq6oqqmmoZyaiXNmZ3l4d3Z6gIOIhIaL
iYOEg42YlJOTlZaYlIyChWhKSU5TWWl2f4aGiIR/f319fHt3dnB5eF9PRToyLDl2e32JlJuemJua
lZGSiX90YlNOTE1rXExMSUtUTU1OU2Vzc3+FhouJjJKSlpiYn5ycnJ2eoZaWl46FgYuBgIaLj5ST
lZ2emJaYoZuYnqOlqaqor7K4vLi1vLuzs7q4uLu6r6+qoZiIfGllYWBrcHqJmqChoaClo5yehnRw
a21tbm1qW1xdV1JWXF9kZm5vdHJ8gZOUjoiIjI+PkqGbjYR/fG9iUD03Mzc3MzAyMjAuKiswOjc8
U1RSW2BiaGdoa25rbnl4WUxNU1dnbnd8gIWNjouTlY+JgXl0c29fYmVoamJfV1BSTUxHR0VOVV1i
YmJqa2dujHRta3+PjYSMl6WtwL+8wr/Ew7qzuLq5tq+ssLO1uri+v76+wsC8t7OztrGyraWmn5GN
j5SVjpGPiYN0Z1hOWW1vcHZ7g313aVhHNR4ZGig+YImhpqWlqqyhnpeRlKaxt7y2rrK5taysn45g
XXymnZWVj5OTl5iPj5OEdGpiYmJmaGpiUEVGODQ8R11weHRzd3d3fWthaV5rlZ6fo6Gnp6mvuqid
mJWPi4N5cXp9ent6d3Jtamt6iZKtwaWfpay6u7CurKqputPBdmdWVWZzeHl9gYSJjpGMi4mPjIyG
hYJ8enuBioqUlpKUj4uCfXZqYV5cWWJ3YmJrksudj5ebprOhoaGenaGam5KNioKAfWhccKGxsri+
vMHFvL6+vLazu7qztbewp6Gcm5+ksLWzubm1ubO1sLKurq+uqKSbjnpfUE5cgI+XlZuhoKChn5uX
l5ibl46KoJFmUEQ7OEBFRlVvf4OEgoqJgXRxZ2lqaW1taGpmYmJka3F5cWtnYVtdbXuGjYyPjpSW
lI6RlpienJWTkoyPj46OjIiNkZOWlZuepKynqKimpqWgs7ehoKnFwbKwuby+sqilpKGbmJyampya
k4+Ri46Lhol9Z2ZnbWtycmtlYlxKOSw4LB4aGhoZEAsICw8VKjQ+QT5CQ01kioaIip6emJ2ho6mm
nZ2fmpacnJePhndrZ2VtgJius6+1s7e/wLy3qZiPjIaFhoN6joR2iZidnKCkp6qwtbGppKSkoJuY
int/g5a4rK61s7i2s7O5vLa5s7e7s6qblJeOlJ+Ri46Uqq+vr7O4uLrDvLazqqeqoZiGcks6Q1BQ
S0lHS1BSV1x6rXJVVFBNVl1rjaGhoJ6doKGfnJWUi3R5e3Z3cHFoYmBhXlxeWVVSUFBQU1lhVUxN
SUZHR0tbXV1dXml5kaO5xMXK0NTX3+zp4N7d4uPc497X1dndzby4i3d0e5+NfYaJhYaAen99e3l9
gYGEgn99e3t8f4OIlqqjnaOjm524zM7M29nKysrLysTIysTCwsXDrZd9fYyPlZ2fpaGhpaeho5+e
m6Cqn5ugoJycnZqYlpSRj4qPhW9mamlycHR0e3p/f4GDg4N/eG6FfHt7goOFioaJhoaGhYJ9hoF9
iJqbl5WUk42Kho+Sko+UlpqYlZqdm5iYm5J8aGlxa21qYltHPkE4MTM1NTU0NzU0Pj5BPkFEQkJB
Oz1BOzxHXG1vaXyRdHJ5dHJxcnNpa4Z4bYyki5GXpaqvs7O2udz+/uXc2a2nrrO2s6+ys66yqqCd
lJOjmJiWm5qeoZ2VkYyOkZOVjo+RiY+2jHZzamFhcHp2d3Z6fXx9hYaKi5Ku2bOlp6afnpycnZ+h
oZyhpKOjpqiqqqqvqqyjl3NZaHh4gpiGb2JpdoGIjI+XoZyjo6moqqmts7W1t7OzsKqqqaGaj4V4
bYGCcW50dHh8fYGAfIOCgoKCg4B8fYB9fHRuc4makZSbmJWXmJWUj4yJi4FiYm19n6GOhIuTlZqX
jo2MhoB3d3Z4d316fIFtZmFiXl5qeZahnpuan6Gdm5ydm6DCwLm5vLy6u7y+t7e1sLWzs6+vqJJ9
dHN7g5qkqK6loaatsLOxtri4vLm8urGmoJiBdImYoaSqqqigl4x9YmJxamtqcnyOnp+gtaGBeHp0
a2hpa21lXEQ6PE9qeYmDhYmIj4+Uj5GXmJiVl5icoamysq6srbCvrrG2tbGqnp6goKGdmJyYiXRX
REBTYGdoamhwc3Z8fXp3e4STg29hXWBra29xdHJ2e3t9fX1/g4KJi4ySlJWWlJKTlpGOj5GWlJuf
hm+Lgnp8goOFhpWFeHZ8hIaFhp6ttrGxsa6ysaqsp6GcnY+EgoSLiYOGjpOcnJidpqemqaqqr6ym
qqets7m8vMHF6O7DrLG2s7Ovs7iupqanp6mknaatoZyWmJufoaion56amJWRiYSGf3ZnVEk8PD49
Ojc1MCw3PkRHTVRda3N3d32LhoGTubjco2ZQU2WIhXRwcnN0d3Rwb3t3cWtrdIOjsLbAvMPCwsHC
vLKzqpONhn96cXBtdH2Jj4mSj4+TkpaVl4t9fXt4fYWGi42Ji4qFiIaCiIqMjIqKhoabxZ6Kn7O6
sayur6qkpKGdlZ2OcnFxb3R7gIaDgH99fHl0a4uJi5GYlp2gpJuRkYt/dnuGjaO2vL68u7OvsK6w
qqmnk42LiIaGgHx2eISDhH18d3h9hl9QTktMR0dQaHFxeHt2dnN0d3R5eHd3fYSGgYWKjJSXlY2R
lpKVkYqOj5acmpado6qzsrG3u764s7O1tbW5t7a3rayuqKGjn5+OfXBrdn10dHx9iISFhYKGiIaD
iI2PjZGXkY+IfXpdUEx5k2JYYGZyfH19fXt6gH17enRzcXR3a1xLQjcrLkdpfZGWlpeXn5WTk5OK
hXhrWVBLUoZoSkdMTU1QWVNZZGt0fIaGiIuPkY2Tj5WYk5KVl5WYko+IhoSAe3qAhIuMj5KWmpqb
nqGakY+WlZ61ra2sr7KprLe7uba3ubu2sa6vrqGdjYBya2JYUFB0fYyXmKCdmJ2fm59/b2loamlu
amJZVlVZhqp0UFdkbnJyeX1/hYiGiYqJhoiOlZKLhYB5cWJKPkA6NTUuLiwqLCsuMTU4OkBQW19g
ZGhmaWhna299ioNfS0pQVl9tdHuCg5GJjo6Pi4R7cWlZWV9iYmZiYmRWTk1FSUlKUF5YXF1kam5r
bmtuc2trc3p8gYmNlpy2uru4s7CvsbWxqqiqqK2ztbW5urm7u8W8s7u4s6+xrrCsnJiclpORj5OX
j5OPhnpzZV5lZ294gYWIhYB6bV1EJxwjOFOEnKmpramnqKess6SWlaixsq2wsri3s6qol3iGg4qP
kZGWl5OUmJGLhHprZGFgXV9la1tNPTk1N1VmdHZ2cnR0d3ZxZ1hkYnyjqaShpqmsqq+yprCpm5aO
hX1yc3N2eXBxaWVncX2Jl6y2pKeqrLO4r6qpo6nJ+/aPYF5qfX18e3+AiI6Ui4+PobmSgoSIg318
eX2Ik5aPj5GKhn9/e3FoYV9TVFdeYmltf4ucmp2hpqiknqWcmqGYj42UkXhxcF9omMC7ubiyur67
vLy8uLq8u7GvrqqqqqWdoKyws8G+t7zHt7Oyqqmsra6opp2Rf15HTFZie5KUlZqknp2boJuSk5aT
jYqMgGVYS0JCPj5CTFxuhJGIgIp6Yl9cYmFhYGFnaGRhYmFnZ2pxa2JeWWJvfYKOk5WWkpWXl5iY
n6Ofm5yYnpeRkZORkpaYn56eo6ipsbOtraquqqqvqKOhqbGpsru/ua6joKOfnZyanZiTjpOWlZKT
iIuEfHZmZGVoanBramJiYEo0KB4XGBUWFhEOCggIDh4vNT1EQENGRltzfX+Ij5SXmKChpKGfm52Y
l5iYmJKIgXBkZm6GnKqxsLK6ycW+tbizqp2PhoOBhHeIgYCRm5iao6Okpq2zsqqoqZ+cmIqFeW93
l56crrOwsK6tsrOysbK3tba4rJ2UjpGRjY6Jj5ivs7K1s7a8vLy8s7CupJ2jmIR0VUFERUdKRUpH
U1ZXXHGSbV5UUlBXZX2ar7GppaeqraqqpqqqmJ2TjZeNgndzaGRfW1lXUFVVVlNSXF9eVE5JR0dE
TElFUFloeIqbsLi7xc7Q1Nza6Ojm5ePf3d/e0tLUzsvFwLORhoWIhn99hIl8ent8eXN0fHd4fH17
d3t6e3NpfY+fpKSjuamfqNHQyMvKydPTwsPLycrIxcvLxcOwi2hdZW5/iZOcqKejoaOgoaCdnKGf
o6Wjpp6enJ+Vk5OSkZGLf2pkZmRpbXF2dHZ9g3x6f3l2epOJf3p8goWFhoiEhIOWuY10dHmIkpeP
kZOPj46Pjo6XsJ6VmJacm562pZiVkaGhb290cGpmYlhNRzgsLzQ3OTo3NTU5OlNeQTU3PTw7Nzk7
Rk9YZWp0hYJ7dHp9c3JtbXB0dH+ChoaLmKizsq+4u7zC7v7+/v7OpKiyr7C1sbOuqaGek4V9kZae
rZ6bmJeboZSPjo+Pk5GSj4uJiYiGfHlkZ2t0d3d3e3t9gIaEhouPm6Optbmgmp2bnpqamJ2hm5if
qK+uqKetrrCuqciyjHN7io6RlZV/cWptfIOMlJWSmp6hn6OtsK2xu7Ozsq2qr6mnqZ+Rg3JmTFVr
cnR4d3t7eHx8fYGDf3qBfHh3hJyNgX1/ho2amI+Ss6iYlZOWmJOIkXlqamt4mIyGkZKUl4+Oi4aA
fXp5eHmfjXR4bl9dX1hQj6GbmpWUmJeboZ+koKCeprC4vLy2uLu8uLOzs7ezrrGzrbGzg3mTt7Cp
p6ihnqGkpampqq2srrGzvLWzrqafnazDlpShpK+8qKGYj4Z2a3Fram50eH+GiJGUg3x7enRuaWZm
YmRkUz1MYnF9g4SFjI2PlJWWnJqYlpeWkpijpKmstbGxs7GysLC1taqhoKGmo6GjoZeJdFdCTWJm
YWhqb3JxbnJ6fX19ent9c2JYanBoa3Jzd3d0d3l7fHx8goqPi4yTkZOPlpaVlJSTk6CYj5F5anF3
eYGAfYSGhnNyfYZ9fYGSpqqxsrOwsayurqyon5ihn5SPiIqGg4KEipShoZ2dqKalpqqtpKahoa21
vMK1vLu5wM7AvLaws7W2tayprKqpp6SlqKWoqKGooZ6eoKagnJ6cnJ2clI+JfXBfR0NCQEI+OTQw
KCUpOUZKTltqcXN5fH19fZ/w/u6LUENTbnJoaWhobWtra3R0c3N5c3R7hp6ys7W8x8O5t7m7s7Oq
moh/e4R9cG1udISemJSLhoqNj42Mgnt4eHh9hIiJj4+LiIWDhIuGhIiGhYmFg4+hm5uqrqylqKWh
np+Yl5SKfHFvfGtpa3OEhIaPjoiGi4yKjoyKj5WYn6iknJ2XiYaChJ2tt7y7v7yzs7Owrayqp6mW
iY6SmH15fXx6eoCKgoF7fZflmk9HSVBQT1RhfHx7d3RybnFvbnFycnR9iJiLhoqNj4+Rko6co8Cd
i5GTlZKWlpSYoaWwrLK1uLW1tbOssbW5vLWzs62pqaejnpOFe29ye3p6hYaIhoOBhIODhIOCgYqP
jI2Kk5p2W09LSltmXlxcYm6Ag3p5dHx7enh0dnR4eHt0b2JZUDgoOF96hoyUl5ucmJaalY2EgHJf
WE9JSklOTlNPSkxPVmJobXR5fX2Dho2KioiMj5GUj5ORkZSWjo6FfYJ5fIGDhoqMjY+Rj5KYmJOP
hYyenqWnqq2qqrCvtrazs7i+s7e4r6qnpZuRfWdkYmRfVmGAl5ibmpicm5uYiHRtamZobWRgXFxX
WHzE64hJUF5lbnJ7fYCDg4aLipqUioaOj4yGgHRtVkE6SjpEOjMxMTUzLy4sNT5ETVlgYWRoaWVn
Z2hpbXqhsHhLSk9SX294gYSFiYifkoV9goByW0tLVl1hYGBmXk5STkpJSUtJTVRgZWpra3JwaWdr
b3FyeHp8goWLjpaesbeyqqijm56loaGhqK6wsra7u7jA1ceyrq+vr7GqqKGdmpiXjpKVlJOSj4+N
ioF0a2t0fYOIjo+TkYh9cWVPQD1LfJyjqK2tqrOxrbOzpJ2bqLWyraext7mzqqCbjZKPi42TkpKV
mJSWk4mBdmpkYV1dX2JmT0Q8OTpBVmtzdnJ3d3d9f3RxZVhoi6+po6aqrKyurqimp56alYyLgHRk
Ym1ra2lmYWBtgI2Un6Wlpqeor7Owrq+vssXv3Y1manJ7lY6BfYWGhouNjouTmoZ9hJSLiYyEhpGV
mJiXkoqGgoF9b2JgZmdYVltkZmlyhY+dy7yXnJ2empuempOWjImNgXt2YmKezr6ys7Kys7y8u7q8
t7e8s6murqqno52fr7m8uru4tre1trGxtbazs6yon5SGZlNPSVNldomYnKGenZ6amJqkx5yEfXyP
iWtZTURBQUZGT12DtYJhaWRiZGJiYWZkYmBfX2BgYWVpa2toYVZVXY6Wl4qMjpKSlJSXnaCloZyf
m5qfnZicmJiYm5icoaOmqrG3tbCvsK6tqayqqKepp6ipsLeznZidoJyenZiYl5OUlJGPjYuGhoFy
b2dkYmdtb3BuZ2VcTCweFw4NDxAYDgoKCg8XLDU3PkFJR0pNXGt5f4CJjJGXmqGhpKOcmJeVl5yY
k4+FdG1na4KesLm5ucDMzsLBubaypJWMhXx0cHF5jZiVmJiYoaOkpqimqKignJSWi4FkTFhlcIaU
qryvqKynpaqzsq+qraymmI6PhoaJiI+YpK2zt7a1u7q5uba2sqiboL/HiHFeRD5CRUpLSkpLUFdc
YGRgXllUV3KFj52nrK6ss6+tr6+sqaehqKWYko6KhIJ2cF1VVVBUVl9WWGBobWdcVU9MSUdLUE5Y
YHGLo7K5w8jO0NLX1trb3d/f49/a3NLRzsnIw7u3s5yWlo6Lgn2AgoF3eHl6j4JzdHR0eHN0e3xy
TT1Yhp2mpqSmpaW7087Dw8fM3N7S0NHT1NDK0dDOwbKTZFleZWdnb4+nqaGevL6fmqGgm6Ctwq2p
rK+ooaGfm5SRk5WNeWZdXmJia3ByeHmJfXiBfXmXjJipinRwdHmCgIGEhKWzfXF0eYKOj4qVnZGR
jIuSjY+Wl4+Ylp2bnaSdm5iPfWtpcnZraGtrZFRHNCcsMjc7NDUzNDQ1NDU1Ojk9PUE9R2FKTWFr
bnR0dHl7gn10cXFxbXN3i4+SlJ2wvLi2vMPDt8Hp/v7+/s6subiys7Gxsq2ul3x0dIySjpaeo52h
nJqampeTjZWfnI6LiIyKhn94dm9ne49/d3d7e3R9fYSKjI6WnKSxtqSbmpiYm5aPmJyYnaOpsK/D
uqaorqqttaSSio6SlJOTkYZ8cWVzhouSkpubpKGfqqepsLGxrLG1sq2npqigmJKIeoZpZGhwcW1x
cXl7en+DhX98naV/dICbpJ2amp2ooKGglpOYmp6hnZiUlZOPjXdla3uNj4uKjpOWlpeWjoyGfXyA
gYGBenRvZ1dCO02Gl52YlZWYo56hn5ylqqqfoLPBvLexs7K3uK6ytbKurq6pqqiFm7ivr62xyK2h
oKGkqrGzrq+qsrO1s7m1qaGXmJiRlJ6nsLWonp2bin1wZXBxdHF2d3l7gICCgHt6dG9rYmdqamhk
Ymppa3yEhoiPjpGPlJaWmJiXmpiWmJ+lsLm4rK+ysamtrbOqo6Sfpaafo7Wgj4Z4Vj5NXWJlaHN2
dHZ0dHiEhXt2gIGOYVdbX2hra25xdnd0dHZ4fH1/gYmMjpSXkZSYk5aXmI+Lj5WRiHRtbXR6fHl9
fYSEc1VPYniGkpimpaavrKqtrKqws6qjpKGjoZyIg31/d3eOk5eXm6OmqKOqqKGhrKefrrOxu7u1
t768tri/trCqsbKvsq+sqamopqWqr7Cspq+7npeYnZyanaCgpKqpqqOJd2hZSkI+PjtAOzAiICMw
O0JLWamwaWJmdHSIzOjOglRNTVdpcGtqaW9vcG5rdHlxeX13dH2OnrC4ub6/v7++vLatqqWSgHp4
fYx2a290eoags5eEhpeKf319eHR0cnuGiYuNjYaFioiGhYaFiIaFhomIjJiuqaSjqqWhnaCcm5ic
gnRvaGlpaG9zhImJj5OUj42NjYuLi4+Tm6Ghqaigl5aTkomgsLW8u7i4ubq1tbWzr6mlnouEiYyP
ocyhfIt8cHR5e31znfjsckdHVGJlaXF6e3d6c3FxcnF2cnR0dHR7ho+PiYyPkpiNiYmPuq6Pi5GO
j4+Vl5uYmJifubywqLGxqq6zvsG5tbi1r7OxsKqln5GEenNzeYGDiYqciIaGio+GhoSFhYiGhoyO
smpKSkpSU1ldYmdra250d3l5e3Z0eH18fH+CfXZzcXFqZ2A1UG6Bio2TlZqYlpiXkol/dmtdTklH
TE1OVFRLR0lUYWVtdHh5fYKGiI2OkZKUlZaSlZKOj42MhoCAhoN5gIaGhoiGjo2Rl5icmJKJk4yP
l6SnrrXAs7C1u7Wzuby1r7GysKehmo54Z2hlYl5ZdqCYj5Kampqcm5yOdm1oa2lnX15oYl1cm7zC
a0xZboJxcHh9hIaGiIqLhoaFhYmLiIN9dGZPRj01OTs7QzMuLi81NDxHVGReXWFkZmZnZ2RlYmBk
a4Khk1hQWGVxi4yMhoSLiI2OjIJ6eXdOOkVLV2JlXVlcXVZPR0tHRUdQVltmbWtrcm9vcHJzfIB9
fX+BeXqBgYaPm5yVj4uJipGhp6anrrCvsbe8uLm3wbqwrrKnpaasnZKYmJOSj5OXmJWSkouEgH13
c32IiYaKlZeWmpSLgnRhT1+jqaqwrqitsrOtqq6qnZ2jqaWhqbCxr6qooZqXmJOPj4+UoJqTkoyF
g3puaFxYWVdVX2ZLQ0E8PFNrdHF0fHp8fX98fXptYnKYsq2orq+ssKytqqWdnJuUkoZ9cV9YW2Jn
ZGJeYnKCjZaaoKmtsLGurrKxraafpraSeG90eH19f3p6goaIi4yLjYuNjY6JhoSBgoKJkZ+cmJaO
i4SGhHxwZGRiYVldXWJiaW1ygJOqoJWboZicn5+clo+KiaidcmpvgJ6yr7mqsbm6try5u7m7uLay
r6+nqKSnsaeus8XBs7i3vLqysbK5tbWzr6akqo9uUkdETFh5l5iXmpyqp5SMjpKYjoKAiIZ9fXln
WUpDQUdOU1tdWVdUV11gYmRiYV9ZWVxcYVxZV1tiYV1ZSjdHrdOpfH2DiY6OlpiboKOppqGlpaCf
nqGhnp6foaGorKquuLe1tbWvs7OurK6qraqssaalpqGfnp6fmJucmJGSlJORj4+LhoR9d3RramJk
c2tpbWpmYltGLiAXCggHDBENCgsPESxAOjtDQERHUFVic3h/hImPlqWooaChpqWhnJePmJeWlY+A
c3F0j6OwubzCycnEwLy4sre2sIyAgXtvdoSRj5KXl5iYm6GpqaempJ+bl49/Zk1FTFdndoaYqa+q
p6SppqmopKqjraiclYqJioyPjp64srGws7m5ubyzsrG1raCYpKeLfGtWS0VHSkdFR01TU1ddX19c
VFRUbYaVoKywrba3s62qsrCurKafn5yUjoyJiomMZlRSU1JXX1ZZa3t2c2liVlBHT2dyYmJriJyu
usTFy9DU1dbX19Xg39nb19bV0M7IwL68u7azn5eXlJGGe3p5dnF0eXaBfXp4c25xcG9yblI6Lkd0
kaO/xKmhrcXJycjJy9nT1tLW19PT1NLO1tC8qo5kU1hlb2dmeZWhoZ7a6bmwqKObnqawqqquqqiq
rqimoZqWmpiSfGdfX2Joa2tvcnd3eHF0do+Vi4Z4c3NyeH19eH+CfHl/nYJ8en2Gj4yPko2MiYqM
lJOXlZqXmJ+1oJewo49xZ29wb29vb3NwZ00oJigsMDU1MzU6OTk5ODMzMTQsFiNDYVdSV2ZucXx/
fXx6eXdycXJ5eH2Ml5SYpLe7s7rFwrzOyN38/v7+6b/BtbK1s7Gpp5KBfH+GjI6OlJyfnZ2em4+M
jI+T1vq/hIWDhp+pgHl3amZ8k3tycnR0dHqChImPk4yYp6ihoJiYmJaPi5SUkZqgpLO3vLOvsa2t
qKagmpiSj4+Um5inkXpuYmt5ho6RmJigpKGlqq+wrq6trbOwrqqoqaObj4R0VThPYGt2d3d8e32G
hoiTj3x6e3qBnaempaOkp6qgoZ6foJaanp6blo+XmpePg3l6oY6AhI6XmJShn5KRjY+MkYyOg4R8
cXNzZmRSZn+1rIyLkZeYmJ2hoaChpKGlrb6zs7Owt7iyrbKzraqurLGXioyuu7KxsrKwraenpail
qq2qrbOxr62yta+qn5iPio+RmKGmqqejnpaSg21nb3dvdHt3d3l8fXp6gHNoanuAb2trb2tub25x
eoOJi42RlJSWs6OPkpiWnZyYlp6jqrOzr6ysrrGup6WnpaOhp6SeqJ6WjX9bQFNbYGhpbXN9nIBx
b3l8d3F0e4VmfWlcZWpnbW5tb3NxcXN4fIGEio2Mj5iYlZOTmpuSkaDMpX13fXBze317fH99g5qJ
WVl/f4CKn6alqq6uqq6uqaewuqyjnZ+hnIqBfXqBl5aYrZ+foaeppKiqqK2PlJ6nr7a6uLm2trq3
trW3sLKvsKqmp6enqaOfo6yqp6mpoZuWlZqbqaOkrbWsqaqqqp2Gc2lYRTw7Ojo+NScaGCM3OT5T
nJ5nVF9nanSXhlxOQT5PXGJmYmdqa2pnaGtrc3RzdnqGi4uap7Czu7zLwLWzs62hl4qAfXl4bmtt
bXN0fYB/fXp9hn14d3uPd3BzdnyOi4mMioSDhISBhomFi4iLj4+eqrqnp62qpaCgo6CWl5WCcnBr
aGpucIaSlpiVmKCXkY+MjI2NlJagoKmtrKCVjI2Mn7q7sLO5u7izsLO2ta6sqqamlIqChoLI+8lr
dHR8e3p3dHeS37BpZ3JwhH16fYF/enl2b2trbWt0dHR4f4KPnp6WlZOUpY6EhYWIio6Sj4+RjYiM
jIqFg4CWloaDl6ivtbe8u7u1tbWxrrGwrqmnn42Bdo6AhY6Ig4KGg4aJhYKGhoqKiIuDjH1iV1RY
XmVmZGtta25vbXJxdHRwcnmAeX2BgIGEhoSAfHt3dEdBeIaGjI6Pm56amJOTi4N4a1lOTE9QUFNQ
Uk1PTVBcZm9zdnt8f4mKhIaLjo6PjIyJjY+PiYWBfXl0dHd9hISChIaPko+WlJaTlY1/go+VmKGs
srKzsq+zuLq3s7OvsKyqp6SaiHJtamdmZmuKmJWgnZGYmJidnZKGa2FgYGVxcnh0dmllYmhwdn2G
ho+Ee32DiImGg4SEg4aFg4WGgnRiVExHPjtBVEA4ODc6Oz4+RlVlamJiaG5wbmhkYl5eXl1kZ29r
ZWJpcnOGjouDg4iLjJGGfHuBgE03OUBHXGViXV9la1JHTExGSlNZXmh9kYCGd3N3fYSGjIuGhn19
gIaDgYF9gIKEfHR0gJiboKSqqq2vtbO8u7G1s6ypqaahoaGmmI+WlJKPkpWXm5OPj4aChIOChIaJ
jZKbnZyln6GooIVedKCkrbm8s7GytbOutbemp6GMiZiwrqOjo6OfnZyYnqGTjZSVlJSSjoR/gZh/
WFdYVVVYVEdBPjpBYHB5d3h9enuBhIGBfXN0rq6lqK+zrq6vraqupJyem5WLhX13YFVTVFZYVVln
c4OUl6GnraqusLCysrCqpZydln+AeHF4fXyFgH+FiIyLiIWKhoSGiISEiYWDg4yRmqCalI2NhoJ9
gXdpX1lvaGBnZGRobm9vhJefmpWYlpien5eUiYaGhYSCip+lr6yy1bmqsMHFu7a4u7q2sbKurayo
pamqqq+ytre5uLu5vtfAp6yzs7Kzsqq2mnRZUEpOU3Spl5Keqa2mnpiSiIV9gYaVg4aLhIiqYj08
R2VUTlRUXldWWVlbXl9cXF9dVlhZW1lYV1tUSz0oKDl6inqBhoiMj5SRmJ+hqKWpp6anpqamo56h
pqiopaaqra6ys7Our7CzrKqqr7Oyr66yr7CqppydmJiVlpeTlpWRjY+LhoKDgHx4Z2JiYmJiZWhn
a2tkW0oxHxUKBAQEBQUIDQ8QHjE1Ozs+S09XW2Brdnd7hImTn66noJ+bm5ubmJeXkpONj4N0cX+m
qKqzt7zIx8HCv7i+vrm1nIyBfXl6jpiVlJOTmp+fm5ygo6GhnJidjX1fSUBKUFyJjoyPm5+hn6Gf
oZ2gnZ2bm5qUhoOFjY6Upb6ztbC1ube3t66wr6+po6GXjY2IemVWR0dHSk1OTE9TV1xWVVVWV1lr
hZegyMCyt7Kvr7CvubOqpKSgnZuTkoqGhoNuWVZQUldeX259gHl6d2pqbVlWbXZub3mXrLPEyc3T
0dPX19PW3N7X19fT0encyb+4s62us7CmoZ6smo+FeXFycIqVenB0dHd2dHR0dnBlTzwsRnKMobq8
r6q4w8PEy87M193b1NfX29fb2dTU0sWtkW5cW2JoYmJwiJiqp+z+/t6Xj5yhpainsrOurK6uqqqq
oaignqOei25ZXGFoZ2poa29vdG9hXIuIe3Fpa3Bzc3R5ent5fXx6d3h9gYiOhoaGiY2Ki42Lj46R
l5iWlpWanJ6koG9oa29rcW9vZl5hPR8iKy4wMjg5Ojs7PD45OjUvNDIUHTxHTGJpYHJ2enuAgHl4
dHNycXSAiZibm6W1ub7AvsHCxcjFyMvU4/z+/t2spqqvr6iahHyBgYSDj5qVrpiRl5KRi4mMj5GX
oJiLi4yGhYF9fXxvZm5uc3Zxbnl3d4SRkYaGiZWyrJ2dlZKIhouKi5OVlZ6hqqqvuLCqo6inpqSd
jo2Sj5OOj5qTf2tiYWd0iJiVmJyYoaq+zKmfoKyqsbOoqqypoZqPhnY8KVR3hoB7eX+BhYiLipWV
hoB3e5SjqKiprqehpqWho56gn6GekpiYmpqVnpqNhIiTkoWJiI2PlJORmJOPi4yPj52wjX9/d3Rx
bm1te4qPi4WPkpGXmJignZidmqGos7GssLG6sKyqr7Kur7CxkoiIn7q8t7a4sq+zs9K4nqGppqyw
sbOurrazrqaflIqJk6alpKaop62mm458em1vb3Fzc3R5f318fX+KeG1qcXZrdHByeXRzd319goaW
lY+Ol5OWmpiWlpqWk5WWlaCfnqywraeooaq6qp+eoZ6koaCbn5ePhGhGTVhiZ2tuc3R0c3F0dnRy
c3NiW1ZVXV9laWloa25vcWtwcHd4goCGi4+Sj46PkpSVmJeVkY+Ef29nbXN2eHh9f399hoBuaX2X
gpauqaGppbHHrqqur6+3qKGhoZ6chnt6en+LjZqeo6WmqrGspaCll4uSlqGss7K4vLi5urmztbO2
s7OurqqqqaqknqGmqayvsbKtnJeVl5idqbGzrLCvqamplYiEdmJMQDo5Nzw5LyEVExonOklOR0ZP
VFdSUExDOjU1Rk5dZmRmZ2VmZGltcG9qdHJye6WzmJ2jr62zvsW8sa6xqqOWiX13dnNuamt0bXJ/
g4J5c3R5dG5ubW5ucHJ4fYODfX2GiIB/gYSDg4WLjImRnKGhpaqqqqSkpqGgm5qTjo53cW5pbXF4
hpaYn6GcmJWSkY+GjpWan6SnraehoKmmnZyhsbu+vLa4u7aws7OzuLWmnp+Pi3BeW3S8xY2FfYqG
fXZ0dHJ2fYiWoazJyop5f395dnNnaWhvb2trb3N/k52eoZqompKOiIF9goaGhYuKiY2MiIWCeXRt
aWt3cnGGrLWuubi4uLi2ubOzrrCssLGmmo+NiYOFioqMjIuKnrWJf315f32AqoRZUFVpeXyChYFw
YWprand3cXZxcXN0d3p9fX2CgYaKioqKhoB4a0RQbYCKj4+Vk5eVlY6Gf3RqWVBOUldZWVVVUk5P
VVVWZXF0eHh6en19goSOjY6XkY6Oi46Gf4F6b29rbYaKiIWEhoqIiIyUmJeShnlugZOfpqqqqrOw
sbe2u7eyr7GqqaGcnJuJjoluaYCFeoiMjpGYnpebn6Camo50ZGpvcG5ven12b2dneo2Ji5Gh162J
i5aUi4aDhIOCg4aFhoFoVlxcU1dUUlJdU0tHR0tSWGRqcnx0bYJzeHNxaGlqXVtbWFxcYmRnanJ4
i4WJhoaEhoqLi4qGfXRvWT06PUpkZ19gXF1dXlVLR0lHXF5haXaAfHx0dnh/hoqLi5KMjoqqpot3
dGtobotzZGJvf5GYnKSqqqSsr7K/taqpt7ujmKCYjpOLi5SWlZSVmJiWlo+KhoN9fYODiYuMk5ic
oamusKmpmHFxp62wsKyyvLqwsLOyrKihr496hpahp6mho6GenZydnpOVmJaTjoiKgIGq0nRLR1BV
VFBPSkA5QVludHeDgH+EhIaJhouIeH2qrKiqrrGys7Css8Wtn5uTlo+GgXFcUEpQTVBNVmuAhpac
o6qqrq+wsK+xr6Snn4l6fXdwdHZ2eHh/gH+ChYSFhIqNlouGhYqIgIKGk5GRkpyfmIyFgYSMvHxZ
Xm10a26admFrjXlzlZiTjYyRj5KWlY+LioaGjJisr7GvrLGqqq63zsK5uLm1s7a1s7Coo6SjprW7
t7i5tbq1t7a+xbO2s7O4uLazqaOYi2tUTVBYb4mYqLO2urzAuqqYiYSDhYWFjoqEgX1hRUFKV09S
WV1mXFZVVFZeWVhWV11YVlBXVVJVT0o1JSIhL1hteoCGhouPlZWYqaelqqyqrrKtqq+tqqqurKmo
rLGztrOzra+xsq+tqqSps7azsbOur6y6ppiWlpWSj4+Pj4uMi4aKhXd4eG9oaGJkYGJlYV5kZmRd
UDslGQwEBAUBBQoKDQ8QGik1OkZXWFtZZWlrc3+BiY+VoKOYoKGbnZiYlZWXj4+Rhnh0hpqnrrGz
vMPFxcO8v7u7tbGhloN5dnuPlI+UlJGTmJ6doaGhoaCdmJKGe2RUS0dQW4STj4uPjY2UkZWTkZqY
j46MkoqFiIaBg4aRpLGztbi4ta6xsaqmqqaempaOjIR7b19OSkRCS0pQVFZOUEtPUFBZWGeGl5ul
rrqzrLC3tbW+sKitpqahnZePjI2Lg3lmYVVQXmp3g42Ggn16dnZ0ZGp2d3d6k6++w8jM1dfZ19fb
1NXZ19bW0svK1cm1rqyuqqeqraijoKSYi4OIdFxQa397dHZ7eXNyd3NtaWdWMStDbYubrrOysLm5
vMHHyMLN09nW09bX0dfZ2tTLvKyPb15kW2JoZn+PkY+czPHfsJqmrqmtrbOzqaixs7GzsrCxqqqs
raOdhl9eX2JiZmZqcG9qWUdEg4F9b2tqcnR0dHh2c3R0e3p5d3d9rLWJhaSmgYODjpGNiY6Rk5Sa
o5iVmJd5bm1yb2trbmtpXlc3IB8nKzI0Oz49PTw+Pjo5MzU7RygjN0ZKUFVeaGt0eHmGfX19dnR9
eHuVoJ6gr7W3t8DEwby/w8PFxcfHzNf017Cprq6sn5aEfX2EhoSBgoOJlJKPjIqNhoSFjpOVjoOG
ioaDfICAdmllaW54eHZ2e3yBhomEgoaLhpidnJySiYaIiYaFiI2PmqquqqqqpqyvqqGenqCVj4yM
jIyPlZJ6Z2VlammBjZKUnKWoqaqsqKmtqqOmwru2qp+alY6CYDMwaYSFhIKFhoiJiYyNkZend3J9
mqiooaeopaWqp6GfoKCjoZiamKCdl5zI3Zh5dH2GgoOLio2Uj5KUko2Li5GXmJiPiYWFfXZ3gIGD
houMjI+Pj5Wam5qco6GfnaWysKmprK2uramsrrCspp2Sj5yxs7aztbGvs7Wxr6qsqqiorKewsLK7
0LeqqKWcj4qGj5ijqKeooaCdjnpra3yPd3FwdHt5e316eXdybmtxdHR0dnZ9dnN2eHp9hIuRj5SW
kY+Tk5SXnJiTj5SpuZidvp2SlpSarrqjnZ6hpqGhoKGalo6GcFxXW19pa25wc21qa21wc3h0bW1l
X1lVWWBkZGJlaWpwbm5vcnB2eYGGjoyOj46TkpOTlY+MhHRuZGJrbXB4fHd6fYCAfX9zcnR7hqGu
sLCtrqylrqqmpqilpJ+gpJaEeXN2gIKSn5yeoaOlpaGkpqahqIuIoLO5srO2uLO2uLe4t7azrayq
r6+uraqko6anrbGpqK6hlpKYnqGps7Wwqa6sqqObj4Z6YkxAOzg9QTgyJhoVERcjKy8wODw9ODU1
MiwsLjJGUFlhYV9iZGVnZmVla2tvbnB3gI2ToKWnqq6urrWxqqWkno2Bd3SSd19faG9yc3d7inRp
Z25tbmtmamhrb3J3eXt9goWBhIiDf4GDiYaKqKGepKqppaSor6mnoJudnJaVkYFya2trb4iWm5yY
m56fmJeTkpWTmp+mqqekqK2u0q2Wo8DDtri8trq8trCyurO1sK2nmIKDbVxnnJ2Kg4OEhYaKfXZ2
d4aRo7zAvLuypJ2Ggnx0enRocpV5cXSBhZOdnqCenJ2YlIyIg4WBf4GAgouNjYuJgHx2alxOUFJS
XnmcqrG1srq4uLGwrbCysa+spaahk4+Jg4mJioyNi4iFhoB7fIN8dG1lW1lZa3uBg4aOjIh9amh2
x7Bvamhqa3BxfIGDhouKiY6SjoWGgnFpZE9TdIWJkZGWl5eSj4h5aV1UT1RQUFJVWFNTUFBecFRM
XGhraWttcnd7goiGiouMkZuPgYF5dGtiYGJib4KDhoaMj4qKj5KYkY+IeGJhgqCkqrCsra6xsbW4
s7Cqqqekp6GYlIaDj3h2eHmGi4+NjJqhmJadn56dkYFlZmlrc3d3fHxzd3h/iI2TrM63m5iOkY+J
hoyJhYSEg4SDc1xSV3JxZmViYmZlYmVobnBxenh0c2ttb2twdHJwamphWVNTXnJpaGVqa3SGhoSD
gYWIi4yKj4yAe3RlTUBATV9dYmVhYmJiWE1OR0dYYGZtc3R2dnt/fXyAhYaKjZWXl6qqjYJ5cWhk
YV1fZ2t6iqCnoamnqa62rq6nm5vd8a+PlYyGhouOkZaxlI2VpZyVjo+IhoSGgIKKlJSWmqGss7ex
rq+jknSUrK2zuLOzs7azqqyuqJqUhICDjY+YoaGhn5qYl5ufnY6Kk5GJhICBn8KlZ01MVVNORkNB
OzxGcJJ9doGChouKio+MiIqIj6ekrMWvqa+tubGqraqooZqYmI6GfGhNRk1MTU5Xcn2Ml5idqa6w
sKqqqaefn6CPaGJydnNyc3R2eH19fYCCgYqShoSNi4iFhYyMjZeWk5SSkZWSjYiCfY2EbmFphI1/
b4h4bm+Yemlvc4OKioWFho+Pko6Jjp2hrLm2sayqqqynpcLCvLu1trOvs7Gxs6qmoKiwuLKztbi8
vLO4u7q8vLazsrOura6poZyeoGBPWHGBjqGxt7zEwcTIv7mvjHqFiI+NiIaAfGRGQURGS1RYXWBc
T05ST1JSVFRXV1RSUlNTT1dPQikeGh8sRmR0gIOGio2Sl5yxo56nqaiora6trainqqqorK6wrrOw
sK+ur6+traemqK2zu7OysbKura+fk5SRkZSPj42MjYaCgYCAeHl0bWdiW1lbW11cWV5fXF1VQSUY
EQcCAAQIDA0NEBEcKy81Sl5YWGB2cXB0fIWLn6+qk5adoZqXk5WWk46OlJ2Je3+SnqOnqrKzwsHC
w8XAu7WzsqWWiXx3d4iPj5GMj5KTk5uhoaGeo5+ViH92aFxVTk9Xa3iDhISEgIaLhoOJkoaCg4OG
gn+Fg4GAiI2kqq2yrrCzr6ipqKCfoZyYj4+Jg4OAaU5HQEFFQ0xSU1NTV1VQVFtgcYWVnKCpsLGs
rLGyucK5s6+qp6eknJqUj42JiGtkVlZidomUjo6LhYOCgHdydICAgZKvwcjN1NbX2tnZ19TV19fV
1NTOyczDv7y2qqenrKqus6mjoZOMgnpbPjk+Z316dHd3enR0dG9palUvJ0Frhpilsa2vurq8xcjK
zNLT19fa19LX19fT0su/qZFyYWFkZGJ4iIyRlJuenqCmrLCxsK2vsbOxs7m3t7Wvs7esrq6/vKqf
jn1raWRlYml/X0tFSkZ9eHZmXWZrbW9vcHl0d3h5cnJucWt0enp9gIKBhoWJjIiGi5GPmJ2YmpWO
io+KjZiUkomRr6pdUEYnIyovODU8Q0pKRklFQkE8ODUsIzVDRkpQVF1ha3N4f4F4dHN3e4CCj5yd
mqSytq661MrBwcDExMLExMfHw7+xr7uzrqOclIqDgoaIhoylmoaGfXlwaYCLioyPiIyJhpaJgX19
jXpzYmtrbXNyb3R9fXp8gH+Ag4KDhouPl5WGgH+ChYGCiJehoKepqqWjpKapoKCclZSPiIaGhYuO
gmhkYGRuf4aVlp+lqqyqrq+moKWnoaaoprWxmI+MhnRQKld4fYaDhoiGi4yLjo+Ok4+CeY6fo6ao
qKampKqsp6WhoaW2npaYnaihnZ+XlIiBd3uAhISFho6RjI+NjZKOj5OUk4+Pj4yGiYB/gIKAgoGE
iIiLj5SUl5ebnZqYho+lr6+jpailpqaqqqmus5+PqLKusLOzs7KtsrOura2opqipra6wrLK1t76w
qKOYj4uDgpKanaWfnZaSemZiaWhtcHBwcHF2e3l7dG1qa3Nwdqyec3B2eXd0fISJiYWLjpORkY+S
k5eUk5OPl5eXlZWdmKCboJ+epqahqKOkoZ6joJ6bmJp/YVxcYmhtcnBva3Zxbnt8dHRwdGtmYWFZ
X2JnYGJkZWdpbnBvcHN3fIaLjIiGio6PjIyPiYR4Z1xeZGtwb3R3dHp9fH1/gH18eXqNpqytsK2l
qaeqqq2nqKGcoaChm415dHp9hpaboaakqKasraqoqqibho2qqqqzsbO1trW3tbm5sa2tqqmorbus
mp2hoKepqKann46NlJeboaeys6+zsK2spZ2ViHliT0I+Pj08ODc1LCMdHyMmJyYnMDEsKisrJiYq
NUxQW1liZGVnYmJiaGlpaHFwdHh2fJGsqKGhn6WprKqsqqqag3hxdH1uWVhnb2prYl5gZGJgZm19
d3BxcHR0dnt8d3d8gYKIoIh9goKDhIWYpqqqqKmvsLGurKijn6OgmJKYmHppaGpyiZaXnZ2dnaGY
l5eWlJWXnKSnoaCkpKemqamsrLWzu7i6tra4trizsbGvyuSjfYx4e4iYj4Z/g4aGho6Ce4COn7vF
x8e/t7Czqp6KiJGSj4mKj5ySk5WYmp6enaCjoJuXjI+PfXZ4e4OKjo6NkY+IiYB0TTQwO0dWcpqq
s7K1ubm5s7Oysa+vr62tqKSajoqGjY6Mi4yOiYaOgYF9gHtvZ1JSW2F6ho2NjpGOjIp3cpTt1m1Z
aHJxbnF7goyPj4+Sj5aRjo6JgnRxbmd6jYyNj5KUlZKLgXFdVU9QWX1kV1tbW1lVU1JOS0ZJVFxh
Ymdvd3l9gomLi42KhYOWgnFvYVVKSlVrf4KFiYuPiomPkpOUlI9/d2BwlKizs7KwsrGxs7Wzrq+o
oKChmJuLe3d4dnl7f4GJho+TkZemoZ2empWTkW9maGpxeHd4e3x5fYmTpZKLmJKUlJKUk5OOiYaE
e32ChoF4W05bkoFrZ2lqbXFydHZzcnZ4gIN/cG1rbXJ3dnRxbmphXlJZbmVia2lvfYmLhYaJhYaP
jI+Tj4iCdm1iTEdZYmRiaGJgX15dVkxGRE9zgnx9enlzdHuAgIOEjJOWlJufo52Yj4uMdGFZWFtm
a3N9jqOloaGmrK2vpp6Xm7Oxm4+WioF9fYOIiJKWk5OWl5KNjYqChYGEhIuPlZymqrG6vr/Etqih
lZalrLC7urO2s7a1r62ooY53fY2Ym5iYnZ2an5+YmJuNi4+RjYqAeXeNfGJcWU9QS0VEQDg7QFtx
iHR7hoaKjpOPjISDho6Xm6SosKyup6y6qqSppaabmJqWjIB4bVtOTU9LTlZvgImVm6OhqayzrqOm
oZ6XhmtWWGt5dHB0cHZ8goWFenx/hICAgIGFiImNj5WVlpOUjouSi4uLhYB8cm5udHN9fHh0dHRv
cW5pcHFubnd2fIB8f4WLjYim9Nazr7OwsrKsramnqq3FwbOzyMGzqaqooZ+gqLCysbO1t7m3ure2
srG3t7eys7CsqKehnY1uWGJxgo6fsLi4ucDDwcPIwrmVg4SBgYOJhYF6aEM8REpUX2d0e29fV1NQ
VVJOUlRWVFJUUE5OU048JxwcHipJaHZ/ioqJjI+Vmp+fnqGpt7Oqp62urqqpqqqyu7axrK+vqrCo
r7O6sKyqsLezu7yxsrWvp5qSlJGMiYWIhoSEhYN/gHt4dG9ranlYVVlVWVxZVllbWU01JhoWDAQA
Ag4REAwOERwsLjlHVFVZWWVpeYCEjZWkqp6anaShmpKRk5KTlo+TmIWDj6aonZ6mqq68vMLDxcC+
u7O1p4+CgHlzeISLjYyLiIuKk5aanZiVkoiBcXJrbWJUS1NvdHJ5fX+CfXt9gYCMjH13fH2Dg4OG
goKEjaGhpq2ws7OwramkqamkmpKOi4uGgntmUEVBQklPTExOS1BWVVhhYmRvhpSYnaGyrK+us7W8
xMW+s7azrKiomJORj4qMfWthYnSPmJiPjIuFg4SEf3p/hIqWrrzDx9Xb2tfZ2dfW1tfW2dfZ2tbL
ycG/uLivqaqsqq+tqKimm4yDbU0+PTxWdnx9eXh5d3h2cW5rXTEsUHKKnaqysLGxtsDFw8rO0tTd
4NvX1tTX2dvc0sGnkn9rX2Jib4qPjY6UmJyfoampsbOtr7eztre6uLzDurzJvLe3vrq1tbWyqpuN
e2tgW1JAPkFER3R2aVxfZmdqa3dzc3h3dnNxb21rZG1ucnp9en18gXyEhIWLiY6YnI2IhpSam52d
mJucl5KRg2RiYS4qLDA7QEFJR1BQUlVQWY1oPjQxPURMUFRTVVZzc3J5hndxcHJ0iZOUnpqersK5
trzDvMDDxcrHx8fDx8fFvLOxsLCooJ2TiHqChYiFipGGenNwa2ViZnmFjI+el4mKpo9/eXh5eHJg
W2JkeYV8g5yhfXd/f3t4e315kn99kZSCf4SChIaKlKCnoaGlpqmnoKCgpp2SjY2LhoaFg4N3Zmdt
aXacnpqcqbCsrK6wp6qooJ6bo6GgpqOllJGEaztZdH2Jj4+GhouPk5OPjIuSj42Tn6GenqOno6Wx
samnrKSmo56hm5idoJ6amKGelZODgI59fIaJio2Nj4+WkpGPk5WRlpSPkoyJhoKDm4h3eX2ChYuM
i5GTlJabk4Z9fZikpKSjpKWnp6Gqqq2wmqe41LWxtbO5tbO4urOusrCtqq6tqa3C0riutr+4qp6W
ko+KjIqOnaCYjHxlbWRlZWVqb3F0eH13d3Z2fHd0dHeG07N3a3J6gYN8fYmYqo+EipKTlI+Uk5aP
kZKXl5qbmJ2eo56bo6Ogo6aho6WjpKGdmpiPg4FuZmJiZm1ya2pqb29vjYZycWtwa2ZnYFBCQFBg
XGFmZWdqcXF2d3R7gYiFhImKi4uRjYqAiXJXVlxiaWlrbnB3enZ0dHaTnXh5f4ixxcG2sKqqqqyo
paWopKGfoaGbg3p5eYmqm6GsoaWoqqqyqqqnpJ6Khpqtqqyzs7Kzs7K7sLKys7Ctraehp6GhoaWs
qaSmp6aklY+PkqappayqrKmpqq2gnZWGgWlKPTs8Oz09OjMvMzAsMDAuKCcnJyknKSonKSwyPk5U
WV9fXl9fYWdra2tqbmttbnN2hpKVj5SYlZeanZqcl42EcmRphnNTT1BTX2RXVUtKVV5qcHZ3cnN0
c3R4e3x9eXR3gICDhn+AhIWDg5Kks62qsKyvsa6uqqikoZuemJWRd2ptcnSPn5+fpKGloJyblpic
lZahqKWgp6aeoaqqr62qrbGyuru4u7O1tbWysKrEwn9zhY+NhIWIg4WJi4mGjIyJkqa8yMvMxb+3
s7e2pZ6WkpKYk5aXm52al5aanKaqp6WgmJaPiI+MfX2FhIqRkpqPhoaFgXhQMCY1SVmGoKeqsrO3
ur+1srawrLCtqqyopp2TjYqMioqNj46Ij6+Ne3l6c2dcUExOaXmBjI2NjIyLjIN6vP3ecl5iaGtt
b3iChoyUk5OSlY2Ii4mEent8j6+shoKOoJuSjoF3dFlQTE9Zal1ZVldWXlxWU0tGQ0VDQU5WaHR6
enx6goaNlIZ5dHx2b3JcPjk8TV5rg4SBiIuOjo6Pjo6JhXpiWXOYqrKxqqqosLCpqqqvqamlo56W
iYWGgH18gXt5hoaPj42VlqmmmJyamKHCim5ncnp6f3l6f4CGjI2PkZWXkpSSlZOVmJyUiYuEfYF9
gHdXTmGFd3N0enp5eHt2dn+DgoKDhYB5dHBxb3d0eXp2c2hcTlBYZGpudHmFu5t7gYaKj4+TlJaP
ioJ0cW5kUnZyYmZqa2ZkYGBcU0NDV4aUjYZ4cnJ3gIaChoiLkpeXmKGkqqafmJOKaVlXV1xoc3uK
jJqlqamkqK6jnpqSiYyRkZOAdHZ5gIOJiI+Vnp2TkY6Fgn+DhoCAg4+XnKWyubO3wMCyrqqjlKSw
ubqzs7i3ta6yqqmhind8ip2qmpiYm5+goKWhloWIjYuJhH12bmVdWVNSSkJBQj44MzVBXGJteX+D
g4aPjouGiomJjJKboaapraqkqLCppqanpJuYmJiahHl2cWBQTEpQV219jpuco6qtrLOqp6WloJNz
XVhYYnZ3d3tzdpqGdHF3e32EfX19gIaNlaSfmJWYmJSPj46FhoR7dHBqanB0d3x9eXp7eXR2eG9u
cnBta2RlanBweX+Dhq7w17KysrK1sqqsraGhpa24s7Gzs7CtqaOkrKGkqrGwtbK1s7u6t7W2t7W2
s7Owr6qnpcW/dE1QZ4KPmrC8vsDExMXCwcC6sZqEe4SGhYaCfXxrSUFKWXGDiIiMi31lVkxJRkJJ
TVROTlJQT1JPVkw1IhofLE9qe31/hY+OlJSbnKGkpaSwqqyxtrCon6SjpKyzubeztra2sqyprMG5
uLa3t766try2saqtpJWPiY2Tj4iEhImEfXx4c3NwZmJhXk5QVlVZWFlZXFtbUDgsIx0UDAUGERMR
FhYaGh4oNUNSWFleaHSOlpqkrqqmoKyppZ6hlIuRj4WFjIiDgYqYp6ehoaCkqbO8wsDCwrzBurKq
mI2MfXB0e4OGhoiGhpGWkpWYnI6KhYB8cG5/c1lPT2JnZm50eHp6j390b3iBb3CGfXl4eYKChIaM
k5ehpa61sq+np5+gpJ+alI2PiYGDg2lTTEdESVhNTFBQU1VWWYV6Zmt7j5iepa+sqrGwusjfzsW/
t7azqaGgoZuVjJaSfGVrip2fnJeRj5GMhoaEho6PkqO4xMvS19zg3dzR1dTR19zX19fW08zIyLy5
sKynqKqqsbGno6Gfj4NwXEM6PFhxeHh4d3Z3dnRwcWpbNDFWdJKepa2tqq6zvsPEzc3S19vb29fU
1NrW1NDNwqyXel5fXmWBjo+PlJebnZ+hpqiqsLPRxbOxt7a2vMC6usS3t7nCzbixs7WvrJyJfXFX
Pjs9QENGfWRYV15hZGJmbm9ycnJva2lqaWZnZmJlZ3F0d3Z0d3N4e319ipeWiYaUlpeYmJygnZeW
lJqIcFtALysvNz5ER0xTUE5MT1hSTUdDQENDQ0RJUlRZWV9gXmuGgW9tc3SAjpyeoaG1uMS8xcO8
vMnK3M3Hyc3MyMLQxayqqqick42CfYOFhoaEfXt3dHFtZmRicIWJiY2NioqGg3l3eXNwYFZeZmt5
jHt/j42GfXx3doB7eXNxcmJYQVN6ho6LjpOXqamho6ShpKOkoJ6YmJqRioaFgoKIhnNocJqDhZuy
06qgqamur7G3r6ijoZePlpaVmpWPlIJMV2t3fIKGhoqJio6Nj46JioyNi4+Rl56doaGpo6qqp6Wn
paGkoZydnZWcoaCfnJ2ckYh6dHl7fYWIi4iJjI6Nm5iWkZGUmJeVkZKNiYSCeXR0eYKChoaIjo+P
lZOIdnJ4hpifoaSgnKCgpaiuspiSpbazsbW7vLy7ubizr7e3tbGqpqmos8G8ura3ubWvraidkY2F
dnF5jY90ZUxOWWJiZWltdHZ2dHR3eHNyc3Ryd3l8e3p7gIaGhn18gIOMj42PkomKjZW1oYmPkZeY
l5acqKWmoZqgnqChoaSho6ejmJqak4Z2aWdnaHFvZmpobmprb29wcHF0dHJxb2ptZkc4OkVnYmJk
Z2tudHN0eHl9g4F9fYOGhoiGg4Z9YVBSYn1rYmhrbW90dHl7fHd2eoqLobq7u7uysK6lpaahoZ6h
np2hoJyFd3Z9nZ+boJ+foae6sKqqr6ilnpN9hZehqrCvsbOytr/As7C2r6ioqqehpJ+hp6qqoKGl
pp+Tk6GWkqCsqqGmqqqqqKWcmo+EYk5CPkA5Ozg4OTk1Nzs+QUU+Qks8MS4sKigsLC44SlBYVllY
V1leXWFiZWpqa2lla3OEjZKPj4+Si5KRj5KPhHdkUFBTUFJTUFBTV1BMSkdQZG9vc3l3e3p2fX2D
hYJ9en16ent9dnt9gImOn6auraqqrLCsqqadoKWhn5eUj4t3aW1rb4qYnJ6fpKahnJqbmJibnKSh
oKSmpaGhqaiqrK+prLi8ubi5ury8t7ezoZaPiIaNlIqIiYmJj4+Sj46Pj5/HzsjJzs3HyMS/t7Wz
sKempZqVl6SloaewqqShpaShnZ6Xj5KPioR9f3+GkpKNlJKRkY+JfWI7KjJEWLG/naGqqq+4tq+x
truzr6iqsa2nnJKPjY+Pko+Rko6Gg4R5d3NmV0lGSVdweYCIj42Mj46Pi32F27tvXmFoZ2lpcnuE
ho6Oj5KbkYyMjoqEhYORl5ePjISMj4p9dHBiU1JSVltbWFdWW1dYVlhXUkRASj07QFBxdHJucnh8
f4mGfXd6enNqlHk1KzNEU15xfYOJi46Uk5WRjYh6cWhrfZqxtrKusKympqqqpqmnpp+YkouEhXt6
gYGAfX2AgoOLjaGYj5ydmpiTm6SCfXJ0dHuBgn99gn2DioyNk4yPkZSSlpOSlZeRiouGgHxxWVVZ
dICBgYB6fH2AfHx/hYWGhoqMjIR6d3Z3ent7hYF/e21ZXWRla3Bzdn2TkoqKio+TkpKTl5ePhn13
b2dcZGloZWpraGdoZGJbVFhieIWCgXpycnqCiIiMjY6XlpufpKOnpaCYkY2BZFlZX2dwdH+GkZah
pKOhoZ2doI6FhoqNl492cHSAkZSJj5Slm4+NjYaIg3+Af4mMkZagsLW2v7y/vL6xrq+fn6qxuLq7
vLWqrq6qpJiFg4SOoJucoKGgnJ+empeRhHx7f319fXNlXFlQSVBOSkE6OTkxNDVAWW6Een2IjIuG
hoqMinp7jJ6hqaytr7Guqq2ppaGjoZiXt9mSdHB0cFtOR01Ya4GNl6WsrKaloaWpo5+fnGhUUFZe
aGl6qYZ3d2t0d3Z8dHR8e32Bg4iapJ+eoZyYm5WLiIuCeHRzcHZ6dHd2fHt3enuBf3h2cXJwc2pq
ZWZmXl1ZZn+GmMC5srm5s7a1sammp6GfrrytpK6vqaeppaGhoaWsr7G1tbe4vLq7ubOzsbGxrbCv
sKqloYpfWGR2i5ejt8LCxcPFxcrLyMC2qZF8gYaCgn+GjW5PVGeEjJ6Pj5SSjH9qVUc+QUZeX1lT
U1xZV1ZXV0EoHx8pR2l0fYSJiIqPkZieoaGenqilo6WoqZyhqJicqc7Btbm+wcS4wbaqs7u8vsPC
s7OzsrKxvrihmJONhoSIiIWAgX15e3dybWhlXVROTkxOUFNQUFBQUldUTUMyLCMVDAgLDhAUGh8d
GiIwPVBYXWJne5KYnqWnp6eur6imo5uYkZGNi4yMgn2InKSopqmhmp6mssm8vLq/wcG2rqqlj39w
c3R0eIOAgX1/hY+NnaGShn98eHFvbW5gUlJNT1RdZmJlamt7a2Zma2tvbn17enyAgX18gIWPk5Wf
o6avsaympaGhmJqYkoyJhp6qZ1BNW09OU01OT1JVVlVbamJiZXqUmpqbo7awqrPD1trQyMPDvLOn
qKicmJaSkoqAcn2WoaGhnpiXk42OioaGjJWfrsHU3NbV2+Db09XX1tTX19fW1NXXzMTFxb+zqKWp
sbG8376hnrmxhoF7TT5CUG55e3Z3dnR0eXNubls5NV19kqGppqmtsbO7u8TM0dHR1eDe19rV19TS
ztDCrY5zYV5oe4ySjY6Tl5ifp6qqqbCys8W8s7e8vry4v7q6v8PCvLnFuLW5vLOyrqichnRdRUBE
Tk1WXFJWWF9fYmRiaW90bWdmZ2JiZGRgWGFgVVdvcmtobXBzdH2ChoiPnZyYm6GemJ2dnJqUj41/
a1IwJzA5QENJUFBUVFRXVlRTTUZEQj0+Rk5QVlRrg11WV1ddZnR4doGVoZygpcXBsbm+ws3HxcvK
xcXMzsi+vsC8qqGknZaNhX2BgIODhn+EgHRxd2trbXSDkZyhoZeJgHp4c3Rxb3BYUFRUXGVrdnSG
dnR0c3ZwenxrZmhlWVJWV3eGhouSlJ2wqaGdo6Ghn52enKGcm5aPioSGiHZqaG9ncoGWpailrbWu
qaywubiup6ehjH99gYqYlYh8XGFtdHd9iIiJiIqIjIiIjIuOjI+Vl8G6mJOWoaShoJ+hpaeoqKWl
paOdmJuenp+foJiRkq+EcnR9f4J/hIaLjZael5iSkY2Rk5SVj46MjYV7eHp8en19gIOGjpGRnbyC
a297iJabmJyenJ6eoaGalpymrreztby1srO6vLy3s7GvsK2vp6mvtba3v7i1ubavqp6YmJV0aGt4
c21rXlVWYGlmZm9xcXF0dHZzdnp4dH19eYCAhpicl5WPkpOJgYuLi42PjpGOjKacjJiYl5aWn6Ge
oaGloZ+bnZ+hnp+gpaqelI+Mf3FpaWtra2Jlb2pnamttb3F3dHJ2d3ltbWduTDU6QldiYmdrcW1w
d3Z7gIaAX1ZZcI2KgHxuYm1fU1diYmJoZGJram90eXh0cniDiaGzs7W4uriysKqhnZ6emJybnqCe
lX97eXuMlpqhoaOnrbGtqaGlpKSej3p3hp+sqq6ysrW2s7mysLKqqKWloZ6WoJ2hpaafoZual4F3
eHyJo6WjqaqoqqGkp5+bkYN0WUlAQTw7NTg1NTxCQ0lLT1NYTkVAPjs5LCsuMC81R09UW2BbWV1f
XV9ia2tnYmVnbXiBiYaIioaGhYWEfX1yZltTSklHSUtKS09NSkpJUFllbXJ3en19fX2EhomaoX9/
j5GDfHJzf4GGjZWlpaTLyKmorrCqrKmop52cmJKOjHxrZGpxjZiYmqOnpaOenJ+dmJWfp6qloaGm
p6iloaetp6ehm6m1tbKzt7ezs62gjoKPko+YkZOOjoqLiZOPjpefs8HLyszMxcjFxcC+vLiws7Kq
qrrBwrGqsrOzsa6pnJecmpiPjY+KgYSCho6TlZWWk5aPlZeMgW88M0FSZ4qgpamts7a3tbO1sa6q
qqqqqKOYkoaIi4qOjYyKiYaBgX15bl5KQUFGXG14hZGTk5aNiouOiXhwcGtramhlZGR3e4OEjpWY
p5iPjYuMj42NjYqWmKaqhI2KeGtoX1VPTVNXW1xZV1dZVVRZVU9GQUE+OjxHT2BmcHR0dHJ9hIR9
koZ9cmtlVDs1PUtNU1tvg4WKkZGWlo+GgHZ2cHR/n7O3vLCqpaqoraGdnqOgk4+SioSAfYB9fXt7
eXt9hImLi46UlpiVkZaWgHl8dHl8f4B/gn9/f4SJiouRjZydk4+PlJGTk5WTiZKfgG5YU1x5goCF
g4WGg4WEhYWCho+NjY+KhoJ7c3R7hYB6gIWGhHxya2hvcXR9gY6PjYuNjpKXmpqYkpGKgn1zcGJY
XmJqb3Jta3BqZmRiZXF5f4SBd3R0e4SGiJKRmpyYnKGoqaOjoJiXkop2YFxgbo1/fICIjpKUm56j
nZ2akpGSi4+PhHJvdHuGj4iLj5SYkY6JiYaBgYKGg4mRmKSzurzEycC4t7W6uKaXpbK1uLyzsrPA
u5iKf4aGj5OanqCfo6Ghn52clY6Jdm5lYGBmaFhUUlBLSko+PTg4ODIxMz5fc3p9fICDiYmJhoV8
cnePnqGnqa2tra2tra+qpaWhoKGkm4mCgXdxZ1xNS05feY+lp6mmp6OhpaOblpF6X1VbYGZobnem
gWprbnRyaW1zdHd5en2Gk6OnoKOhmp6fnI6Phnd0cXJwc3mAfHl/fX+BhIB2f4F7c290cW5qaGlc
UlNZdISNqq+zurizsrKqqKamnJ2muaajo6CgoKShmJi5ra2ttbOyt7q7uru3trixrq6qqaejoZuP
a15kdIWjwLuzubzDx8XFx8fKxcK5k4x9fYKDfYGCfHR9iJqam5admJSTin1qUEE+PktTWVlfX11e
XVlmVTMiIyhHaHuEj4iMj5KXlpifnp6epaeqqKWfk5aaoKGhtb+5u8TBvLO2s7W3uLa1trC2t7Kx
sLGxsKeci4aJiYaGhoN/gX16d3RtYl5bUExJTE1QT1RSWFhWWVlSUE1FMSAUDA0NDhQZFxoaHyk1
SlRcX2+GkpqmrKWpqqmuqaeqqp+gm4+KioN6epGmp6Wgo5+Ulp6w0b6zt7+5sri4qqGMfHR0cG5r
b3Jta2VrdIKhrYZ5eoF5cHNva2FXZFBOT1ZWWV9hYWJeX11gaHJraW1zeoyEe31/g4WMk5WcoKet
r6qhoaCel4+LhoOBtbNmTVNTR1BQTk5QUlRYXVlYX2RocIaXnKiu4M6oscnSztDWzcW6vLauraOc
mJWPgn+LnqSoraGamJqUko+MjI6Xn6Syv83TzcvS2tfT1NTS09PM0dPOy87Qy8K/tqyjqqqtsLHL
s6OcqqSGfXhoXVNWaHB0eXd0eXd0cXFwako+XoGcp6mop62zs7e4wMjN0tfZ3NnZ2dPOzs7OxcCq
j3RgcHeJkY2Lj5WXmqCkpaaur7W5s7i6vLy+v8XHwb7FycfFwcPCw7nBuLW3sqebj3teR0dWT3Ro
UElNU1xdZISOcWtoZ2RiXmFgXVxbXVlUTlleV0tER0dgcX+Op5yWl5ydoaGen5ucm6OaioFrWTUy
NT1HXWJQTFBSVF1iU1ZlU1hOOzk+RUlPUlVYV11ZWVlfbm5xeI6bnZuos7WzvMPBxcXHy8nEycrC
vLq8usKsp86zhXl8fIODhIOBfHl2dH2gg32Fho+doZ6dn56JendzbmuGUDFDUllhenZub3FwbnFw
cIZ0bWhrYl5zfGJcepipmI6dnpWXnJ2gpb6hkpWjqqmkmpeVkomDaGJmZWZ0jJihpaWvtq+tr7Cz
rqesqp6Fa2llcpF0XVtweXd6jIJ9gY+NiomNjY2SioWBj5OUmpOPl5udl5ymoKCeoKCjoaWqoaOz
scG+taCYlZGGdmR2in2AenR4pLGEiI+Pk5eRj5OYlZOPk46IfH18fHt/gIaBgoqPlI57dG1zfXd8
g4+VlY+Tl5SclpibqLmys7m3uru+vsDAy8K1sbGtqaqkqbCwsbO2sba8t8u7pZ2bmndnbnBtcm5r
YlBTYGJmZm9ycnJydHZ0dHB2eHl7gYSIj56hm4+PjYyTiYOCiIWEgoOLjIqNlZWSkZegnp2goZ2c
mKeeoKGdoa+6sqGYfWtqbnJxa250bWdnaGtrbm14c3JzdHR3fYJ6bmZXODJCXmloanJ4d3R7g4N/
fXZbUFVZaWleXFxfZHB4eXl2bmtpZmFkbnF5eXd0dnySpa2zuru5srWyrqScl5OemJybmpuhhnd5
gIuXnqiqoKGpqKakoaGgnJiTgn2BjJissbCusLGys7Gxtq+mo6WelJednqGkpp2emox9dHR2c3uV
p62lp6ysrKysqpaTjH9yYlBHQDs5Nzk8PUNHTkpOUk1KSkdCQkU5My8sMTU5Q0pQVFlbYGJiZWJh
YmBdX2Rna3eGe31/dnR0cnd0c21nZmJOREJGR0pQU1BPTlBWaW1udHR3fX2Fg4iYhICIjZGSjYaA
gYuxj3h9jqasqqmoqaetqqioqqWhm5iWmJSWgGVmam2CmJ2Tmp+go6qjn5+goaSjoZ2gp6OhpqOj
pqinoZqYmqe2tq6qrLOxrqGFiZOSmJeXlZOPjpKUlpOTpre+xczR0c7WzcXHxcjKv7q6uLi+wMS6
rrCys62xraeYlZeWkYqKi4R9hZSMj5KSj5iYlJeYmJOEeFM3QU5bd5ujprK1wrqysLOyr6qoqKil
nJuPiImGhoiKi4uMiIKBgXNlTkE7PkdfbneBho+TkZGSj4h2bW1paGtqZmBgdIN2cn+GiY+SjJGO
kY+Pj5KOi5SdnoR5hX10ZllOSVdpVlRTWFZYWFVXV1RQTUdCQEE9OD5LXWpua3B0en2CfXiNmnhp
aGZdQzw9RU1VV114iYyPjYySlY2EenNyd4acsLbEtbChoaGfko+RkaCOgH+BhIGAgIGFgH2AgYSD
hoqPj5KWmJeOi496Ymt4fX+BfX1/enuAiYmJjoyKj5iWk4+Ul5OPk5KPobKGZllXYX2CgoSLioaN
j4yIjY+NjY2Sj4uKiYN9enmAgHqCobGJfYBxbnR0fIuKhoWMjZKXmpaWnpyXloiEfXtzal9fZWlt
dHRvbnR0b25wd4KEg4B9f31/hYyOkZSVm6CjpqWqrKShnJWTiXxtZGRrf3d9iYqOkpKSlp2dmJ2a
lJqUjIqGgnF0d3t/hY6UkZOUi4iGgn+Af4WJj5GYn6q3ur/EwMG8tbKzsJuUnKessra1raWcjHl9
hI+asayemJqfpKWdlpiXj4BuZWZgWF9dXlhTTltXQDc7PDs6OTQzQHp8cHh7f4qMg4CCfXlvj6qb
mJ+praypp6qqpqWfpaGkvJiBgH17eHR2cVhKT1+DlaGfpaOloaGcnJWFc19cXGRhZWptcHB3b29u
cXNycnZ4eHR5gIiVo6efoaWhn5qelG9pcIl0cHKRj318fIN9goiCgoB9gH18e3l/cG1oXVBWVF52
hYyfpq+wr7Oxr62nqaGcm56Yip2gnaWemJiWk6mpqrPUwK6wtba7vLm2t7Wwsa+tp6GbjXBeZHF9
j6q7vLi3vLu8x8rFw8PCv7WblHx5eXZ9gYCAhIWPlZaaoaGdmJuWg3ZfTUE+S1lhX11gX2ZlXl1T
QigfJkdndHqBiY2Sj5aYmJSYmKGhnKGqqqGTk5aXnqewubu5vL+trbO2tra4xLu2s7Gws7Wzr6yt
qqmWhoaIhoOCf4J6dHZybmtZVU5NR0pQVlVTVVZUWFtYUFhYVEw9KRkQDQ0PFBcXGiIfISw+TFht
gI6aoKexr622sLKzqqymo6Gjmo+UlYCCmKWknZuhmJien6OwsK6yvLOwsKynn458cnJtcGtkXVRF
QEdbboaJhIF5eHJvb2pmXlBVRT5GTElPU1hZaGFXYV1iZWZrcHB2hH14fYF/hoqNjpieoaWtrq2q
qaGWk46IiYaIfWZZWVdUTVJZWVlbWVxZW11ZW2JvdH+Pn6zLwK+/0tbV09TTy8C8ubKtr6abm457
f5ShpqWkpKSfnJeUkY+Xn6GoqLC4x83Q0dXV1NbX1NHR0tbX0M7O0M3EvryypayzrbGxsbGqraih
nZaFdGlnZWVpbnR0eXR3d3RycW1oS0Rii5+pqqypqq2vs7zFwtLR2tfR0dTU0tDR1tLQxKmUfWJi
f4iLlJiVmKGbn6GnqrGwuby5uru/xcG8wcLEx8XN4Mm8v8PAv7+8xcGvrqeYjHtfS05PXV1fXVZh
ZGBphpVrX2JiX15eWV1dVlhiUkpJR0VAOTk1N0lqd4KYmJuXn6mmo6GcmpaUjo6NhnRfPTU5PURO
T1RSWHRbT09KUm5URkdCPEA+RkVLUFBQVVNQUlJqa293gpKWmqOvztPDwMXFxMTFxcnHwb/Bvri8
saSerIt8eXmBgIJ/hX92cnR3iYiPlJOVm52YnaPMsYp/eHBpXj4dIFBbWGVkZHBtcG5vcW1ucG9m
ZWFfYWJbWF+Fk46Xm5qXo5yYmJiepZian6aqpaGYmJiYlYxtYWJmcYCPoK+zsbGvqrGzs7Kyraqs
m3piYmhmZ2Zmam50fH2AgYaFhoOGi5GIhIaPg4KPj5KYm5iTlZifnJ6YnaOkoZyeoaGhoa64uLrA
vLuaiYF0b213eXl6amtzcoiqjomSj46RmJSVk5SPi4qBg3t2fYKEg4aEi5GYlYxzaXB4dnl8g5d9
fIOAhI6dn7eys7GvsL/CxLy2uLi+u7mzrKqpo6StrrKws7O2tby7y7uqp5yWemttbWtxfXiEellU
WGFiZWtrbW9wc3d5dIB/e3+CjZOhoZ+hoZiPj4+MiIqGhYaJhoR9gHSYmJSXmJyhn6mnn6Wblp61
p6Ceqq2z4LxxYmt2dHR0b3BmZWFmZmdrbm5xdHR2eX15fXdycWlPNTtZa2lzdHd5fH19hZiDdGhS
S0xPWVlZYnF0d3R2dm9ya2RiX2pwa2p3gXR8hp6ura+ztruxraqnl5OPmJyXl56enpyOhHx7j5qb
m6SqpqCjpJ6fm52cmKB/eHmFjKG7s6+usLC1sKqsqqmjoJSVm5iWnqOdlo+Lhnpra25ueI+goaek
paajpaikn5iTjYR7bltJQT47PT1CSU1PTE9TUlBLVmVOQTs0Li4rKiwvN0JUU11cXF1bWFleXltZ
WWJnaX95dGpqaGFiZGptcHR0amFTSURKUFJZXVhXWF9pam9wcnR6gYiFjouKj5iRi42Ok5GGiZiJ
eYKKsbWtpqavvK+qqbCqpaGbm5ibkoJyaWRmb4SYmJWam56eo6ehoaOgpKaooaSnpqeqp6Whpaef
n5yYpLypqqGbmJuYkYqcpaCfoJyblpeWkpKRlJWjt8PLy9DSzMXLzcnNzMXEvrzCwb7Iwrq4t7Oy
s7WqqJ6SlJeVj46Jhn+Ik5GYlZOam5ubnZ6Yj4uEa0Y6RlRoiZqhp7Cys66vsq+np62qoaGbjoZ8
gYOEhYiJiIqMjYZ2g29GPTtAR1drdISJipGSjomJhpN9aWdlZmdkYllLQFdvgoqSj4+PjY6JlJST
j5WXmJidj3yBemJZVk5LYoxiUFBZVlRSUFVVUnRtRz5GhotQQ09ZZGhrbnJ6f3x/fX19f3Zyal5H
PDxYWVBXaHmDhoaIi46Pi4WFgYGIkpyurbGwpqSflI+TioqNnImBgH1/fX1/enh9gX9/gomIjY6N
jY6Ti4qKg3Bob3Nye4uAeHl4eHZ8hYmGiIqRmJaunpGWlJeVlIyGiYZtW1tmdJWOiaCVjI2Pj4+P
kpeTj5KVk46Gg310c3p/gYCFhouJhHZxcnd8hYaJi4yRkZeVl5qcmpiTj4aEf3huYGBqa294enx2
d3h6f4F5eH2Ag4SAfYWGiY2Ompuho6WlqrCxqqShl5KGhX1wZ2lvd5WKhYONlpeVl5iboaGcj4aE
gX90b3JvdHyGjZWTj4uJhoN8cmtmcY2lmJifsMfCu7zAxMG7tq2kioOSoKCmqK+sp5R9e4aPm5zF
wpuWnaGkpKGampqThHRkb2JYWV1mWVVPUE9FOz1AQD06OT5HYnF0d3uCi4qCf3h7c2uGqpqapKWn
ra+wr7Oxp6Sgn7OXioSCgoR5bXOTdFVXX3qToaGgoaGgnpuWi3ZfV1ddZGVrbXJyc3Bxd4JzcW5x
b3Bxc3N4g5KjraahoainmIZxamdvdm9qb4aIhn+Dg4GGiIKLkoN9e3p6e3hzdGtgW1ZQXnKAhZWk
qrKxs6+urKelpaCWkoh2j5SYm5SRkpGJk52nrLOxs7e2vsC+t7Kys7OqqaOfl4lrV2Z8g4+fsLW3
uri8v8HEx8fEwcG7t5+Gc3J2fYmEhIKIj5WamJ+moJ6bm52Vg3BeUkdKVlxcZWJiYmBhW1RHMios
Tmt0en+GiYaMkZaVkZObn6WopKqlqJ+Ul5+fqLCyt7q4sKqzs7izrLO6s62wsLOysLO1s7Gqo5KJ
hIWGg4OAe3d0cW5pZGBVSkxJR01UUlJPVVldWVtZWVxVVU06IxQQDA8QERgYHh0hKDdJV3iNkpih
oKaqr7Ozr7O2ta6tqKGhmJSmiYGWoZ+Yl5yaoJemoaSnrKyurrCpqaSckn92dm1obWJla0czOUxi
cX2Ef3dycnBqYWJiSzk6PDxCQ0FHTU1TTE9hWVtiZ2ZpcHJydnp9goaEgYaNj5ueo6qqrKygnpeT
joqFg3x0eHBhXFxgYF5eXllZVFZTWFlbZGRqc4WYqKentszT0dLU0MzFxby8s7CvpqCej4iGlaOn
qaqqo6qnn5eVl5ygpKinr7nDzM3NzdXX09LTzs7QzszKxc3NyL/FyKmhxcylpaqwrq2ztaqek4J2
d4JtYmVteX12bnR0c3R0aGpQTW6Moa+spaanqa+vt8LFx8fO29fS0M7Q1tDNxcPDspV0doaPlZKT
l5WSmKCjoamor7azvMW6urzFxcTCyMnHwsXOxL7BxcLLxbvV4LOhnJWPgm1JR0lgYGRmaGtoa29y
dGhfXVxZWFlYWVZcWUpERUpJR0I7PEuGeGJrfY+fn52cnp2dm5ibmJiMjI2Je2A5NUlEREdKT1BY
XlNSU1JPTU9HQ0I8PUBDRUlMR01QUlNQUFKBe3B2i5ucobbJv77Dwr/AyM7Oy8fFu7y7uq6ljoB7
eXl8fYJ/fX15hnp9f4WRkpaYmJ6koKOenqSYj46FfW1lUDFPVFZZXmJna3RrZ2tqapiGYl1iYGBh
ZmRYWJ6fi4yYoKShpJ2XmJeXlZqhp6qup6Gjn5qWmIFxi3F8k5ykqa6wsrGvsLO1srC2rqWcgGRi
Z2tua2lncHt5dn2DhIaGjYyJiIaFg4iFhouTkZyYk5KYm5ecm5iXn5+fpKSjn5unuLm2ury8wbqo
m5yGio+TlY5vUldlj5WSj4+PlJiVlZiSj4+WiIiJe3x9fYaCgYiOi4+Sj4x0anB4eXN2dHSChYaK
kp6lo6GusrO6ucLDuLG5vL68saytsKqlp6mvqqqysrK3ubi1sK2qoZh3b31zdHZ6c3hZQUZUWWBm
aWtpaGpucnJxd32Dg4uUmqGorKWjoZqWjo+KhoaChIB9eWRiZn2PkpaRl5iWnJ+foJico6SfoKWs
oaSoio12b29wd3FvbV9ocmlrbW1pa29ycnNzcnJwc3Nra19QTGBqanN/gHl9f4GAgIOCcl9HTlBQ
VF5obW1ucW1ra2drbWdnYmFtbmhqiciknK2xs7K2s7KsqZ6KhpSTmJybm6ChlpaUhICAkp2bn6Oo
pKGloZ2blJaPjHp0eHmBjqGyrq6usKqts66qqJ6Vj5WUk5idmJuWi4iDf3d4cWlvfZyfnqGnqqmo
paOgnJiclo2EdF9ORUdHQkVHSkxPUFBQT1BWZU5APTc0MSwvLCkpKjI8SlRQTlhVU1dcW1xYWFtg
ZGRkYmJdWWJncnuTmHtxfWpOTlhicH2GeXFtaGdmaXF0cnmAiY2GiKGUiYaGhoaKjYmBeXZzdoCY
oaWkpa2zr6elpKejpqGnoZKGeWtka7zRi4SXnZignpueoJ2do6Ohpaioqamoqqihpqqopp2amI+P
j4qGhoqTlJ3J17aWm6SnpKCdmpyXlZKRj6a/xcXLx8jO0s3O0MzFydDLycXBxMPCwbqzs7W1rq+p
oJeUlZOSjIaGj5SVmpOVmJyho5+enJiUj4Z/YkQ+R1x9mKSz6cWnrbKssKepqKWmn5iPhn+BfX2B
iIWFiIt8ZVhhXEQ7O0FMZHN3hIWPkYyMiYWFfW5qa2llYmFgWD41dp2Ae4aLjJOOjZKVkpKWmJ6l
n5ubin15cW1lW09NT1VZWFdVVlRTU1BQYllHRUqX0qFdTF95cW52d3l/fX9/fYB7dG9rWT05Pmdw
UFh2eoGDhomJi5WPlqCkoKCfo6aqqqqonI+Sj4iLhIaCfXqCf3p4dnp4enl9fH2AhomGiYqOlZSM
jI2Gem54gH+GjH95eXt7fICBhYiLi5OWpr+hjI+Tko6OjIiGgXBlZGJne4OGiYyOj46PlJGPk5OU
lpWRjo+KgHl7fHuAgIKCgoOCd3Z2fYB9fIGFjYuMkZKVlpecmJWPi4aDd29pYmFrdH+Ki317gH1/
gHx9gYCEgoKFhouOlJSYnZuapaexsqqmoJ2PkY6GfXJqZ259k4aGi6SllpKWmpieoaGbin17dnBr
anF5eoOIkZORj4mJhX92X1JlfImSoKawub6/w8C8v7qzsaqdiYaJkZuerbGYf3yEipamo6Ogo6Oj
o6WhoaOdlIuCe2BfaFlVWVdZWFBSXl9PSUdGRkU+PUFkcHqBgYuhg3J6hm9oZ3CGmKOnr6+qpqeu
t7Osp6CbnZSTi4aCgXx5eJaBa2JvhZKXnKCdm5ybmI54YFVVV1licXJzkYt6c290f394cXBra2tr
dnp/jJyhoZ+enp6SgG1ocnJ0cG9rgISDhYaFhYOKhoyCjZR/en2KinRraGJkV1ZmdICGl56jqKeq
rayqqqWflouIcGJuhZqVkZKgn4iLl6WorbW2s7i5trW4s6yvqKSjmI99ZlVVbYKNn6i2trO2t7i+
wcPAxcXAvLuyn4l2a3KJi4WEho6Tl5yhoZifpKShnZeMe3RrWVdUVV5gYGRkX1xdUEk9NTFWa3B0
en+GjIuPl5qWnqChoKGopqWkn5yeo6aqs7jCv7ytqrC4vLOnqrCvt867rbGus7OvraqqnY9/g32C
gHx7dm5pZ2ZiW1NOTlNOUFZVV1hZXF1cW1lcWVVbU0QvHBYQEREUFBYYGh4jKz5PcYySl56oqqyx
ra6wsbOysa2vr6iblpqfqaCYl52YkoqPjJufm56nrK2oqaeknJqTgHpwaWZrYl5pVUE5Plhxf4B5
eHhxbWlia2BCLisxMzc6OD5EPjk9QkdTZV9cYmFqcHN2eYJ9fIB/goSLkZadoaeqqaObj46LiIaD
e3p3cnJ8dG1qaGtnYl5ZWVtdYFxhYWpxeo6hpay/19fR0NPV1M7EwLy4sK2sqpyFg4iapqapqqyu
yLqamqCkqKOnqK61ur/JyczIzdbU0dHVzs3Nys7JxMfIwKyknKGxraetrrKuqbLOqo+Jg3hzcGto
anF5eXd3dHJ0c3RrZ1NTe5ior62tt7KqqrC5v8PBwc7p18rR1NDQ0czLxcW2moaMlJ6Yl5SPj4+X
nZ2foaeytbrNy77Cw7+8w8XF29HCwcC+xczLxcW+uL/Bs6qqno6Bck1LTm5naXR8gW5mYmttXmlk
W1lTVFVbXU1GR0ZcU1JKQz1Hv/7mYlBrmKGemKOfm5yYk5KWlI+EiYRyYD46QEVFS1BOTFBQS0tO
TU1MR0dJPUM+PkFBR0VOTlBUUExPTldZZW97jpi8xbu7vsTJx7zDyMfEw8G/uLi2qpOBfHR0e4J9
fYGMhX2Ego6qsLKzrqqutrK4t8K5npKPlKmOcXyWW05VVlxlZWtrZ2dnZmVqcXJramFiYWJoW1hV
ZIaTlJiepKGjm5OPlZyjpqWtvK+dnaOhoJiclH1rc42Xoaaqqqepr7KysrW1trGpp52Ta2Jobmtu
a2hwd3t5fHt/hYaFfYCMupWAe319ioyMjo2JipOVk5iclZidmJigoaGgoamws7q8vLy/s7Wuj4uL
j5aUk4ZlSVRld42WtaCPj5KUmJeWj46Njo2FfX+Gg4KGiYqPlZaUknZpanF2fXFudIuOiI2WnaGe
pqeqr7m8vLq6vL6zt7u1sLGwo5ujrKykrbe8xLeytbOxqqqhhm5oa290d3BrbnJXR01PW2tlZWJk
aG9qbXJ3fH+GjJeloKGqqqqkpJiWj46PjoaEf25UU11tjY+Kj4+UlZuYipyho6ClqKSmpKOjloN2
cHJzcXR3d3RzZF9iaGlrb25rcG1tcG5wbm9wcnZ0b0tGWGZpcnp7fYB/gH19f3x6d4NwUFBVYGtx
cXR3dHJ0b29rcm5mYGBcVWuUrKixs7KzuLqxqKmllYOCiZaPkZ2eoZyboaOWf3yJj5ijoZ2goZ+e
nJ+doKGbf3Z8gIGDjKOssK6trqqko56Wi4KCfYaOl5aRlpWPioyatsmoZVl5rKGam52hpqOko6Og
pKSgmJGLgnJcS0ZDR0dJUFNQT05NT0pLTUNCPjw6Ojc1LykoKSgsNERHSU5KTU5KTk1SWWlmYmBh
Yl5iamt0e3x9fHlrbXJ2dJSYi4B6dHFuaGpub293fXuGk4uGhYiIjIqFhIWBgoF2joFvcHiRpqSq
qqSnpKekoKSho56Yj4R5aGR76P7IgYWms5eYnJqft668qZ6kqKaqqaqpqq2srqympqCeoZuKjJOP
m6OlobC1p6CgpailoZicl5iXl5GUvMnJycjQzs7OycfHx83JysrEyMTAu8HEwru2sbOyrKedk4yR
jI2Mi42PkpGTm56cnpydn5+gl5SPiot8TUBLXH2dxa2sp6SsuLKqpaWhoZ+Xj4l/dHh6fHt9goF9
g3NnYlJKRkBAQExhbXR/hI2Ok6CPhoJ2cXFtbWJhZGBPREdPZ3mMvKCGio6VkZibmJqdn5ydnJqW
iH9zboCEc1lOU1xWUlNUVVJST1KAk01KUGqChnpwd3RrbnFzd3l5end9fHx6cmpOOTU7RUdNVnKC
f4yom5WeoaWfoaSempqdoaijoZSNjI2Jhn94eHt0d3t3dniGenFvd3t5fX+DioiJho6Sn4yAfX16
f4aGhISGmI93dHJ2enl8g4uLi4+TlI+TlJWUlZOIg4KBd2dnYm95gYaGjI+PkpKVmJWRk5GRoJWL
i4x9dHZ9gYF/gH1/gHRyc3l3e32AgoiEiY6KipSTkpqfnZiOioGAeHJraoOEgoiOk4V9fH19goiE
hoaIiI+Mj5KUmJygoKWqsbGxqqeloJ2UkoaEfXRuanKCmIaJtbOPlJieoZ+hlo2Ggnl6aWJ4cnJ6
goaIjpGPiYaFe2VDRFlrfY2bp7K1ucG8v8TDtrOtoZefi4GGjJSflo+LhoqPlp6hm5+npKinpZ+g
oZeUj4FhU1VWWVxfXFleW1lZW11eU0lFREA+R1twhIaJiYV6eHyPcmVidoKSnaSqrayprbOqqayp
pp6YloyGhn1/eXd3dHh9gImOk5WWmJiam5qUgmtWVFNWW2eGene2oHFqcnSEsIxpa2tram5tbnJ0
gY2VmJGPjpKDcnBwd3N0cHR6gIaGhomJiouEjISBfH17fH13amlnX2ldWGJ0f4GTsKCYn6mtraqq
o5yUjnxqYnaJj5KPi46Nio6bnqGnsrOyt8C5sLKxsqmln5yDZlBLVGl5lJujr7Kzsra5ucHCwMTR
xby8vLOjim1ohYmEhYuRlZien6GenqGko6CXlpKLf3ZkWFRXWVteXF5gXlhQTUM7O0pianJ5f4SJ
jJGYnJ6foKOjp6qpp6mqpqWqrLGwt7+6t7OyrrW4sKqqqaq1zbyqsbWzsKqxrKibi3dyd3t6gHlv
ZVtZWFlTTEdHTk5PVFNXWFlZXFlfYGBfW1xYSTwlHBYUFBEXGB0gISoqNUxtiZibnKWur66wsLWz
sri5treyqaOfnZ6joZiTlpSGhISFi46RlZygo6isp6qnn5GBdnBqbWtlYoBoVEtEUHSEeXNvbnNr
amhrXDwuKCgoJSgqLC4pLC4uNUFYT1BZW2Z2cnB4goOBg4SDhIiLjpecpKynn5iPjI2LhYJ8fIB5
fYZ7dnZzcHNtYmBdW1leaWBgYWhyiZefqsrWycvO0tbRx8S8ubWzrqejmoCChpuqrKysr6qvqJ+1
r6GprqywsK2ws7i/xcTFxc3Nw8XHyMTFwMC/wcKtlJifqKqtu7Oqt8ysoaSWj46GdHJraWtvdnp3
dHRzeHp9d25hTFuNpaejqL61s7K4ubmzscDFxMvKzM7Lx83X08fCvLOcmJqgoaGak4+OjIuRmqSt
sLKwt7y+vr68vrzEycjMx8nKycPIzsW/v8S7v7y3rKGekYBlR0dPa2ttbmppbXJvb2JPTVdXWV1V
TlBOTEdCREVGRkZGRE3N/utqTmFxk56emJWXlpaYmI+JioiAen1eOjU5PkFFSkxQT1hTTk5PTVBO
Rz48NTc7QENER0lMU1BMSVBSTEtPW2uYwc68srW8xNnMvMHIxMC8ury6uLGliYGawoiIj5uKhoOA
goCNp7e8u7vCu7a8ysfI39OqlY6OhoSAd25gWVtgZGZoZ2JkZmZmZ2RiZ2pnYmBlX11cWVZcgZSY
oaWpoZ6lnpadmqWopa6yr6mlpKafnpyflHyLl6OnpKWtqaqqr6+xsbOxqKOfkoF5ZWVpaW5taW9y
eXt9g4OBg4WJhrPyzX1pcXuBhImOjo+PjI6SsJaTlpWYnJycmpelqq+zuLW2s7m4ubytlIiNlqOb
jIV9YltheZHCsI6Ok5SUkpOPo5WgmIV/fYWGhoaKi4qPk5GNfWlnbWpua2ttgIqNlZqfn5icqK+w
s7O5xc2/vr+6ubOzs6ehn5yfqqqxs7eyrbG4t66loJd0bm5xdG1ybWhrXT46QEVNVltbXV5iaGVq
bXByeoaMkpihqK2pp6+qpJyWlI+PjIN/c1tWZH2Oj5GNiYqGg4OToaakoaiqpaqloKCVgHR0dHN0
dnt6eXdiYGVmcHpqZm1yc2trbW1qbXFwcnh5hnxkbXJ2e3t5e319gISCg32BdFtTV2t6c3Bva3N0
c2tpZ2hoaWdhYWFUeJWcsLaqrbG1s7CtppuOgXp6ioySl5yfoaOfmpiGfYWRlZ2lnZyemKGjqrK2
yceXf3l9gIaKj5ynpaiqpaGclIaAdHR2cHeTlZSUlY+LjKDb/uxzSWuvmImVnKGgoJ6hnp6suM2j
lZSMgXFmWUdGSVBQTU5PUExNTERGR0tJTEdHRUZEOi4qKSwqLzM9REdHS0lGTFltdGpoYmJhYmdq
anJ8fYJ8enNrc42Gi4uIhn93dHNraGlwdHd6eYaBiY6MhoiGhYJ9fXx7eHFlZWRqcYyhpaGhqaep
oaOhn56al4uKgXJiXWq1/fabeoySlpyXmJukn6OnqKyssKmts62prbCzsaihoJualpebm5+mpaSp
p6GgnJ+oqaamnpeblpKNjZGnw+DRxcXLztDRzc7JxcfFwcXFw8LDwrm6wL6zsq+pqJ2Yko+Ro5GI
iY2YoJ+bnqCkpaWjn5iWlJWNhoV6cnB9jpaboKCnrKqmqq2trKWjn5GGeW99gH15e3x/hIadc1VP
WU1GSVBPTl1pcH+EiIyNl4uCfXhzeXd0bWBfWUpMZ1lZfIWFiYqSkpGTmJeYmJean52hn5yThHhz
dHx/bl1YVFBOUE9SVFNXTElHT4KKf3x6d3JramZocXd4eHZ4hYmJgYyEZ0A0NDxCR09ZeHx7quv0
6MWknZ2loaWhoaGgn5qWlouIhoB8dHZ0Z2hrbXR0dHx2dHJ0eXp8f4SCfX2AgYGDg4F8gnx9hoWK
iYaGhoWEeW5xdn2ChoSJjoqOj4yNjI2OiY2LhZGaa2JiZm99hImOkZKVlZGWmJaWk4+SjYmMo4Fq
anF/fHR3e3t3b3Bzc3Z5dHt9hIWGiYyNjpKXlpeYmJSNiYF2dnd0fIWGjI+Si4iAgICFhoSIiIOG
ho6Rkpiamp+jqqmpqqmppqahnZWTi392d2trcHZ8hIuPl5aal5+yp5uUk4yEcGVdXmpkbXSAhICG
j4mEfX10UzxBWGZwfYyqtba4vMPFwsG8sqqYj5GFgoiOjI+dmIOIjJSan6GepKqmp6Sho5ubmJGR
hG1cW2BfXV5eYF1ed2liZGRgXllTR0NKWHR/hIaJhH19fXhxX1lmf5agpqqqqrCtqa6zqaqqnpaT
jYyJgXt8d3p6e4OGjpGPmJqanp2YoZF8a1hJR09daHNvdHx3eol8enmLe25xdHJxa2ltb3BtdHd2
dHJ5em9waWlze3FvcnaDoIp/f4GJhoCBgIB9gIB5eHFrZmJgXV5QWGt9hoiampieo6aqrqyjpZyM
e2BieYaMjY+PjoqFgouWoaawsK6zuK+qsK2vpJqShl49PVBqhJOap62tr7W1ubzAv76+wMTFw7u4
t62KbnGDiYyTmJWXn6Cgp6mkn6GhnZuYnZSGfGtgWV1bXmJfXl5rdFNMQT5BR19na3aBiY+VmJiY
nqGko6amp6qqqqeora6qr7Ozube3s7Gxury4sqqosLO8s7W3tbCzsbfCsbF9ZGVlb3J6cmtmW1RW
XFVQT0xQT1RYVVZbXVthYmJiYGFgYF9TRysaGBMVFBgYIiYrNTM4R2mGlJifpKqtsLCysbKztrm8
wrqspKCcl5iXlJ2dlIaGhISBgYuNlJqfpaqqp6ijnIl0b21vaGdqaWJYVVBSZnZtb29uamlrZF5D
MSwmJyclIyEeHSAiISYqLjA1QEtVV2FpcoyGgX+CgoaJhoiJkZ+hppeWko+MiYmKhoSGjI2IhoKC
f3R6oY9mYV9bWVlnW1dbZHSPo6Go19nBwsPF0NDJx8K8s6+ppJ6OeHZ9iaCqpaWloaChpa+qpaWu
s6mpra2urba4usHBwcfDvry8vLizu7m1uJGGnaWlqK/OwqyssKigmpiTj31va2ZpZnF3eX98fHx7
e318fGJMUnmemJKoysGxtbu8tZaWwMy/x8jHzMnK0MvNy8C8sKqzqaamoJ+VjYmJj5WasLGus7y3
uLnAura2wsG8xMXHycfFzMTAwsPAw8S8trOknpSMfWJNU1dpbW1ya25vam5waV1KRUVMTkdKRUZH
R0dJR0dFQ0NFT6z73GFPZXR9mJiYm5yVkpqWj4mAfZN9a2VOQDw+RUdMS0tMT05PTk9OTkRBQDw1
NTU4Rk9JS0lKS0pMT1BOTk5Scqm8u7a2ury7xMXEwcLEvrvAv7Wxs6GEfY2enp2dnpuUhomlsqOp
t7/DwL7Qx7W3xMO4ubzQo4qKiYN8dGheX2ZpcGdnYmRkZmRiZWVkYmt5aGBbWV9ZWXONkZehpqaj
pqaVhouYnaOjrKqsp6ihp6qgm52Uk52Yn6GhpKiqqqaqr6+qsLCuo5iMcF1hfHRkZnBydHh2dHR9
f318goOIyuylZF9kbniCjIqIioyGhImLj46Wl5uYo7mkmqWzs7Gws7K2tbe2s7Gpl5Gh0qyLioqF
aFxdeI6Ki4+Pj4yMkouDg4mLiYKChoqLi46Ljo2Njoh9bWJiZ2ZnXWFvgoiPnJ+an6G5sKq2tri7
try+vLq5s7WnnJqao6WvqrG3s7G5s7CxrqyjhWttcnR0c3ZrZ2JiSzxEQUZLVFldYGRkaXBwb3R3
f42Vmp+hpaWvsq6qqqOXkpWbhn17YVl0hoaJjIuEfX99hZqgoaiup6qvvKSkn5KIf3R0eXmBkY95
a11cYWpramZnb3RwcG5rZ2llam9xdIODcWZma3Z5eoKAgJXCk4J9fIFuVFRegIlyam90cnl2cG1w
cHJxZ2FfX1Ryj5uera2wrrCztbubj4WBd3Z0doqYnaChoaCloZF/gpWhmpqjo6aotcLFwry7uaqc
mI+GiI+JiJWhoaSdl5GGgH1za2dlboSUlZOPioJ/jq7fpFhQW2JuiJecoaSdpKWppKampqSmpZuI
eXFkTUZGTExMSUtNSkpGRElLUFRPUFJPTklJQTUsKSkqKCYrOjM1PkNOeMjxo09QV1liZ2pwdH2B
f317e3p6f4KEjI+Oi319eXRycXZzeHuAgoWChoiIhoSIgoN9dnx9cGhiamdrjZyhpJ2jpqW3saSV
k5iaj4V9Z15cX22l25WAho+XlpilnpiXnLmsqamsra2zs7ezsLOxraajnJiavsyspp+hqqqopqCh
n6aqo6agm5eVk4qFkqnD09DKzM3N0s7KzMvKxcnLx8XFwcPCvrq5s7Gyr6mclY+LnZqBfYWOkqjO
p5acn5+hpaCXmJyTkZGJiYyMj4+YlZiYn6WloaWsqqanpqGYjHtkYnNteHZ2eHt6i3lgW1xhU1dY
cnxTX2p0fH+GjoqEhomFhIGCfICEcl5PPklqXVt7gn+EioyJjJWYl5WUm6GhoJ+gnJiUioF9gH16
dF9UVVNOVFRST1BPS0tgfIuDeHJwcG5rZ3eBho1yiJWAgYOAf3hnSzxBYk9HTV16g4COzv3+yqGe
paWeoaGhoJ6eoaCejIR9e3lybWddcoBtZm5xcGtudHh5fYKAhoaDhoOCg4OAd3h3eICCg4aGg4iD
gYOGd2ttdHp9hIaGiYWIjpGPioqNjol/g4NxZ2dpbXaChpSXlpaVlZufmJiVkYyKjYl9bXBweHh3
d3R0dnFta29wcnZ5dnh9iIaFho6PkpGTmJaTkY+Ogn19fHF3g4qPkZiPiIKBf39/gYaIiImNjZST
mJudpqytrq+qqa2vrKaYlpWOiYSDdGtye4GGkpSPl5uYlZebo5eRj45rWFRYWV1meXx9f32Fg4J6
c14+MzhMZGt6g5Ons7O1v7y+vLWzqJOKhoSFi4+PkaG4lIiIlpyeoaSprKmoqaignKOjnoZ7aFte
YWFcZV1fYGV2a2dnZWRoZ2ZeXFxygX+CjYyJhoN/gYN9al52kp6uraqqsq2qrKqsqbCfko6RlZ6q
gHl6fH2FiIqXm5qYmqCcmpWdloRwVUpCS19ob3Bxcnh6eHd2dHRwc3FycXxza4RnXV1mamJiX2Vt
cXByb3aIhnp4d3R6hoWBg4iGhZOSfX99f399bWdoZl5dYWFZZHqIg4iPlJqfoaSqpKChmIFrWWZ8
hYiMi4aNiYmPi5yhoKWqsa+ts7GxraGSg2BGOTpQZXqTm6iorbOzubm1ub68ur+8wsG/v7mzr4x0
dn+PlJOTm5ufo6WkoKGjpaOgnZqcmI58ZlhZWVlbXXBcWV5hT0ZDQEBDUGBweXyFipGUl52enqOl
pqWjoaasr6yqrK+ztra5tbe5wby2t7y6sa+zube2sK+xsbK1r7ChhnFkYWdraGtnX1tYVVdWUlBW
T09VWVhYWF9gYWJhYWVmYmJkYFtPOyMZFhUZGh4oLjA0MjpCYH2OmJ2hpaywtbGtrrO2s7C2ua+l
oaGcoKCcl5aOiYaDfX+AhpGhpqOqra6lqqeelYl/hXBpZ2doZF9YUE5MT15rdHlvZmJXRzczLCom
Hx4dGhoZGhwdHyAiJiguOEJQXmJrgH2BhIWEhoaGhYqTmJ2gnpWPko6NiY+PjI2Pi4yGioR6eYGV
hGhnZWReW1VXVltidJOfn6G8x8LCyMvKyMzFwbyuraipm4R5aXJ/j6WqpJ2YpZ+Ynqeqrs7ovJye
p6Oqqqqutra2vsO6s7azqbCqo5d9gI6ep6WorLeyrqqqpaGdlJangmlnaGhucnR9fH18gIGAen99
cVdPa5OOiKfQw7a3uLupfWiIub6+wL7FysjFztLIvrOqrainuc6qoJeSiYqTmKy6r62zu7a7wre2
xcm8vMPIxcfH0M3BwsXMyMDBwbuwrK+jlIh7W01NT21zbWprb3F0bnR4dF1LRElJQkNGRkdDREdG
R0tKTUtGVsjVZlNre4B/ipGRkYyPjouGf4SEhHZybWlNQlZJSkxOU05PUE1HR0dJR0E9NTo3PEdD
R0tLR0lNTE1NT05NTWGdsr6/srK5vL6+v8XFxcHBwrq3s7Kjmo6Pl5ybm5udmqDIpZ+krra6u8HI
wry/vL/DxcK4s7OqmIuLhoF0aWBcYGZpb2toZmVkZWpmZmJna2hhYFlYWF53ho+Wo6ScnKCjqZyL
jZKhpqahqa2ppqeno6Okp5uoo5ueoaSmp6ipqqyzrbCvpqGawbdoUFhba2tvd3p4dHZ4eoF7gXp9
gICEmJVzYkdZe3+GhIKNi4aCi4qOkpWSlpeUl5eWprats7W3s7G3uLOvubqsnJOYk5OUlZKTaF1k
e5uYkY+PkY+MioKIt59/fYCDhIiIjYyNkY+Pin1iX2BfXGBuYEFZhZaboZ6go6aqs7vUvLC4ury8
ubOuqqicj5SYpKmtsLO7uraqssGvo5Vzam5wcnFxc21oYVxDODk7PERFQj4+QUdJT2J/gnd/ho+V
mKapqaqtsrGuqqWel4+IfXh2d5GPioyOioJ9fYOPoJ2coKqsqKmqqqWpnI+Ng4WChomMj4+Eb2Bh
ZWppa2ppbW5wcG5qaW1xcXR0eYOAZmFvqYp0eHh9f4SOl5ePgnRfXGFzbXF0cXZ2c3Rub2tubmpk
XV1WVnmPlqbArKGqtrGurKOFfHl4e25fg5SgpKGmp6OblH18jpign6WkrrrEv7u+vLy5r6ympaCY
iIOJi4+Nj5GOjIKBfW5kZmdvjY+TjYqGhYSEjZd7WVRZYWR3l6yfqKWfrsKso6WopKahnZWLgX2M
UEJFS0lKTUtJSUdNSklKUE5UWVhQS0lHR0o4LCMlJyMfHCEuQEpdmNehVElSWWVoam9wdn2CgXt/
gICEi5GRko2Mj4h/d3h8gYKGiIaAe3qChoSGhIGBg316e3huaGJqYGiGmJ6bo6SmpKahn5iYlZGG
f3BhXVtcb31/j5WNj4mVm6ecmJaap62ur66wr6+zt7q5s66lqKehnJu346+bnqSnqaSppJ2kqaSd
npqWlpGLhJKjsMHFysrM19PMysrIyMfIyMjHzMe+u7y7urGxta+tqZyPhnl3eI2flZaYnp+doaSn
r6mnpZ2cnJaSj46RkouTnJ6dm5iboZ+foKOen6OhnZyNcVlQWVZcaXR9eGVhX15YW1tfXF5cWVVe
aHF3fYaKg4KDgY2LjIaBenh6c1xDRU9TU2l5gYmOi4mSlpiVlJiho6Ghn52dnpuYj4J/gn2PgF9W
T1RUUFhOSUlNYXl8dHR0dm9ua5KRa2ZrcHyVtY99goN/fHBSPkZPWG5gYnaAhI+q9PS3o6anqqSl
qKmho6Gcl5eMhYB6emtiUkxYW11gZ3NydHZ3fIGBgIGDjoaDiIiEgYN3d3d2fYGIiYaGhoiGhYBw
XFVqc3R6fX19gomMioOFiY2GfHt6cGZna25ma3iGjJOXmJ6bmp2YnJiOiYWEdmJla3B0dG9vc3Zw
aGpta3Fyc3F2eHd7f4SGio6Tj5KPkpOSi4iJf317eX+GjI+Rj4iGioaAfXx8fYKFhouNlpygoKip
qqqtsKmnqaSooJ+WkY2IhYRzanB0fYOLkZKNlJeXmpeVmrWRallUVFhVXmBkdoB7d3h0b2ZUOCsj
LkFYanmDiJWutri7wb++uqSVlYmGj4uMjpiSj5iPio+apqChpKesqKSkp6GppJ2UhWtbWVxbYGJh
X15iZGdqa2hqbWtucWdhZoaGfIKGjZGKg3+BmqpyXHqWnqmqqqywr62qqqWop6GYk52Wj5OGgn1/
hoqRmJiVn6OenZ6km5OWk31TRERKd3Rub3N0fHh2dHh4eHR0dHJwcXF0bWJhTUpUUk5VX2dpdHR4
fYF7d3R0dHZ2eX19fHmBjox9gIGAeXBqZmFdWVtbVlNgcXd9go2Rj5aYn6WjmJKNe1VNW3qGjYqF
hIiChqiboLCztbKtrK6qp6Ocj2FHPC8sRGJ7jpagp6mzs7e5ucS8s7ext7u4s7O1uLupjH17hI6V
lpaeoaGjpqmqpqGfn6GclY+PkolrYVhQVWJbXllXUFBLR0VCRUZTYWJrdIGFhpGYmKOjqqmus7ev
pqWqp6qqsa+zuba1t7rCvLy6tri7uc7DuLaysLa2sK+wqJd9amVpbmptcmdgXlVUV1VZVVRQR1BZ
XFlZXVxbYGFiYmFiZGJgYVs9JR4ZGCIgJSwyNzc4O0VhfY+YoKamr7OxrrKzvLiysLCyrqOhoJ6f
nZ+hmpWLgIOWhX2DmKCpsbO2tbeus66ekYR8d3Rra2tpZV9XUEdGS1RXX2dVSUE6NC8rKyYiIh8a
GhoYGR0eHRwdIB4mMD5TYHCCeniDhoWKiYuMj5KRmJ2dj42MjZSVio+WlI+TkZGMhoOFhH15dG1r
ZWRfV1lWXGV8lKCgpam3wcXAxMXFxcW8srKtpZ+Oe4ZubYCKlqiwnZaTlZeco6qwyuW8nqOlo6Om
pqaoqrazsbOzqqahloZ5cHSBl6Wko6qwsKqysKqmpZySj4tzZ2Zma2txeoKCf32AgIF9g4R9a1RZ
dH2FmKm3uLi6t6mJaGl9obO+wr/Ay8vM0b+2tbmzsq6zvqmkoJyJipqVp6bFuq2xs7K5sr7m5by2
u8HKwr7Dw8XFwsPFwb63rK6qoJqThXJhVllWcXBtdHRwcXRxdHR6dFJKQkBFRkVFQkNFSUVDR0lF
RUZBYY1iYXeBiYaEiIaLjIuMj4aCfX19e3RvaFlFQEFDR0ZLTUxZWEpHR0U+PDc0Nzg6TUtGRkZJ
R1ZuU0xOTExTc5q2tbC2uLa7ure4vrzCxMW+t7Wvn5GLk5ubn6Cdmp2brpyRlqeutrzFw8C/wsC8
u7/Kv7KzzrmcioaMg3duYmJhZG9taGVgYV5iZWJiYmJmYWJiXF1ZW3aGipKYnJ2amJ6nj4aGt62f
pKSjpKSnp6qnoZuYmKWjn6GhoaGkqaqprKisr6eloKGjhmJZX2ZnZnN6dHd4eHh7fX14gol6d4Z5
bl1GNTdZdnh9hH+ChoiLjImOjo2PjJexn5Shrqyqr7O2tbO1sayxrqqqmJKUmpuYlo9uWVhkgo2N
jo+KkY+LfGtpboGGg4OJhoiMhIaGiIyPiWtXV1tbW4NPKDRtlpualJ6kqbKzyNm8u7i5vLazs7Cj
lYKK0baUmKmvr7K6vLO1sKWnhHFzdHx2cHByb2ZlcUk3Mzc+PDkyODxAQ0VFR2BoXXaFj5aboaqq
qqqss7Ksr6idkYx8eYSJjI+ToMKPeHd/ipOTnKGpqqyqra6tsaablpSjw4+CiY2Kjo2GdGFgaGpq
a25wa3Bva2hpb21wcnR3eo10YmtxeHp6eoKBhpbFtZSPf2dcX2ZudnZzc3NxcnR2cm13c2VbWVRS
cImPk5yoraysrKqpoY16eHp9gXaJmJ6kqaSgpaGPfXuIlp+kqq+4v8DExMLBvLiyr7Cqp6WYhIOG
ho+MlI+MiImGdG5xcXOIi4+PiISCgH19enRtVlZdZWR6mp2fnqGmpq+ppKWqpKSsno6AdmdOR0pG
Sk5LR0dGR0dHS0xQUlJZX1dUTVBPTD0xLiwhHxgXGSM1R05dbW9hWVdeXV9kbnl/eHR2dHh/hY2M
jZGjjpjBloGGjI6SjYOGhoV5e3l9hqGNfHh4eHx/cm5ycHBub3qLl6GopqyhnJ2YlZWVjYZ/b1lS
U2R9f5LV3Yt4hIqTkpKSkpags7Ktr7K6tbe5uLezsK6poZyeoLi/p6Gkpaajo6Sfm5+hnaGalIyP
joKGoby6wMTIycvOzcvIycfExczLycfMysTAvLOzta6sqamfj39vcG1zg4+frJycpamnoaGlqaah
nqCdlJWXj42LjpGWnKOhlpSYmpiYnJ6lrp2VkoRqUERJYVleXl1dW19ZXGBmYl5eYl9dXV9rdHl9
goGDg42VqpeOi4aCgIB9cV5LR1JOWXmDhoaJk5WVlJSbnZiYmpufpKafl5Sai4KFhIN9c2VUTk1N
SkRHT15ud3hzgIZ4bmRodnBmZGhzfIGLj4iEhIN6b2RTUlBff2Recn2AjZ6zra2wqqSkpayooaah
oaCdkoJ4fHlvYldDNDI+WGJna25tc3x6fXl8gYSKiYaJiIiXin12eHt/ioiJiIiGhoSFfW1LPlBo
dHN4e3x9goaEhIOGiIF9eHRraGWJj3RqdICJj5aemJ2en6ajnY+Ff3dnYmJqcmpra21rbWtnaGdm
amt0cW9zent9gIOJiouRlZaRj5OPjIyGhoF4f4KJj5KPj4V9fHx8f3x5d318fIaNlJygoamwraqv
u62lo6Chm5aSj4uEhn1tcnN7iZqPjZOUkZOWnpWWnY10XVhYVVRVXF90b2pra2JTRzwsHxYuTFRf
a3N7iZemrq+sqqmloZuSjIiNlpeUlJOOjo+Plp2eoaaoqKilpqanoaGhpKSCYVlZZWRiZW9mX15g
a21xdHN4eHZza2Jnd4OBhouPoI+EgoydiWJbepanpqqqsK6qp6qqpKSnpp2Xk5OhnI2PkpiVnpqV
l6GloaimpqegnpqXeFNBQ0Jlc3BydHh7eHZ4dnh7eHR3d3R0cW9gX19LPEQ9QVBZZm5wd3uEk3x5
d3Fyc3t8fH19fXaAgH19f3yCe25qZFxcWVyBdGJrdHh3eYWPkZicn5yXjn9kSkZVfIiIhomMiYqL
l561v7u8vrO8w6qhk3BbUkE3NTVYd4OTnp+hqaquuLe1tbWzuru5ube1sbOys6yRf4iUlZidoKCg
pqqop6agqqagm5qXl4+PjHFhVk1MWVZTT05JTEdDRkVCRUpSXGp0fYGGjpScyb6nrLGwr6qmqayo
rK2vra6zs7y8t7a1ucG8uLu8zby1tbO1xLivsLGolXxucXqGd3N2dG1oZGJgYV9eWE9SWGFiXV9d
XmBfX2FoZWViXmJfWUcuHxoZJyUsNTk5NTc6RVh8j56dm6eqsLOvtre5sa2sqqyqp6mpo56jn6Gg
n46Bhp6EjZKcpq6zu7u6urmzr6WflYKBrYJnYmlnYGBWSz0+QD1ER0E4MTAsLCclJiMjIxwZHSAf
HxoaHRocHBoeJTM4UHJ5e4GDhoaKi42OjZWRk5KSj5WSj5WYmpqXmJSTko2MiouEhYJ5c21mYmJi
WVhdZomYm6G3sKG1wsG8vsHCwby5sK+joIxyaJGIeYCKnKiTiY2LhpOeo6iqraSquqqhoaGlpaGj
pqimo6SklH1pYFhgc4qbpKOkrLKvqqqura2om5GJe2tpZmVmZ3B7hIqIioqIjIiKhoN3XWGmmH2E
lK+4vLy7s6GPf3SBmLHEwsHDy8XEv7y8yLaqraywr6qloY59g4yYse3QrrCxsrm3uubfuL7OztHO
zsO+vMK+u7zAu62lpqGYkoZxWWllZlhtbW9uc3Fuc3B0cXBpV0tQVkdNcFBBQ0NERkdHR0pKUE44
Pl98gn19iYaEiIqNj4yIhYSDfXd0dHBlWUVDR0dHREZJTU9QZ0xEQDg3MzQ3NT1ER0dLS0xOUE1H
S0xKT2KGpLOzr7G3trm5tsDKt7Wzu7u6qZWNjZWXl5qdoJ2en5uhmJSbpq+7ws7IwcLEw8LDwcXD
u7u8sKGYiYaCd21lXV1fZGdoYmJcYWFgX2FiYl1fZF9YVVlkeoqNjpKfpZ6YppuJho6Wpq6nnqGm
n6OkoKeqsdesnqWhoaGfn6Gmra+sqqyzvKGVlY9tXV9eX2JxfX9/e3x9f318fHuDfHhxcnBvZVsy
I0JheoCEhoOIjYiFi4aIjYuMi4+Rj6itqqqtr7GvsbGxsrGxqamelJSPkZaOhn1fWFxeaIGMi4yG
iohmVV2GiomIhoODg4aEg4aGiYh0XWBcVU9NOCs1QWuOk5qlp7i1qrG5vLm5t7azsa6wsaaYREF0
kqGxrqips7q1sa62s6aWhoV/dHN0c2tqZV9BNztLQjU+MDAyN0FBQUlHTlNVaoKPnKOmqqqprbOy
s7GsrKy7jIze/vnRhnuV15Vzd3yJlp6enqixqqywsLawo6OhnImLmo6Fi42Oj4qEgG1rgW1obW9r
a2dub2trcXRvdHd8gIFxa210fHl5fYuTm6aYmJagkoRxYmdvcn2Eg4OIjYqGhoWBf31qVXKDgoGP
mJufn52hn52bmIiCkruFcoWXoJueoaOfmIx4d3+RmqCvwszAvLy6vLm1s7m3rq6nqqaPgICGi4mK
io6Pj46FdnJzfYWKi4uFgX99eXtxZ2JXVl5laH2Unp2hpqilpaSqsqakp6adl4x/cVVFQ0JERkdF
RkZDQ0ZJS1BbYFlZVlZQUE9MRz4vKCEeGRQaJTVER1JWWVlYW2BbYGZtdHl7cnJ0dnl/g4iTj4yN
lJSNjpKWl4qIhoaEg4J/fXR8hn19enZ3d3F0d4OPkoF3e4aSnqCem5icm5iWkY6JgHtrVVJTYnqJ
2/7ymHF9hYqNkZaYlZeztrazs7m4vLmzs7OxsM66npicoaippqiloaGkoZqVlpiWmJKIgoOgoaO2
vMPc0cjHzsrOycfLzcjJzs7NycnEwMO8ta+xraqem5OBbVtna3eBj62znp6hqKmqqaqtqqGfnJuY
lJGSkYyRlZufoJqdnp2VlpWWlq/ZoYiJgFw8R1RSUlZkZVlYWV9bXmJkYmRiYGBhWWdybXR6hYmX
s7qUjIyKhomDf3x3alRJSUdQZ4GEho6Rk5KWl52go52hn6Sen6Gfm5yVhYODgoZ/cGVSSUlJQ1BT
X3Bxc3p5c3Bra2tiYmVlbX2GioOFiIiDfXpua1tdVlhXXWd4g4OUpKisrqqnqKqoqLGoo56hoZ6Y
hnt4a2thSzQsKSw6VWRpbXJxdnl2fYOCgomMiYqPjouLhIF4e4OVhoaKjIaEhoN8bUlBRF9rcHR8
gHl8fXp/hoWAgn10cW5rZHB0dG5/gImUmp6mpqGfp5+fm4B0ZlNSWF9lZmdoamZlYmFhZWZqa2ty
cXF3e31/fYmIiouMk5SKjYyIiomGf4GGhYqOjoaDe3Z2e3l5enR5cGpfd4yRkqanp6qtra6wp6ap
p6Gdlo+OjoyCeGhpcXyCiY+PkZSYnJiYlIyLhmtYVldZVlheXGtxZ15hW1VKPScPCiZGTFdocnSB
jpWYobGml5icmJGMj46fkZihlJSVlp+2oJyhp6agoaeur6qjnqGjpoNrWFlcYWJiZGV5a2JkbnN3
eXt4dHxuaGt0gYWNjpGSlI2Cg4tnWWB4k6GusLezsbGtqKqqqKWnqq+opLu+qa2ssbC4qKCbn5ib
pKmopqmfoJeFVz47NUVlb3J0ent2d3FtdHh0dHR3cXdzampkXFhGQkBCTVZdZWtze3p8enR0dHhz
c3F0dHZ3dnZ7dnd8enZ4cGhkYVdHZJ9uW2BpbnJyfYuPlZuWlpKKe1ZDPEZwhYqGhoaBipypsLm8
t7e7urGwqaGPXUtLRzc1PGSCjZaboaGtsa6vuLWxs7Gws6+trKyqqqyoqJGGjpugn56jp6epqa2t
qZ+lpZ2YnqSPiHt/bl9MPj1YVUZBRUdESUdFRUNDQURQWWRvf42Nl6HLt6etrqqzsamqrqypqaqz
sLC7ubW2uLi2v8G8vMHHxbq3ubi8vLGtraaPip6yy8h8a3J5d3JxdnRvbWdeVE9XYWJnYl5ZXF1i
ZGRmZ2ViYV5UTjohHhogIiw1OTc5OT5BT3KLlpygoaeqqrKzs7Kvrqqmo6amqKiqqqegm56hj3x/
gISsr6yxsbe3urzBwb+3s6OfjYy2kW1maW5rZWJdQzg3NzMzNDUuLykqKSgvJx0eGhomMyAZGBwa
HhwWExUdJSs7XXN8fYCGioyMj5KSj5KPjYuSo5uanJucmpicnJialpWRjYuIkoBxcG9vaWJiZGFt
jZian6yooaq8v7+7vMXEu7azrKWYgHBqiIJ8gYqRjIqLho2Si5imqKmlp7fFqqChqa6sqqqjpail
n5KFdGFSVFx4jqSnpKqqqaapscq2oZ+Ylox4aGdqYl9kanF8iI6Pi4+Rj4+MhIJycZ+YhoqYrrOz
t763s7O5iXp/mL+/vMLIxMHBzsW7s7OurK6qqqekkX16hZOgvrmlo6+xr7K1vLm5ydrc19TOzsrB
ztW8s6+pp6OfnJOLclNNVVlWV3R2enJwcXZzcm90d21kU0lER0VLRERJRUdMS0dHSUtJQzVEa4KC
g4SDhIaDiYyNiImGhYR9f3xrZ2BgXTw5QEdGRUJKTU1HQT46NzQ1Rj5FPEBLVk9OSU1KS0xMTk1Z
d6rbtp+msLO5s7u2qqqhpJuWlpOVlZePlpiYn6GhoJ2gn5yakpequcLN38e8wry5xMjFv7i3urqv
pp6Mm6l9a2ZeYX1ubWJhXV5ZWVxfXltbXmFdWVZUV2V4hYyPkpOampqdl4mGi5OboKCgpKGgnqel
oaGnuqO2rpuYoJ+joKSlp6mpra6fn5iPd15cW2BmdKqVgH+BgoJ/fXt/e32Eenh0cmtrWTEsSWqc
j4KGhoiOiYqLjIuIiIiMiYmRs6+qp6iur6iqrq6zt8nFrKeYjpeXlo2Jhn1kXF5cX2WAdmpiZGBd
Z5+DgoaFgISGhYWGiIaFhGpdXVlZTkc6Kys8aIKLjJulrK2yu768uLW4ta+qsLCqoHw8N3KYpKqu
rK2xtbu4trrCsa68sKyId3JycGhgTjo1NUM8JR0hLC43PD5ERUlMS1BgdIqUmJ2hqq+7u6iopamq
saCGkuz+/rt0f9P+xW9odo+dmJimqq+xs7nRuKqlpKWwmoyOkpKSko+LjY6AfXNrc3Nxb2tra21p
a2tucHFydHd7enBpb3Z3d3d7hpGYnZiTlpeRlY9rYWZmdIODhoSFjIyGiYaFgXl3jY2JjI2PkZiX
mJqYm5iTkYaXj46KhoqPlp+ko6OdfXl6gIyYqby8vr68vry3uLezrq+sraqptpN9f4KMmI6NjY+O
j5GNfHSEjIqLiIGBgH92cnNtYFxdXmhrjaOhoaeprcy/qqGjpqWknpuSjY52XkdBR0dGSUdAQkdL
S0tQWYHUymteaFlUUE5NRz4qIRoaGiAjMUFHSm1nV1ZbYlxhYGhrc3R6dHF0gYODg4iSmpiMjo6P
i5ahjIuFhImPkYZ6c3R8eXl6fXZxdoODjZuYhYJ9gpGSk5idqKCWlZSNi4qSiWZQTFBYa4C/+v7p
pHyCjpSLjouPkqi6vLq3t7u7urm1sa2ss6qem52mua+oqqmko6CcmJOPj42NhHqSpJ6krrW8wL7F
ycrNycXHxcXJysjFysnHxb++vrizsaijnpKKiHtcXWdudn2Pp6Chqq+yrK2zraqnpqGcmpqbj4+R
kZWdoaGblZidmpyXkoyPk42NkoZnQTdOWVxfV1hZU1RZWV1cX2BfX2VgYmFbb5x9dIKVk5udlZiU
mJiRjouIfXhyaFRJR0lkqY2Bho6RkpGYnpudnJ+gnqGhoJyanpGGiouGi393cmRPREFKYGJua3Fv
dHt0bWhrZ2BfXWV2f4OFhoOAgoOAf3d3cWhta2RkZXF/f46hqaqsr6mupaahpqahn5ygmJWFcGpq
bVhFMSopKDNDYHRycHN3dHR6fYaGfZaPjY6OjY2JgH10doCIgYWJhIODgYSATTQ3VXBvcXBzdnd4
f4B9gH2De3Bra2tlaWtqa29yfYyXmJ+jnpqempiPf2lNOjlQWWRiYWBcXV1eXGVlZWdvbmttcHN0
eoCCgoaGiYqLiYaNj46JhIGFiYF8gYaJgHh0bnN3dHJ3cG5hU0tQZIOTmKOmqaqtrKilpaOfoJWU
k4qBfYJ0Z29yeoWPj4uPlJSYmJOSkYV8aVlVVVdXVFhdXWRdV1hSTVBDKh0aJTU+YWhqdH+BipKW
oZ2XkpiYlIySkZWYn52Wk5OSlZyYmp+noaaspqippaGdmJqBb2RZWVxcX2BiX2plXGBtcXd3dHRy
dG5qaXJ/iIqNjYuDgX10cF5YaISTn66ytbKvrK6qrKesqqmsrrCxubmzsbOzsq2loJyYoaampamk
o6OelYhiPCsuOl1xcnN2enl8enR2eXh5e3p4dHhya2JeTkJAPj5JU1xfgJR9d3h9e3x4cG5ub3B0
eHh7dHt6dnRzeXltZWZhS0RgYlhXXmRpd25xeYuRj5STjJOaaUtBTXSChIaIi5KOqr65trG4tra3
v7OnqZ+BWUdTOS5GbYKWmqGkp6+ts7KzsqytqrGtqamhpaihnp6PgYSOn6adoaGhp6mtraqhpqOf
nJ+bl46EfXJpYlM9OlhZQjo9Q0lYVERFRERERUxQWGR0iIyXo6ihqq+wqrC1srDDtqqkrLawqsO8
ray2uLO2vMO8w8O6t764ubfIvKmnoYue3/77yH17i4yJiYyMiIWMfWtZUlhiYmJiX2BhZmJkYGVl
ZmRkYmhWQykiHhwfKzMzNzk6PUNMaIGXuqaepKqwsqywrqmppqeoqq6sqqiooaCjqKaVfXd6fY6b
r7O7xbu6v8HCwby6uKmYjYZ6dnR4c2trZ1hBNzEyMzIyMDAuLComJzElHhwdGiEjHhweHyAdGhMM
Cg0VHSlOdH19gYuNj42TkpafmI2YwaWVl52fn56WmqGYlZecm5iRi4uYhHyBdGlpfXF0ZGeBlp+f
n5+hrK+8wL65ub65vLOupJKBeGtxd3yAhYyGi4WGlaqMiJuhpKqqqqqsqq6tqqeqp6WhoaGbkYZ7
YVVMW32MlaGoo6GmqaqquKaYmJymjHRtYmFiXmZqdICTlJGMipGPiYWGhoGBlZaJipqtsbm8yNC2
tbmSfYaXtbq7w8rEyMTJxcK7uLa4s7Gyp6Gae3N8hpGcpqqoqq2ws66zuMTS29nb3dfZ0srIwbux
qqihnpSKhIBiTEpPWFlYcHNzb2t0d3JwcnR2b2diS0VBQURJR0ZHTElMTUpNTEdHPUxtfIGJiYuM
jImGi42LhoKBe3yKgm9kVU09OUFCRUdHRERHQEJBOzU0MTc6PUlFQUZLSktJSU1PTUlKTFmBp7an
pKqxsK6xqqipppiMj5iYk5SXlZGYv6eVmp6foKCfm5iYmKi5vL/Dwb7AxcLDv8DAw7y6trOuqJaU
kYaIYl1iYWRmZmBcX19cXl1cW19fXV5YUlVcd4CGjo+PkZeXl5KMhIOGjaWsoJ+jo6CgoJ6jpZuU
kpicnZ6enZ+eo6qtqq+zqpiUiXpkXmBiYGR9k4uJhoiFgoB8gYGAfX19dnp5c2tkTjRce4OIioaI
iYaRj42NjI2GiIOAgJS1tamjo6atra+usrOyvLqsqZ2Rl5iUkpGJgXJdXW9ZW11dXF5ZV1ZZWF58
i42LhIaGhYODhYZ9ZWBmbWZUTUQ1NWJ0gZSSpKWtsbm6u7m2t7q5r6+2rKGfj3pOeZiksbCzsbKy
tbe1sa2xs66hmoh9cm5tZ1hCOzk6OTMgGSMsLjA1PENHSkdJSVhugY+YnaSprLWvrqqtqqScmqaP
zv7fa2J9vsR4ZG13lZyfoKeqr7C1uravr66pqbibjY2RlJiVnaOWiIaDgX1zaGdra21ramdrbmtr
bnR2cnBydHqBfHR3g4GJj5SXlpiYlZWmrHpZW2l/hIOFg4iMiIaFg4B8en19hYWAiIyUj5yenp6Y
mJiVl5aSjZOPj5acnZ2dnpF3dHqCipiqubu4vLu4u7ays7OsrK2wsaihkoSGhIaGiI+Pj4+UlI+S
iYiMiYiGgH16eXRzcWhfWFxhZmqBoJ+boaaqvLupp6yppaGmqpyShIBrR0BBQ0FCQT46OEFOTlBc
p/r4k1RNTlZWU1BUXTglHR0fJycwPEVMVFVQUFtnWVdgZWtvb29rbXR0enyBioqKj5aXi42MiYmR
ioqRprbov3praW1vbXRzcnh9hY+anpqXint9hY2Sk52nnZKTkZKSlJSOeV9UUlNkdn+GoKfB4KGS
mpiTlIqPnbC1sbq8trGzs7i1raeloaCgpKWqqKOoqKOgpKCaj4yShoWOnKegqLCztrrBv7nAy9LS
zMXKyMTBx8fKx8jLx8G7ta2lnZaPhXNXTllqdHx7hIyPruLBpKalqq6vqKqppZudm52Uk5GWlZKY
mJiYnaGalpOTlomEiYiGfWZKPk1ZX4VnWVdYWFxZWWBlZWFiXl1cXVtYV199kZWUlJ2Yl5uXlZOP
iIaGg32bhVtNRlNugoSKlZKYmpWUm6Ghn6CfoZ2Yl5SsmoSDhIOGhoB0allLRkVOYmtpbnJzdnFt
aGtqX1tiaXuBgoaGgYOBhISPmI2Gf4B6c3Jrc3qAlKapp6mqqqenp6SnoaGjmpeXj31rZG9hRjUv
LC80PlJbYmhqb3l0e5KNf4KGiIuNj5GSj4qKg3p7fYuXioaEgoSGi4RQND5ba21tb3JxcXl5fXt6
enNycnNua2pkZmp0dHF0hp2hoaGhn6Cxk4V3Ykc3Mz5QXl5gW1lbXE9XX2JlaGtvcXB0d318fIGG
hoqFkZiNhoiOiYiIhYSRiImPgH94a2trbnN0cnNvbV9QR0tWco2cp6qpqrGtqqilo6CYmJWOgXt2
em1fand4gIaMiY2SlJOSkYuJiHpgU1JZYVtcWV9bWVlbU0lFRD0xLCs4NDlka2prdHl9goaIjY6P
jo6PjYyUkpSYm5iTlp+YmpeWn6OhnqCfpJ2amJGAcG9mYFlZX1xcYF9fXFxgZGtxd3NwdG9xa2tu
f3R9hoiEg4p/eGtgWWZ9jZOYp7Cssa6ts62vqqioqrK2trOzt7Oztbi4sqynoZyjp6q+rqaloZuY
jGtAKSs3VG94d3F2eXuFfXd0dHN5d3dyc3JuaFtOQzxARUZPWWBxeHh5e3t0dHZ2bm50eXJxbnN0
e3x4dnpzd3JiXVlHQVBTVllbYGJnZmdufISemoR7gIZpYGBwfYSIi4OAiZOqurWzs7a2uLi8ta6m
o5WAaE87Mk1vhJKYnaGhoaqxsq2qqqmjoaSnoJ+cnJeVjISEiY2YoaGgoaiqrq6qqqalo6qnmo+P
j4J9cmZiVz46PD0+QEBERElHR0dFQ0JCPkNHU2B9iJijqqSkqK+sqrjCrcCwoaSpqqas07qqrbO1
t7a6u7i5vL67uLW2s7nAsKGTgnqn8tyNf5GYnZiTmJ6Tj56fj21XXmllYmBgYFxiZWZoZ2poYWBi
YlA+JyEgIiEqMTEyNTg8Pj5ZdIqhk5ekpaioqq6qpqWjpK2yr66usaqqpqWmpZJ6eHaEjJyxucfO
uLvBxL+8wcG2sKSPf3p5fHd0cWthUEY9NzMwLi8sKiwqKCgjKiMeGh0cGh8fGhoZGhgXCwcFBgoZ
J0VvgISEho6Oi4+SmJiSjZq3nZicoaOcmJucl5ealpialJKKioyGgX9xanSBaV5cYH2Ynp2dnJyf
obDIxLu4urm+saygkoiBd3Z4e4mMjYuLiIWGjICAkqeqqqehpKqsqrCwqKSjpKikpqGYjX1mUktT
doyboaGnpqOkpbCzqqOeo6SIdHtrW2BtgXJrfJyYkpaUlJiOjIqGfXuMlYyPnaq2usHO0MW7tamc
j5i1wL/ExcnMyMXLx76/wL+1sKqlnY10doaChpWbpq2tr6+ts7nF1OPj39rX2eDX58SorqyspZ2U
joiDc1ROU1dXVlRvcnFxa29zc3Nua21qXklDREJHSUpHS0pKTktHUEpHRkpHVGl6goSGhoqPjY+N
iYaDhYGLlY95amBTTUk4Nz5BPT1BPUA+Ozc1LzE+RTw9QERHSklKSkxNTUtKTU5ZcY2epqmqp6ap
srOqqqSbiYaf27aPjpKWj5WYk5idnZugpqCenZiYpLzcxbu6wMPCwcXHwb+6u7mzv7epqbONf5aG
WFdUVV9yYVlcW1lWWF5eW1xcW2dfW1VZc4qej4iNlJSSj4uGioOLn6acn52cnJyanqGemJSPk5yY
nJufoKChpaelpqaelpKOcl9iWVxfZYaViYiEhoqEgoCBfX2BfHh7f3Z0b2traW59hYaGiImJjKST
lI+FhYCGgnxwdICPoaempqWoqKywsLKysbCtn5eVlJOTk5KKiWJUUElLUFVVVVROR0xVcHR9f4aA
fYB7fX2EfWliYGBdV1hQR0VVVGKDi4+qs8HFvLy6uLO1tbKssKynoZ6Vb22XqayyrbKztby7uby4
urOvsqWWkYZ9b25cRz07PTw7NC4yXD4nLDM8PkNFS0lNVG6DkpqfpqqprbyxpaSpqZ2Ohn+GhGJJ
WWhydIB2dHmUn6GjqLK1t7a1vsCzt7KhnJWampiRmJyjl4uPi4N8enhwcG5tbm5rb2tva29wcG1t
cnZ3fYaGd3N0eomPkZWYlpONjJqedFxcYneBhoKGho2JhomGgYKBf32DhoqMho+XmpqenJiWm5eT
lpGNkZWTmpifnp2YjH16e4OYr7rAwLq4u7u+u7q7tbOzrq6wrKWahoGCgYOLhouSmJWOj5GRjIaG
iIaBf3p5eHZ0a2JZXV9qcnyNmJujqa2urKeno6OooaGolYh/j3xBODU4QDw5NTk+OkpSU1yJ7/2q
SkRNT1RTU05GPCcZFxwjISxFTE5TU1BPT1BNR01bZ21ubXF0d3x9goaKioiMkpGLiYmGi4+TjpSf
6/7+yWtfZW1wc3R3e3+Lk5ecmpKIhYGNiY6PmpiUkpWTl52Yk4+Gc1tUWFhmbXKAiqHBqZ6jraGY
ko6Vpby4ury2s7ezsbO1qKagoaGhp66zrqqqrKqmnJ6Vj5WThYqjqqrNyrGxubq7vMDJwsnJzMfC
w8jIysXDxcTFyMS3qpqRioBlS0pYb3Z5e32Chprg/umooKStqq2vp6SjpJyYlpSalpWVl5ealpiY
mJicrJiGhYmNiqGReGlZVV1gZGJcVlZcVVZZYGJkZGBiYGFeWFVVfY2PlZOXmpqan5WUmJKNi4yJ
g4iWtZRHRlVtkayWj5SWl5ivoJidnZueoJuWiIOAiIyJi4aGhnltX0pGT1lra2drcXh0c25rZmRi
Xn18dHh7gH2BgoSPjpOSjo2Fg4GFfXRxdIKPoamqrKqlp6aoqaOcm5yfmJqagWZcVkc5ODg4QE5g
WF1hZ2lrcHF0fYCGiIyJj6WYlJiYko+ghnZ0goSFhYaEgYV/b1dJW2hqZWVob3FwcXl5eHNyc3Jy
bW1wamdoa2prc32RmqSkpqWdoKqYgHRiQTM3OkJKWF9XUkc9N0JZaGRpaWhtcHFydHp8hIaDiYWO
rZN9fYqCfIKGhIaIiaN9cWhhXGJqamhqa2diU0xKTVZhg52lpKiopqyqp6GjoZuaj4qEfXhpV1tp
a3qBe4aMjY+JjI6Mhn12cFBPUFlxWVhYWVdTVldQSUVBOTU0Mjo3O0tfaXFyeX1/g4OJkZaYk4uM
k56cmJian5uYqq2poJSVn6mjlZaWk5WKe3B2hmtiXF9gXmJmYWFvYWBham9wbm1wcnByaGluZ3B5
gYWBfXFoX1xed4mRm56lrq2quLyvqqyzsK2usri1ubi1t7y5vLyzraehm6CjqKqqraqknJeGZEI0
Mj1fdHFydH19gKGMf3x7fHt8e3hzcm5rZlRMR0dTTUxSXGJncXl4dnl7eXh0dHFqa3FzdHF0f4CC
fXZzc2VNPj5CUE9UV1VZXF9iYGRtcpeWfXx7c3uAiIuSkYmGiYaFk6qxs7Kyt7Ovtruwqaammo+E
cllHV3KFjpGdoaGmqq+1qqWdmqGhoZ2VlJOTj417iJKRl5idm6Onqqmqta2qp6SeoaGdko6Ihnht
Z2ZeRTQzODtDQ0dLSUdKSUZHQ0JCQD06Q2J9lKGoo6Wprq6vsLOzr7Cqp6ylnZutl5elpK+vs7a3
tbvBub6/vsLAubanm4J0dn+Vj4+Ym5icn52foJiPmKGRf2JcXmBeYGJkYmFiYWZoZmRkYl1VTD4r
ICEjJi8zNTEzO0pcREdgfJOhpaWtrKqsrKqoqKyqqK6zt6+vr6aopaSlppR3eoWUqbO7v8HDv8C+
wsW+vr67vJyDgX99fHp0cWZbTkU9NzArLi4pKygpJiIiHxoeHhwfIR0aGBQaGhcODQwICxooO1t0
gYiGi5GTk5OYlY+TmJ6jqaOgoZyanp+Ymp6dm5+Wj4uGhoOIhnpteG9ZVlVeeY6Ynp+cmJWbp7+2
srKztbmwqp+XlYqCfXp9iI2Sj4qIiYaAf4KGl6GmpaGorrazsK6mqqqqqKqvoaGOfWtQSVNxi5qb
oKWhnqGpraynoaSgnZeGgGpOU3JvYWp5ipaRj5iak4+MioaGeIOIj5SdqbnAx87OxcLBvLiam7PH
zMrLzszHx8nIxMXDuLizrp+aamRpfXN3fYuap56PlsC/v87U39/g4N7X0tns0KWepamlmJGGgXlz
cHKRaU9OU25vcG9ucHN0dHJ6nXNMQUVBQkVFSVZYXWiFaVNJR0pHR0pbanl9hIaJhoWIjqyPgHuA
fYh8g3RgU0RARDU3OTg5QlBEOzo1Li4sIDVHQ0dFWExHR0xPT01NTE5ZbX2FkaGopqakp6mopKij
j3d/iJOWko+NkpGTlJaWmJaWm6SdnJ6fl5KlvsXAvLy7uMLIw8C/u7q6ubayrqmqnoyVnYZ2a2BZ
Z2hiYVtZWVhXWVlWWV5hXlxdWFdleoaOi5GSkoyFiomBf4WWnpiYmJqdmpuempuVjYiSmJqYlpqc
oKSkoKOppZ2UhmlWV1dbYW2WkoaKiYmIioB8gX+BfHl4fX18eHZza2tznKaIf4aDg4yNnI2GiIaG
jIN6dHp7gIqbo6ilpKetra2zsLKurK2klI6Rk5STn4+Fj2tMR0NBQUZJS0xJVXSMa26RhoKCfYB6
eXdraGtqYV5fXFdORkdWW2+DmKq7uLe4t7u8ubK2u7iwsKyloJ6LfaGuqrKztrW6vLq6vra1uaqp
pp2YlI97aEM1OkFEQDk3MyUhJSozTk8+QUVFRkpbc4OPl5uho6y2u6qqsKifnJGJgIJ8ZmCBc2Vu
cnSahpWeo6Sqr7W4wcPBxbmtp6ihkpSbl5ugmJePjouFfXp3d3NpZm1va2lra25vbm9zcnByeYCC
iYufem93hYuVlZuYj46NhnxqYFxmf4aEhoiGiYaIg4OEhHx7g4aChpGYi5SUlJqblZeUlZiSkZaS
k5iVmJ2fnJeLgH2BhZivvLu6ubm8v762uLGss6+trrCsp6GNgH+AhY2OkZWVj5SWlIyLjo+LhX17
fXd3b3FuZVlZYmpzdo+amqeppqmxr6qjpaSjnZuTiXxyVEVAPkdBPTk1MzI1R1BVVF13j21ZU1dZ
WFVVU1JZOh8gGhohKkJPU1RUVFRVUkxHRUlPX3RzbXBydHmAhoWFhoWNjYmIioqJj4yGi5Pd/v7S
a1thaXSVgnd9homSm5yel4l9icyoeIiRlZqam5ianpuYlo6LgGRXVV5zhIWPn6Skp6eopaadlJOa
naq6ubGus7OvqLConZybo8m3qKehpKmvraSdmI+KhoaDlp+nrsjXwbO3vL68wMG7uLnRzbW2y7as
srazvM3p6biOfXt2WUtKVm+Fj4yIhH2Il7vbu6SkrKqnqqekpKObmJGPj5iXk4+VmJqWnJqXl5iU
j4qCiomIoZJ0bmZiYmmfd1xZW11cVl5eWVliZGBdXFlSTmGAjo2UmpiaoZ6cm5ealpeOioSBrc7p
1l83SVhuho2Oj5WUl6CamJ+dnJeWlo98homMhoyLhoWGhHJrW2BZX3FvbWtudHFzcG9pYVRQZXR8
e4N9gH2DiI2Jj5OPkYmFhoSDhp17hbPLsaWjqKqjoaakpJuRkp2flox0X1hMTFJfZnRqW1tfZWVl
aml0dm5veXuDiIyPko2OlpGXkYl/gH2BgoqFfX2BgHhrZ2JrbW1ramlta2tvdHJudHN0c3Fub29o
ZWdoa3BtfI+anqCcnJ6el6Z9WUpDPTxBRkZHTE1AMiwuMj1bZmVoa3Fzc3Rzc3l8gYSIiY+PhoJ9
g4OAgoaGhICCdF1PQUBUXFxiYmVpZFZOWVtQU1xylKOjoaWqqKmqqLKflo+Mi4B/c1w+R19rj42C
g4aGg4SGhoV9dG1hS0VHU1lVVFdZWVZXVE1HQTw7Oz09OTc3QG19cm96g3+AhISOuKOOjY2OlJaX
nJyXk5ebnaSajI+NjoF0dnh3dnZta3SBal1ZXWJia2diYmJiX2VgYGV0i52UaWVmcntraGtydHB2
amRqZ3SFjJGdpaatqaasraWosLy1rbGzs7O2urm5urm2urGpqqmgoKOqqqqqpp2VjXtcPDU4PlNn
dHd2eXh9fXp7fX+BgYOAfXRra3BuYlhOTlBWU1BhZF5reX15en19eHd0dGplcXZrb4GPjI+RfXR6
ZkM9NzxKUFRUU1ZUVFlYXmRpc3t7f32AjJGUlaGqj4qKiY6bqaqqrbWws7W6vLa1sayhnpeLfXJk
cYOJkpi4o56koKqkoaGsoZaPjIiIhoJ2c3Z9iJGXlpSbm6Gho6qtra6spqOhmJaSj4l6dmtmZ19L
ODU4PUBESkVGSklKTEZFQkRCSy8uR3CPnJyhqq6nqKeqs7ezsbCqqKScj39/ho+YnqCprbGxvMLB
wsLHxcrFuKeagHR2gYmPmJujqaOhnZ6dnp2TqJ2IblVbXV1eYVtiaGRnaWlnZ2pgVVNUQzMrKTAs
ODw5NDQ0PUc8O01zjKCcnqCnqqChqaqoqLG1uLWztbO2sK6xqKaojHZ4gYyuvsLDw8XCw8TL3su8
vMC/qo+DgIR/fXt2a2RWUktBNCgoJyUnIiMhHhweGhocGh4lKR8ZFxkdFBQTFhYZNywvR2l8hY6R
j5SYmJaTnpieoaOop6mloJybm5ibnJ6dlY+Ki4iGgoGAfHRkX1lTTldyiZidmpWPj5SUk5uosa2t
qKmhoJ2YmI6JhoaJi4uOjY2LjYaBg4SGo6Wkoaemsq6upqmnqKWpqaCcmI+Ac1BCR16AkpiYmJiY
naSjpaSlpqGknpSFbVNHR0FMZH+NlJWVkpKXk4uGhHdwcXmGjZquusTLzs7Lwr/BvKakvMXKy8vI
wcfJx8vJy7yzsq2voHc+PkFGQ1ZiaXN0aWBmg6PD2d7e3Nvb3tnW2dfDrKGhnZSPj4aEf3+DgJVv
U1BTaWprb3Jza26AeXqXfU88PENHVHhvbm10iqqjfV5NRUJHT1xre3t8f32DgYOIiYR9fIF8eXRy
ZFlMOjUyNDM1NTg7Sz43MissLCEgLz4+Q0JDRlNQTEtKS1NdbX2Mk6WfnKOkp6ekpaino5SAeH2F
ioqOlJaSl5ilmJevtaGgpaWloaGYlZyvvL6+vry7uru8vMC8t7i+tqqop56TkpWPiIB8dGJUYqR8
WVZQUFJPUFVbWGFeWV1dWWZ9kpqIgoiLf31/eHd/hImOmJyWlJKXmpyWk4yIj4uknpOUlJ2goZyf
pKejo493VE5SVlx6oJSMiYuIjI6GgYB/gH19e317dnd2cnRuanSRjn19gIiLjZKPhYaIi4mGgHl2
eHp8gZSjpKGhoammqaytsbKtrqWalpq1nY+NjYqEYkpDRD1FTkNCRVdiZGltamZndHR0mJ5xaGF0
nHNiYmBdWFRLTlJZaZOuurG2u7i1tri5ura2sbGwrqydmJuPlaa1s7W6y8KysLi5urjIuaaclZSN
jHBHODg6QENAPD01KSEhKSs6R0dGR01OUExlfYiWnKGoqqqsqKmnnpyql499c29rZmhtfZF0dHh2
j6GqqrK2ure4vMG+uLa7y5yNj5Wdm5yWlI+LgoKCfXl2cm5oam5ub25tbnB0cW9vbm52hIaFhIN6
dHeNj4yPlZGPjYmAbldXWVx7g4GGiIuMiomGgoCFiISDg4aGj5qNjY+Oj5efs5aKiY+MlZicl5iX
lpqcmpODeoCNprq62sqztre5v7Ozs62psLGuqqinoIiBfYWIjYuIioyOkY+WlIuNk4+LiYF9eXt2
cmhmYmBma257kpqdn6GmqaSloaOloaGxnYuGf21PQzw7UEU4NzEoLzlPW1tWW15gYVlXWVdbWFdZ
WVI6JyEfIScvO0lMT1NZV1ZVUEpGR0xOVGVtbXB5dHh6fX+BhoOGkoiGhYWKjYuMi6DWt4x0cGdp
dHZ5e4KGi5Obn52PhoN8dmh0lZ+PkZicnJqWmpaTlI+Jf3BeZX+Sl52qqK+qraWlpJ+Ti4mKl6qs
qKqsqainoZucm5uhqKWjoaOjpqejoJufmI6KhoiXpqyxt7u6urWztby+uLa3t7GxtrKmpaOfn6rL
8v7kmG5lXlBMVWt4iZWSjY+MjImSqK2xraWxzq+gpqOjo5+Sjo+Sk5eWlJSXnpWUl5eXnJSNjIaI
hYiGiYaAbWVgZWdqa3Jyb2hgWV50b3BnaVtZVVJOUHCBjJOUm5yhoZ2bnpiXko+GiISPqdunS0BJ
Ul5pfYyOj4+Wl5iVl5yWlZ+VgHp9goiKjo2Fi4uEgHZta1xea3ZxbW9zdHJ0hHBgVlBbbYN4dHR5
hpuMjJKSkY2Oko+JiouGfXSBzfK4oKSho6ehpKCfn5iYmpePgmJWdG9hYmtyjJNqZGdoam5tbmtq
a3p2e4SEhIyOj5iqlo6OioCCfX19goSNgHp4b2plZm9tamtwcG1qb3FyaWJrcHRwcHRycWlkYmhw
bnF/k5iaoJ6dnpeOfWJXUE1ORUJGR0ZHTj0xKi4wOUxta2lpcm9ucHZ6dnp8fYWCgoN9f399f4WN
jY+Lgn9zUC8iICUzUGVmZmJiXlVTTU5QYGqKm6S8qqanp6ytqp2Yj5KOiHxrTTE7TWFxeX+FgYF/
fYF8eXJlYkc+PkZgVVBQT1BQU1dTR0M+OjU4Pj0+Pj1AccKPZ3R7d3uChpGtw6GPj5GXl5SYnZiT
l5icmJ+TjpOLfWVYWWJxcWZmZWVma21iaGhtamhnYmJda11MTXCErK9fUFt2fW5nZmppam1lYmZv
gYmOmKOkqrOqqKShp6WzxbOtrLO2s7e4s7zBu7aus6+wqqOhpbywpqikoJOIckc6NzlFU2JoanB0
dnp6fXt9f3p5f3p6dHBubmZrhmtYantxVExQWGJwdnl9fXh0bnh4VlJcaWl0gouPj42GgnhdQTUz
PlBVUFJUTlJTVVVfaGt2f4KGiZe8qo+Yu6OUj42JjJqmqamvra2wtru5s8G+sKqmnpiTj4p4gIaO
kZifnZuYoaGcpNKffXRycm1qZ2RrgYyMjIuPlZaWnaGkqKSpqKShoaCclZSGenF0dGllYEs6PkM+
QkRJRkdNSkdER0ZCR0A1GiA6YIGUmJ+jp6efoayxs7ixrqiopp2LcGlxfISTmKOnrq26xcPFxMTI
ysS6t7N/anSJlJOXnKSnpKCgnZqkoZiVjX1zWVlfYGBhYmBiZWtlZmVhYltQSkI+PS4uLzA+Qzoy
NTQxMzE1RWJ7iY+Wm6GjoaGsrKyssLOvsbOzsKqwqqinpZ6KcniCla23vL/BxMTCxMXOxMLBvLat
nIuFg4KBeHRtaWJWT0s8KiEWGSIcHBgYFxkeHx8cHSkmGhgWGBkXFhoiICMsLC85W3eDiZKSlpKL
j5u4oKOnpZ+nqqmhl5asqJWdo5iUj4mCioaCgXp0b2dgVk1OUGeGk5OVlZSKg4mNmKaqqKeoqaGh
pZyblo+WioaKj5OPjo6LiIuKiY+co6agm6OmqamtrqqmoaGfn5iemoJ0T0RCSl97jpSYmpuen5+h
qaampqGamI+JiXJXUFBnfYmPlpSRkZKWlZSIcmpqZ2Vuj6/AzNPRzMnHx8nAu8HLy8XCxcjHx8TE
yMnAubCxr6WbYltid3x4hot8e3xzZ3F5mMTj29rc3N3d3dzW0sHCrZiTkYuKiIuNjoWEgHJfUk9l
Z2hnaGhqa3BueHRhX0tDR1hpdHd8gYWKi4h9Z11VSUFHaG9we31/hYV6f4aFgH+CfXl4cGhoXE1O
MSsuMDU7OkNEMjAsIh0nHSU1QEVHQURHRklLTUxTa4GNl5iYmqehoaOppaGkpJyYhGJyhYuUnJaS
kZORl5qfpqqxraipqKyqqK7FnJeyt7vAubjBv7y6uru8urizt7yonqCXlJSPhHt9dmtkZVRHRkdf
XVdVVVlbXWBffXRWVGJ6hISEgoOEfXdvdHeAhYuWkZOTlpWRjo6OjYqWi5yak4+SmJ2hn5+cmJaP
hlxKT09ZZIGIhImGhIqSnpSBfHp8fHh4fHl3eXR0cXRxd3h9hpeIiJOXiIaIi4aIi396eHR0eHl7
gpyloZ2eoamoqqqqqqemm5GWlpGNjo+NjIJqXnhPOUBGQ05VXmZna3BraWZ0bmtra2lraGRmZ2hk
Yl9ZUE1QVV1kcqO7ury6u764uru3sLK4trGspqSYkpOfoaqytbi4uLiysbKysbe3sbCjm5WUmmI7
PUBCREI8OjguIRkhJSw0PUNJTk1TVmWAipGTnaenpqikmpWamJuKg3txb2toa3B4e3l0dn2XpbG4
ubq6wsjCury7vsLCnIuRmqahmJick4mDhoB9e3lvaWtma25xcXBucXBxdHhxd32GjIqIfXRqbnSG
jYyPjYiGg3RgZHeCgYuLhYaJjo+MiYmEfYSEgYWEg4iOkY+NioyMi4yJhomPjIyPk5GTlJSUmJ2V
j4aCgo6mtci7s7i7v7m5srGusbCqs7Ksp5yPhoR/gIaKjo6Oj46OjZOVkYyOiouGgXt3dHNva2Zi
YmJmc4CPmJqanaWspKSkpKCemJWTiIF5akU7OjkzMjU1MCwsOlRcWVtYWV1eWVVTVFZUVVRNRjcr
JiIiKDdJV1hgZGJiZ2JcV1BNSkdHW2lubXNzdn18fYOBgoOPjH2BiYiEiYyMm4+DgXh0cXl0cHR6
gY6Yn5+alJORhXRZTlBihIyYoaCnoJqelJebmJOLgnd8kpSUnJ6jpKippqmhnZ2aj4SCg4mImLW3
oZaam5abmpeXn6GeoKChpKGgnZOTj5GIg5yjqrKztry8tri5ubu4ury3sKqpp56em5ah0PX+961z
a2dcTlBthpSVl5iVj5WRiZaqp6aprK+7rKSfoKWfmJGSipORlpeakpOXm5iYl5WUj4aCg4uOiYOE
gH1uZmZua3mGg3+FfXJhX1xZWVlgWFRXWFRTcX+Gk5e2rJidnJijm56WjYaIioqUs4ZOR01VWV5n
fY6YmJ2YlZeYn499fY17eH+DiYuLiomMiY6EhbJ0Uldkb3NydouIgIOAb19UTD1SZmhvdHmAjpKP
jpGVl4+TlpGPjYyIdHiGnqmlo6Smo6GhoJebnp6cmpJ5XlJcZWdvd3h5dHNpcoZycnh2f3lucXN4
gYSIjqSXk42MiouMj4iDgoCBlaCFfXpvYWFudHNycG90dHJucG1qZWdra3BwcG5veGhhaIZ4cH+L
mJygnpiblohyYFZSTUxQT09ORz46NywyLCwvM0BMYW1rbnF3e3x3fYB8g4CDgH+DfXiAj5y1kX18
eWlQLj5BQ1JianN0cGtgX19YUFNfa4GRlp2dn5+hqKafnp2fmI2JfHFHLC47UF1rd3t6d3J4cWtm
ZF9JRERARFdSTE1eYldTVVVSTUk7PkJAPjw8Oj5ThXNicm92gX+Dj6nOpI+VmJiUkpiYl4+Uk5eY
k46Lk6yNeWZbVmFqZmZlYm6qo2lhaWtqamdkZGFeWE9JUllte1dMU2FmamdpanF8ZV1hZW+BjZig
oaastbGno5+cm5uuubW1u7O2ub+/t7Oztbe3s6ysx62eobC/qp+XkoFlSz06OkFQV2VoaXB4eXh8
gIGFhXx5fXx4dnFyb3J7bmJlZGVma2tfWFl6gIqJdHJyiY9eSkxPW2uEjY6Si4OIfWlfPC87Qk9Q
UllTUFNbZHRweH2Ik5iYlpygoKa/pZWPko6Rn6eno6msrLezsbC2trWxsq+qoZ2eoZN9fYaTnLWd
lIyOkZOOkoR3b2JeWVleZ3Ogn4iEho2Ul5iYnKSlpaCboaGcm5qXloN4cG1oZ2ddTj1OWUA+QUdE
RkdJR0pMSUddQSMWHDBSboSSmKG3saGho6etsrOvrqipnoxuaGpwfZOLo6Gfs8PExMjIw8HBv7u6
s5J5eYqKk56hoaWjo6WjpaWkoJiRiXtmXFtdYWJhYGRiZmVlZGRhV05EPkJHNTQzNTU4NzMwLyws
LCw3U3J9ipOYnZ6en6OtsbGtsrKyubq3sq2srKqhnqyBcoGfs77CxMTJx8DCx8PEwsK5sq6hjoiE
gH14dmtoYVZOTEMvHBETEA4LERUXGiglIyMhIR8ZGhkdHRoaHCEmJiUmLDVHZoCOkZWjl4iIkpqc
pKWlqa2traGXkpePjpibjoqEhIWGhH15d3NuZllOS05Ya4SSjoyMi4iAgoaYoayqrK2oqLinoKCf
mJSUjI6Pj5qVkpidoKejpaO2waSYoaaprq2sp6yspJ+clpiUgnRiaV9BRmJ9jZSRlJianaGnsKqf
o6CYmJGTj398eHR4hYmWqqGgpKWqt6V/aGJeWWCGrb/U2tPOzsjHxcXF1sjFyMrIxcXHwsPFx7+1
rKqtqKWBgpKaoaOkp6ahqqqhoZasw9fg2dfU1tbX19XMx7mfn5eUj4iRlJOXlI+IenJZTWViZmRk
am1rcXZ2cWdbVFNod3l2d3x9g4aIhnx0a3tuQzhGZXGFgHZ5e3p7gX17enRzbnJtZmJZSzowLCwv
LywrLi4rJyIiGhYaLDo7QENDRENFTE1PVWiDlZugn5yfpK/SsZ+hpbOqnYhiX32JjZWRk5STkpGU
naqsqqGjp6mus76zqp2Lj56zubWys7m1uLq+u7qztbaupaCmpZiXmJGLhnx3c2tgVmBJNTs7R1Zc
VllfWVdbWVdTUFNZan2Df3hqa1hrb3B7goqKj5SVmJuNi4uBd3p3hpKRj5KRlZWMgnx8enh0aGRX
SVBYdn99hYaJiYmKhn17e3x6eHZ5d3Fyc3Nyc3R3e3l8gIWGk5GFiomAhYaKgpV9eHN3fH2DiKOh
naGmqKmvrKiutbOelpiXl5WPio6Mg25iU0E9QkdJSVlgZ25vb3JvZ21tbXF3fXp7em1naWRzcGlo
e3BeV2KKsbO5ubm7vLO8vry2s7Ovrq6noJqYoKSkqa6ys7e5trG3s7Our7OzvKqhpqOxilI+PUJP
WEI8NTMpHB0iKzlAQ05UWVtbb4KJj4+YpKepo56enpign4+EdHN6cmZudnl9fX2AhJipr7O5wsK8
wcTBvru2s6mTkaGdmJigmpaRj4uIfXx3dnJrc3p0b3BtbnBub2prcHB2goiGiIZ9a3CngXaKlIqE
gICAcmVmhqaak5aXmJufmoqFhoaDgYSEgoGGio6Pk4uGiIaDhXx8fYWLjI+VjpOXl4+YlYuLgoWN
r767s7jK17y4uLi7s62tsqqqsNe7joV9e3+BhJuujoSJjI+SjIyIjZKPi4iAfX18fHRwcmpkZGp4
hYuTmJahtaOgoaGhoJ2Ym5GGgIFmPTk6ODAxMiwqJyo1TVlWU1ZZW1lZVVVXU1dXVE9KRT5COjJA
Vl1iZ2hqbnZxbW1vZ1ZLSklWYmpucnRxdHl/f317f4F8d3h6fX+BhomGhYF8eXJrcXJwd39/i5Wb
n8Soi4aGfGtQUmJ0gZSdnp6jo6Ohn6eqpaGgjoaLkZWcoaekqaanqqGhoJiLhnx/enySvM6djoqy
yJqGi5yknZ2hmJ2joKCcmpONhoaFoLW2u7q6wLy8t7e6vr+1t7WwqaefnJWPj6Hn/vqsbW9wcGdc
Z32Om52bmJWWlJKNi5eclqGpqqilnqGloJqRkYyOj4qPlZWYmJOampSUl4yGhoSChIiIhoN/eW1o
apetkYB/goJ8gn1pXGJXVk5NUktJTFh8hYiPraCXk5uamJadwaGGhIiEhIiIcVxbVlZZYnifpZ6f
paGfoaOnhm9tb3R6fX2GiY2Ri4qLi4aDa2BgXGVqa3R/jJqPhomAcUwsKkRUYGpteICFhYuSjpeR
k5vHso2ChoR0comenp+lpLGpnJidnJybo6SbknBXZHFxbXJ2dnh0b3J4gIKFgoCOenZ5eXZ8goqR
hoaGhoiMjo+Mg4aGhorA0Ip2dmddYmp6e3l4cm9vcXJxc3BraGtwcXBxcXR0cHJuamhveoOJl56X
kpKDfHBeU1BQTkVLUExQRzs1KTAwLDExMzlGVF9yc3J0fYB7eH2Fg4aGhoZ9fYCEj5iMhZKGiHdb
a3xub29zd31/fHZua2FYWWJteYWMkpiaoaSho6Sll5SSj5KIckwyLzRAR1Zicn9zcnhvWVBSUE1U
S0ZHSlBOUGVkUk5KUlVMTT0+REBBRj47OTtCSlhra253eoaUnJiVmJuampiXk5eWl5SVmJOTlJab
n4+JhYpnWFtiYmJkdKqXa2hrdG1tbWpxdmJZU0tHQkNKREZUYmltZ29tb25hZWdlcoiUmKChrbOu
qqqpoaCWl6q5urOttry5s7K3s7G2ta2wsbGqqLWlpKShm5GGd2BFPTk+QENHVFxib3FzgIGGhoCB
fXt9fXl0c3Nya2dmaWZqa2tvc3RhTlhrfYSAeXN5dG5tYllZZIOMjIiGg314aFY0LD1JTElOTUxO
VXRwd3R6iI+RlJ2dnaCbnpucmJWSjpG1sJ+hqrKysrezsLO4trCusrKqqaGlqIx8gYaNjY2LhoOC
gXZiX11YVlVPTVNbbYCCg4aNkpSUmp2eoaSln6CcmpiWjoyShHRza25nYl1OPT1BPj5DSUdHSUlN
TEdGREM+JhodKklohI+apbOvoaCosbKzsbfFtamkk3JcZHR9gH+Ij5iywcDIx8jDuru8vrq8t56D
fY2YmqmspqOpqaimo6Gpn5iPgGhUWVxeYF9hZGZlZWJlYlxQRT44NTkyMTU1NDMxLygoKiwoLzVO
aYCBho+alJihprW1r7Cxs7W4u7q5uq+vp6GhpZaKlaWyvrzBxcjFzMfEycTBwbuxoY+Oi42KgHh0
amhkV1BHQDMcEQ0LCgwNFh0gKSgmIyEeHh4cGBgdISMhJissKigoMDlMan+Uv7yJfYaMmKClpqqq
qrKvoY+PkYyLj5OLjImCg395fXx2dmthUlNTUF5zgo2Ni42KiIOAho+foaaqsLGxrqGhp5+hnZiP
i4qWmpqgn6S3w8rEwtfZspyeqKyqqqinqrq8pp+217OGgGt0YUlJR1VwhoyPk5ieua6nqqehn5+c
m5aTkZuOf3+CkqCxrrfHwrOzqpiCZ19dXHihwNLZzs7KzMXJxb/CxcjFxMDFxcnHxb/CvLOuo5+e
k4qWrq6nqq2vsrO4s7GzqLbH0NLR0NHQzM7N0dDEsaanqZ6OjpuYlpibm4+DclxQaWlrcXF4cG93
dHFraGlqbnB7d3l8fX+BhIaJf3l2c2BBMjBVanJ0fXt3fXt4eXp6dHJrcHBoXFBEMywuLjAuKycs
KSMjHhkUER0xN0JDQT5BR0dJTFBkgpSfpKCjo6OfsrOhpqeloZeJZUuJjYaIkpWVlZiXk5+lqKao
paqxtbG+xby1rJiDip6osbK1tri4ura1u7mzsKyqoJeYn6CgnpaOhnxya2RkWUpCOCxGWVxYWVxg
XllUVlZOSkxJT1BYdFxKUGRvcXR8wLOAf4aMlpiJg3l9e3RwhIuIiIGBf4OIi4uMjIJ9eGBMTFJr
eoOFhYuMjo+Jf3qAhoR0cXN4d3l2c3Z4c3F5gYCEgYWIgoSGg46KoNmobWRpbnJ3e4KChqalo6Gj
qqissK3XyJKPlpWaj46RjIaBcF9QSkNHR0tbXWJqa29wcnRwbm15hJKOj4qKg3drbXJ0fImThJFw
ja2qrLW3t7m8tba6uLOytrazrKqknZ2+vKWjqLK1s7q3trWws7OwqqOel5WUrLWIVT4+PkFDXEQ4
SiERFhomOkVJUFVXYnCAhouMlJie19Odm6isspSJjIWGempodHd9fX1/hoaGobW2t7m7vMXKv8C/
wsm7p5OOlZyanJ+lnJWSjoyCfXRzdHB3eXx2cWhqa2ttaWhtcnR8gouKhoV/d4GKi4N7gIGAe3Ju
fYuPlZedo6Wmpaqpn4yBgoSDhYSFiYaGjpKNfXR2dHFqbX2DhoqPj4yIi5KYmI+SlIuElp+krcLI
ub6/uri7vry7sa6ppaGjoZ6TiYB8fIGGg4WGj4qNkpOPhnt7io6OgXt4enhxbmpkZF5faX2MlJGR
lJaWnJ2dnpeRkZKNi4qDX0E4NTQ3NDAsLCojJzJGUFhYV1JQVlNQT1BSVlBWV1JPUE5PVFRham1u
eXR2d316dnd3cVRERU5iZmpub3FxdHl2enh/e3RwdHmBg31/gYOCf3iKjXJpa3Sas4l9kpWVnZeP
jYiCfXlranR/lKOhoJyhpqqys6qto6WloJiRmp+fnaGhoKCgoJuYmJGEfYiAdnigvI52d63lqoOK
lZ6YmJycmpqampqVj42Aen2bs7e3ubi1tsW+urm4srO6s6imnZyPjZGSj5uWloSCfXlxbnF8iZSY
nqGfmJePhoaEg5WNjZukqKGfnZiUkZGRmIqOl4+SlJWVko+SkpiYiYWCgIGGiIOFhYJ6a215j5GJ
hoaCgIKGhIBnYlRYWVZOUlxfboOJjI6SkZGWm52anZiYl5SGgISGfXJiWVdVV1xzo7epo6OmoaCh
pKGGb3BwdHd4fYGChYaIg4Ohi3NoWVlZYmt0goaDgYaIl452WUo+OklVXGJwe4SGi46Tk4+aoJyW
kYuMiJ2LlJyhm56doJ6hoZqcm5ilr5uKdGp0eHFtdHZ4dHd2eH2CiYmGiYuJjJ+aiH9/j4uGhISG
jouGiY+PjYqCiI+Wf3x2ZV9gZ3Z2eXpzc3Rzd3Fta2tiZGVucXFxdHp4dGdiZXF9gYSMj4qOi4R9
dGlYUE9OTk1MT1BKOjgpIiUpKywzNTlAS2tzcXR3dHR5eIGDgoWGjYWGfH2FhoaGjol0bXCAenR4
f4WBf3t8gISCbl5eYm12gImOjpObnp6cnJqbk5GNhoJ2cF0zMTQ7RUlQVFlmfVlLUFBVVExJR0dH
SUxOUlRQS0dMR0A+Q0lHTVNWTUI+OD1DTFheaXJ7iZKWmJWapKSdl5WYmJeam5qYm52XmJqWkY+P
hXllT1NeZmhtc25tdH15dnRtbXJ5aFxYUEpCPT5HTGJwbWZtbWpraWZiYmVphJSfpqysrqqtpKSk
npaRnbe7tbe4t7G5urO2uLCxsK61qqCUlqGcnJuVhnluYUpDPkFJSkdESVxtanB5jIqDhIF9g312
eHR5eXJvb2Znbm9xdHh3cV9SaZyKgnyCfHd2eHZ0dG1pfYmLhoOGfHhrWUE1UE5HTVVPTlJSaHJ0
hYqNkpKanZugo6Cdm5+Tj4+Pj6CmnZyepqeqsa6wurmws7O4srGupqiopImGiYaGgYKEgnp8Vk5U
U1NOTk9SUF5yfYSEg4aRjY+SmJudpKOblpuTj5GLg4yBdnBrZWBdWEc4MzdAQEVHR0pOTElHS0dE
RDsxIB8nQF9zjJegqqajpamvr7W6uLyzqqGqjGJocnx/g4uKlbu/wMPDwsHDury/v7m8p4uGipWh
qqalqa+qqKqqpKGYlZeIb1lXYV9hYGJhYmRpaGZZVU1BNTAsMDgyNDg4NDI1Ix8lKysvOT5ddH+I
l6Gam56qxLmss7O6ury8vLmys7KmpKGcmJipsLO8xL/DxcXFx8nHwcLAvKqbjYmFhoaCeGpiZGJb
TEI8MxwRDgwMEBw6MCYnIyYjIh0ZGhYRExoiJSMoLC4rJygvOklfc4WekYOEhIugpaGjqa6ssLmq
mI+fk42RioWAgn16dHZ2cnJxZ15UUlJWanyCkoaFhoWAfHmCj6Gjpqiwr6qhpKWjpKOfnZePjZah
paGhtsXN0NPV1tLHuLavt7yyr7e1w8Oqo77HrJaYeWViXlxDPmd9jI2PnaGoprGyr6ilp6Sdk5eb
mJaVkpiyp6Szubm7u7ezraV9YFVZa5i1wdHT0NTS2+DJusDFycnIxcnKycnFxcC8rqqsoZiUl6Cp
rLO2u7/DxL+8t7GtssDIysfIycrLys7MyMOysLGpoZiVn5ueoZ6Yk4p8ZF6cjn12enx3e3R0eXd0
cXFwb3R8fIB7f4aJg4B9fYZ/dkwrIkRib3Nze3Rxc3Z0gKF7a2hra2deUEU4LC4sLjEsKy84NR8m
IRUgNTs5PD1AREZCQ0RJXHyGmKCmpamqp6mhpKqjnZqOgFY1UJiOhY2PlZiYmJ3Es6GkpaqnrK+v
uLy+ubm1ro12eH2PsbO3sq6zs7Kwra2qqqShmpiYm52VkY2KhHpzZ2RZUk01JzRLUFZbWVZSUFNQ
TValtmlQYG6Vdmpuamttb3l9d3qKiIWLhn16eHRyb25va3iEj5WUlJSYm5qYko+LclBCTmhzfIWK
jYmNj4qEfHh2d3R0cHN0cnN0eHdxdHR7f3+ChYaGhoSIjYuYoX9waG5wc3R4dHt7gpelpaSnrq+q
sKmYlpSRj5OSkouIg4NxX1RHRUdKTlZdZGlqa3RxcnF6iomUnJibl5OLhnhydIadmpaOk4mOnqaz
uLm2sba3s7Wzsa+1s6qop6CdnJGOoKOnsba4tbGssbCvrrCzqp+Rj46am3xkTUZDPkA7NDEXCAsU
GjA+T1RTe4V9gomKjJSbnqrEuZ+eoaaYjI6OfXRuaW92en+AhYSDgoqos7C2vMC7u77CvsC+wcSz
nIqLjpSqpZ2Yj4+RjoyFfXh0eHp9f4WGjnJmZGpnam+Fl4aChIuUlo+Uj4mIiYmDgoSOqIyBhZST
naWqraqoqa2spJOEhYWIiYaLiIiLlY6ApZFzbXFkc3qAhoaFhIWIjo6SjY+Uj5ehoaWtu8K8v83A
ta+1ubyqpKOkqqWblI+Ge32Vm4J9hYmNioaKi4uBfH+BhouCeXd3e3Zxa2tfXWR5kY6SnJeUmpuY
lp+cmpeTk5KFempMOTc4NTEsMC8rJyMnOElQVVdWV1dSUlduX1BSU1dZV1l4eVdTZHB0eHp8e31/
g317e3Z4alVMS1lvc2tucHBxdHh4enx4b290doy8jXx9gH15d319b2tvdJegenyKjo+Pj4+PjI+P
jIJ2dHmPoKOhm6S7wrWsra6sp6ippaq2npicoaqlpKOhnZ2YjoN5cmpriM2MXmp3msXupXuOk5eY
mJqemJSVlpuRjIp9f5Wvurq2ury6vrq2tbu3sbOqoZKLio+KhpGTiYaMiISCi3twfYycoaSjm52Y
k46CfYOMgWFxi6Oclo+Pi4yOj46LioqKjImJj56bj4+UkYmKgH9/gIaJkouIkpZ0dIGPj4uIiIaI
ioaCg3ZcXVRQSk9YeJWFhoWIj5GOj5WVjpOVmo6NiYWKjYJ7fW1dWVZec5KqsrOuqKqoqqejmoNp
ZWtrcXqBe3t/hoOBgIB0b2ddW2FiaHuIhISDhIWNiXtqYFBJRUlSWWt5f4CEipOUko+PkZONjYyD
j56bnp2Xl52gnpucnZiYmJiTiYqDcm9ybnd0c3l4fH2CfYKJj5Ofn6OlpaGckZWPhoGGiImKiYyK
jomPj4iKhoiKg3F3ZGJrcnp9fHh0cnRza2trZF1ZYWhtam1weIZ8a2JdZnR8fYmDgIKEe3t0aFVO
TE5OUk5SV1A6MCgmIyUnKCwuMDQ+Um9vamtxdn2AhIWKhoaKiImGfYOJg318fXR0d4SEhIWIi4mF
hYaGhHyAdGtrcIKEhYuSmJicnZ6enpyYlY+PiIR3XjsvLDA7QkZJT1VYUFBUV1NTU1BQWFJORkxL
TkxHRj5AQkpUYGJgYmJhXlRGRTg7SlNgdIuVlZqYmJydnJ6emJytnJeWm6Chnp+foJeTk5GLkXxQ
RlNdZW5ycnh9f4F9eHR8dHFrYllWRz4+R1Bda3Rybm5qa2ZnYltfYmqElKGlqq2qqqikp6Wek5Wg
qrC/v7qwrLCztbezs7OvsrGonYaGjomOjIiEeWtXRT5BQUlLUFNQUmJVXXigk4uFgYOAfXt3cXZu
aGtubW5wcHJ0d3R0cmt0g4iIgoCDgn96fXh3cHF4gIOChIB5dm9iVUlLSUxNSk5NT1xmcYKSko6T
n6Glo56cn6ahoZqTk46Oio+YnqOlqa2xsbm2tbi5srG8urq4s7O8qoaBhIR8fYiEe1RHSk1QUE9O
Tk9VYm95gYKGhIaIjpKYl56fnJiYnJuPiYB5dHJpZmJiYl1XQzw4NT08Q0NCR0lJS0tLRktEQDol
GiIzUG+CjZihoaasqrCwsrOzs6+qqrWYdGt0e3uCg4KawLi6wMW/vLzAurO7u7y7pZaJkp2nra2u
qrCzraehnp2Yj4Z5YVlfZmRiYmJiZ2pkXFVPTTwyLDE7Ojs3PDU0N0ciFBwmLjM5QlhreYSPlJeh
pqe1t7e5s7a7v7+8srOxrqihoaGjp6yut8LBwsfFzMzIzsrFwresoI+FiImFgn16dGpmZVxQR0A0
JRcRExYdI0M8KicoJyEmIyUdGhgRHiMiKS4vLC8sKDNSYmlzeX2GjoqNlZuhoaSqsLezt6iekqGJ
f4iDfXh2eHh3dm1tb3BnXFBQV2d0f4yXg3t9e3JzeIOGlqSkqq2xqqelqJ+doZ+bmI6SkpKepqy/
0dfW1NnVzsrFwsHLyr65ury6saepqqyfmJWGc2ViXE5KboaRj5GWm6CqqaypqKmmoaGdnZ2YmJ+l
o6qqs9HCu765u7auqZhwWVdkga7J09fg387f7M6+xc3Ix8XExcPCycTCwryspaCemJ2hpqqvtrfE
yMTCv7y4uK67ysW+vMG/vL/Dw8fBtbKwsK6tqJ2gpKShnp2YjnRgVIB9fH19f32Be3l4eHJ2eHh2
coCBf4KFgoaDgHx4dHRpQy8iPltofXOFd2tyc4B3cW9xa2Rka2RWRzIqLCosLjExMDAvKiMiKURD
NzU7PUE+QERGQkxug5ihoaGlqqyppqqnnJOPhnZVS11ifY2PkZKPkZaYmKCoqqqoqqqwrK66vL+8
urOumH1/dG9xfZKgs7GwqaaqqqGgqLmVk5ibmpaVkpSRhXppZ15YU0YzKDtQV1dWVW9mTkxPUFhm
aWt0eHlxcXR9fWtwcnh4f3uBgX2GeXlxa2+EgYuCiY6PlZqfm56ho52amJR8UiMOLGJ7gn2CiYaJ
hn19dnRtaW5waW90dG5wcmp9fXR7fX2BiYGGmKqqoJqYhHNlZW5xdnFxdnR2f42apKmlpqmpnpKS
mJSOjo2KjH9za2VfV01MUFJYW2Jpbm9tcXR4eH2Elqeqs6Gjp56ThoaRnKCamJuXlJWYoKywtrm3
s7a5trWysbKqqrCwpKGekoGprKCmrrGusLGzqq6qrqyqoZqVhHx/c1dLR0ZAO0E3HQgDAwsgNUNN
UFBdfISJjIuYn6Gkp6qqqKeqp6eWhIB6cGpuc3mnj317hYaLjaWuuLq8vL7AxNDDvMO8ubKhj4iO
sOn8y4+LjY+Oj4uBfXp2d3qDg5Sqa1lhcW1pa3d9hYSJjY+Pko+SrZ6MioaOj5GakoaLkZifoaGl
p6itrbCsoJSKiIKFi4yOjo6RoIF0cnRxcWtucn2GhIaAhImIiouNjZGLmp+fpre6urO2ubq8t7zA
wqycm5iWlpWPj4J6eHd7f4GEhoWKioSGfXJvdHt9gXx5fXx4d3RqZFxdYHGJkY+XlpWdn5+hnpyc
l5aPhYBtVj4zMDAsLzAsKCMjIydAVFZUUlRQUFJOVHttTklTW11eXWBqYWdudHZ5en17e3t/hIB9
d3duXU9KX3RraW9uc3d0dHJ0dHlzbm9ydnl6f3h7fXx5cnFtaWtzeHp6gH+Gi46Rko6PiouLhnp7
hLO6npihqK64vLyzrKyvqqihnJ2YmJibnp2em6CalZSNhX9wbm9whnRwa3F0e6Sqho2WkpaXlZqU
mJiVlZGPk4GCkay3v76zuLa3uLWzuLCsrqiYjoqLfYKJjZWTjY2LhYahg3ePpLOpqaOgm5iRjYiE
gnRlWVhedI6OjpKOjoyNjo6JjY6PiYmLi4+PiomGhoGChYiEiY+PjoyPjXt/ipGUko+OjY+OjImF
hHmFYkdLVm+Ei4yKioaLi5ORj5KSj5WWj4uKiIWGgoCDe2lgYWmGmKizsK2xrK+sppuYim9oaWpu
c3Z4fYB8ent5dHFraF5faGVngomFg4WGiImIgXdpWE5OUEdPZnZ9fYaOioqMkY6Oi4yNi5OYn56a
nJuam5ubnZ2YmpOOlIyIhX1ta252c3uYem50d4WJkaGeoaqxraympaaflpWIhIOFhYaJhYmOjpKM
jYaRoZGRhY5uXmpven15en17fXpybWJiXlhZYWprbXNxhoBrYV1ib3N2fYB8eHp5eG9kUkxQTktQ
UFB4Zj0pIiEgIyMoKi4wNDVDX2pucXh7gYyLhoaNj5OPlIuChIGCgH17fYCFjIuPkY+Rjo+NkZGV
joWKhHRzfYqNlJeWmJyen6CalZiVlI+MhXtvUDMrKTI4PUNJUFhQUlRUUlhZWFlVTU9MTFBORURH
SU9dZWZhYWFmaGlpYlZJPjk7QlVpi4+SmJqcnZadnJ2eo6Wcl5+lqKeknqSjmJeYl5KKfWFKVWJt
cXR9g4SBfX98e3p4dG1kYFVNT0tNXG1zd3ZzcG5ta2hiXV1dYnSUmKSxraqqp6aknpedoKSou8ey
qrCzr7Cxr7CytbCtqqGKgoOKhoiFgHl2clc+PD0+RFVfXV1ZUkBHdJqVhoiFgn1/f3Z0dHRvb3Rz
cXR3dn95d3ByeIONiImMhoaFioF8f3x9dHFzfYGBfXt3bWJbT01NVFRPTk5odHaLkZWRkZidoaGk
oZ6cnJuak5GJioaFgYqTnaOlsbCusLe4ubO1t7O3ure8tbOmjYmGg4OAdHBlTkxJTVBPUE9KT2Rv
enp6e4CFioqJlJeanJ2YmJOSj5iOfHZydGhgZWJfYVRFPjs5PDtAQ0tPSk5LSUxKUFVFOiceIzBF
XXSJk5egpaipsK6ura6xsKmtppeGdHJ0kaCDe4mhucfEu7y8u8HCvLe5vuTFsJSNm7CvqKmnrLGp
oaCblY+LiIV0X2BgZWtoZWdoYVhURzkwLCksNz04NztXUzo1NRgQHyowMTtKYHF8gYyaoaGlqq6q
r7W7vLazt7m1r66ooaWopKWnqqqzvLy8x8XFys3FxMW8qZ6OioWGhH2AkYByZmhkWVBCOzUwJhgd
JSksMDAsKykpIyImKSUfFBEdJyosMSwsKS8yQnJ4dnqFho6ei4qXl5+ko6SusrGqpaSPe3eDgXt3
c3FubnBzamlra2diW1tffZSEhoSAfX14cnF5goyXoKquqqmmqqSnp6aho52alY2Sk5ijrMPV3+Dd
19fV0MzIzMjAxMTFu7awsrCqqqSdmo14a2ZfU1l3iIyRlZujp661sq2wqqihm5yfmp2amJuksriy
s7W8wby8trCmn41oWV1umLzMztvW0c7MyLzDysrLysLAwsjIwsfOu6egpa2hnaaqsbm8vsXMzse8
vL68rbG6wri1s7a3urq7v7u8ubazr6yqo6aqqqqkoZ2OeFxWf39/hYB/gX+CgYSGg4+AcnN6e32I
hIWGg4B5eHZ2bV9LMiM+fH98aWtubXFycXFvbm5ra4+UZVJFMysrKiwvMzI1PkQ+Ozw9Nzg8PD09
RkVARUdHU26Il5+nrbW4r66mppyamI93V09SXltxiI6Nkqeql4+epKmpp6qvrLCvrbjAv7yzr6yS
c3Joa2VfYmiCoaGco6OlpaihmJqlo56al5SJjYqPhXhrYWBYT0U0PlNWUFJMSUZJTVNXXWRva3F2
enxzcXh0d3Zwdnt9gX9/gIWCgHFpZmZceo2TmKOlpqysqKmknKOmmotiMCtAZXt9fX2DiIyIi4Vx
a2hraGdnaWlra2dnYGhvdHN7f32GmKqtp6GenJeSdGlkX2htdnh5cm1yi7GqoaCmr9eyiYuMjoyD
ioF9hXhrYltSTEtKUGWKa2Joa2trcHB5jIqUqqqkoaGnqKeknKCgoaqon5iWmJqdrbK2s7a3tba3
s7C1sKqopqqppJp0lq+goaitra6tr62mqbGqp6WenI5raWdfV1JNRkI9NzUYBAADDSs9RklQV2d9
iI2PlJqjqKmnpqanqKamqqSLeXR0aWt0fYGDiIaIjY+Sl662ur+6v7++wMDAwb+1sKeVjI2S3va1
lY+WlpGMiIZ9fHt6fIGAjKpwYF1na3F6fYWGiIyPkY2PkZOVlI+OkZiSk5GRjpiYnaOnqKWnrq+q
qa6qoZiRiI2IjY+Rjo+AdHR5eHuCd3JxeYCDhH18fIKIhX2EhoWNnKCvuLW4uru2taywuraqoZeU
lI6Pj4uJhX18dHd/gISEg4WIgX12aWhqdHl7fHh5eHl4b2dfWVlccYSMj5KYmp+hm5uhoZiTj42G
fXFmRzMyKCwsJyMgHyAiKTVFTVNUUE1KS05KRkdJVV1cYV5fYlxiZ297en99g4KAf3h7eHt9dHBp
WFBUZGBpcHJzdnZ0cXBudnBiZWhrbXR0dHl3dHp0bWtpcW5wcnd9hIaDiY2PjI2RjIN/hIiJ4uum
mKmyta+1urezqqymoabBpZaYmJyhoaOkoJ6VjYqIfHZraWtwdoFwcXZ2eH1/g42PlJWRko+Tj5SS
jo6JhI2kr7GyucO+urOzsLWzraiszbV9dn19hZGYj4uOiomFf3p5f5SWnaGlpqGYlpOPhoB8c2ZS
Tllug46PiYaOj4uPjYmNi4mMiIWJioSJiYaPjYSBiIuOj5KWj4uSj4qMk5WPkpOMjo+Kio2GdmBQ
R1NmhI+NjYqNiI6Om46Mj46MjIyOjoyPkZWNlJ2Yi4F/hZShqLC2sq2vqqSemJKNemtrZmhubnF3
eHh9enZua2VlZWVnZGp9fYCBgoCEhYWEem5lX1lVR0JkaHF8goSJioyPkYaGhoyNk5aYmpidoJ2d
l6iqlJSWk5KPiIuEe3BpaGtycXFuc3eFjZieoaixs7O5s6ypqqmho52PioaKjIuGjZ+cj42PkY2P
j46JjXp9iI6SlI+LjYuMhXx2Z1lcUlNeaW90d3l4cWlZVFlibnR3e3p5eHl4c2VSRkZJTEtKTldH
MSgjICIfHSMqKCwxMz5XZW9yd3l9g4qJj42NjpGMhoB5eX2AfX+LhYWOmJaTko+Tk4+RlZKNlpaT
hHh3gIKOlZScoJ2al5SVkpKOioyGf3BXOy4rMjU6PUZOUFRYUldbWFtUU1BVWVRTUElEUlhiZ2lo
Z2dkYmdlZmVkX1RHPkBBR1Rrgo6Vko+Ynp+dl5aYl5icoaShoaGhoKGdpLOfjYZ9alRUYGpxeICF
hYJ8gH14dHh7dmlgVVJbVFRocXh6enhwc3FuZmFcW19rdo6jpaSnqKelpKCjnqOkp6q4v7OurbCu
rrGvsqyytbKql313gYWDg4qOfHZxYj41OUVQWFhfZmthRk9zdHiNjoZ/f4F5c21vb3N2c292eoGC
eYCSeHR9jImGiIuNjImCgYaFeXlzaGlpcXl9dnNrYlxYVlJTUk9KUGVwdI6Wkpaam6GdoaCfnp2V
j5SSjoyGf3dodIWSmJ+osa+zuLiztbazuLu6ur62trOXiYiGhIJ5cmtVRUZMTFJQUEtSaHSCfXp8
f4OEiIyRlJOPl5ucoI2IjIFwZmdwZVtbWVZPTUVFQ0o8OD5HXmBHSU1JSkdGPjw4Lys1QENTa32N
lpujoaaqqaqssLKwrKmelo9/d3iUp4J9lba8wbu6vMC2t767urq7vLKspJynuLuwqqioqqSdmpaX
koaBgXd0c3BtaW1nZmJfVkc0JhoeLi8xOD5HR1toQi4oHBMcKzM0PEpmeH+KjJKbn6Gsqqqqsre1
s7e5tq2sqq6gra6opKaqr7O5vLzFycLFxcHBuKqek5GLhYSBfX+NfWtnaWlfU0dANDE1LC9DNDEy
MS8rKCkoKicjIiIdGigrKi9JNTIsMjtLbZKMi4mJio+Pi4+VnaWoqq64trOpoZJtan1uZmhpaGlt
amdra2ZoaY+LZGSGhoaGiIOCfXZxcneAjJednaWqo6Ohpaelp6aemJiSjoyKk52qvtPd2dbV2dfO
0szMxMnHx8W8urmzs7CppaijmINqZF9Vb4aGi5GaoKWprrO4ramuraaloZ6dnZ+doam3t7O2u7/C
wLq8uLKnl3BhYWuRrsvV187KzdDSsKa4y8nIxb+8vMPF7v7fp5iXpaGnqrHAwsXOzs7JzM7HxcS8
p664qamoqa2trq+utry6r7Oxr7OurK+wrqyqppRzZFt4fYaFfISGhIKCfYGFhYx9eJiFen18gIF9
gXhzbWhkW0YyM5r5/uZ4Ul5zeXF0fIKEfHhzbWJcVTwrKTIxLDAzPD4+QUFBOzo5Nzg5OkA+QUJD
REdbdoidoaess7CoqqSdmpOUkoFhWVheX2iFuJiMj5SVqMGlnaSorKqtqqaqtsDBu7CopI+DcGZh
YmR8aVlokZ+Okpqdla+dkZGUmJeYlJWPioiDf3BoYVxeX1lHRGVTXGRHQkJHU1l0dGlobnZ/fXx4
eHZ3dHh8loyBhouMhomAe3Z7hmGEj5GpqKChqKeloaaqoZyVj4RcR0JYcoCCho+RmpJ/cWJnZ2Vi
ZGRhYmZfYHB2ZmRrc3p0fJOfo6Shm5qdnZ6Kdl5bYml0ioiJdHiMobOnqNz5tYaEioyNiYODhHl3
cGtZVk5SVVJQXJF2ZWJqa3GAe3+GjJuhpKytrainraWeqaynpKalo6Gam56osrCwsrCsrLKxramk
pKWdoKGej2lZdI+kqK+yqqqsrKqsrKqknZiUk3NdXVxWVFNNRTUpHBUGAAAUMENHS1JYbYiIjJed
n6SnpqyqpKitn6aopJuFknhia3SJgY6VhoWMjY+Sp7O/vMDFxcXFyMvCt7azrJeIiouVnJ+enJ6Y
mI+GiomEgHh7gol9cF1dYmdudHp/goSNj5GNi46Pj4+OkZOalZWSko+SlJeYnKGhqq2qqKqvsrKx
pp+RhoGKi4+PmIVwdnh5e4BwXXCAgn16g4SCf3x9fHh3eYWYpLCxtbWwsbXDvK+tqqmck4qMjo+M
hYiGf3tzb3SAgXh/f3t9dGJgYmZrdn19e3R5gHdqX1lYV19pfYOGipKVnaOel5ibn5uXkY+GcmFJ
MSolIyYiHh4aHh0gKCwzOkBJZE8+PklEPkJLVVdfYmJiYmRpa3R7f3t7gX19fXx5enp0c3FqXlNL
W25ycnN2eHx0d3hzb2ZhZ2tpbW9wdHmAeHBxa2hqlYloa3d5fYuNj46MioiJhoCImoCx27Olvrmz
uLazsK+qpaGfnqqfm6eenKOqn52hnZGJiYqGcmtpa26ayolqa3Z4eXh7g4+Ujo+PlJaUkY2Yo5GE
k7Oorbiys7ezsbCxr6mkmJKShICBhomMj5aVj5KPiYR/fHh9ho+crK+oo5uUjYiEg3x5Z0tJW2p9
iYmOjIyPkY6NjY+IiJWPhIKCg4iDhYWBgYWMpqSRkpKUj5O1l4uSkpWXlJOUj4uGhY2YWUdEUGaB
ho+Sj4+Om5SYk42Oj56Vj5qakY+fpqOdmJaXlI+Vo6Onsrq1r6yvqJ+hm5OKc2lvjnFqa3N2cXBr
bW1pZWRlYWJrdpKAd3p/fYKJhoZ9fXBkYFZLTIhrbn17gIWGhoaEg4mJiYmNjpKanp6anZ6ako+S
lpKPkYuEhYaAb2plaHyAa2ZrhZeYnKaquMC8tbWzsbGvrKqhnJ2OhZiNiI+Ojo+OjpKTlJKPjoyL
iYuJj5WWlZiajYuGgnpmXlRNV2JpbXaKhHpybV9YWVxkbnJ0dHd3eXNuaFNJR0dHSk1TWD4uJyUl
HxoZGB4hICswN1Jnb29yeHyIjI2Oj46Oj42Jd3Z0eXuAhIOCiZKTj42OlJibnJeXmJielpOPfXh/
g4SLkpWWlZqmmpKYlpWUlI9/dmBHNTVPRj4+REpPT1RVVlhZW1xiWFVTVlddXldbYmZmZmhoaGho
aGtrbWtmXVJFPkJHSWKGj46TkZ2Ympyel5ybmpqkpJ6mp6SjoaSmtZiTjIWNe2tvcXSBgoaFg4KA
gH17eHt0ZFxZUlNhXWlydnh4e3pzbnRoZWZiZGuAiZacoKWmpaWgnZifo6Olp6ippqmoo6yurqqt
rq2tqKOLfH99f4SFf316cVtHPDc6RlVXXWBramphW15ic46NiH1/gH12cW1teX99fHt/gIGBgn2E
e4GGhYaIj5KPjIuMi4uBdnRxbmtra3J6lHdnZl1bXl1dYVtkZGuAkZKYk5abkpifnJyXlZqXko+I
hYV0Xk1ObZGkqKmsqaqvs7a2t7m5urO2tbi3sJySjpHBpHZpZ1hHRUpMT1BSUFhyhIJ9e31/goKK
iIWOkZSalo+OhoZ5kYVnXVlZW1RTTUtCRUQ8PDc7PkVLR0ZFRUQ+PTs6ODo4OT5GQktSbYSWmJ6j
p6GhqaimpKGlpaOflJF5en99fYaTtrqxtcC8s7i/vru7vLi8sK2qqK6yuLm+sqSjoJ6dmI2Li4GE
hH15eXZybWhdWVdHOCodFx0zNzdAR0pMUFVGOS8jHSArLDE9SWV5hYmKj5WdoaSmqqmqrbKyvriu
qqajn6WwraqoqrGztba3uL/Cw8C/uruyno+MiYN/fX+AgHdwamRmZ11SRz4zMTIoMjQwMzUzMCws
KSspJSMlJiUjMCwrMDg3NTg+SmSRxJeBhYmPjoyLi5GYoaapr7WtpKChmIZxclhMSVNZYGRoZmJe
YWBro6NmZHmImIyCgX14dHFzdHeDj56goKSkqKalo6WnoaCYkY+LhoWPnqi+1eDf29vX19fSzMzO
zM7Nxb/Cvra2srOqpqGYhmphXmpyeoOJk5qcoa+xsrW1sa6np6ahoZ6joJ2hqK+xtbm/xcXEvry+
trCkhmZ0yOi/tsPOzsvOy8immrHQzL68vLu5srLT49mej5OhqLW7wMTEyNTfzszNzczKzNCxnoqM
k5ijqqeur6+zu76+trCzs62ur7Czs6qto3JnZHd6fYGBfH1/gX2DgHt9gXlzdHmKgXt8gIB8enRv
aWReUEdx6P7+4nxWYnaAi4aDeXp5d3Z7gmpJMzQwLy4uMjU5QDo+Pjs9PkY8PTpCQ0NDQkRASlR0
n7Ohoa+xr6yqqaSjnZyXjHhiYWRtaGp0m7yTi46uzqqqp6eqqqmjoaizvLixsa+eeGtpZGZxfZN/
dHBvW1yPqI2XmJOYp62dl5iYl4+MioZ/eW9kYmJiYk49QUdMR0ZDRk1baHFwb3R4eoWDfX13d399
hIuUm6agoaGVjoiEfXx0b4GOnaSkp62wsKqnqqenp6GdloVpRExtgImNlJiYlph4YmFrYF9fYmVi
XltdYmJeXmKbrHR8j5qdnZuWnJuelIJmWF9hZnSGlJyPhYymoZzJ4K2IhoaDhoWFgn15cm1mXGWP
YUtLTlRVWVxia29wbX18gIOGhpGtrqWmpammoZ6kqaikqKGdm5iVlqGpr6qqqq+qrKqmoaGqoKCd
m5yOYmF0kZabpKiqqKqsqaqoo6SdloRrXmBmX1lXVVJZVSwgGQ4AAiE7RE1OTFdvipKVmqCkpqGn
qKqsraqmp66uo5yUdGJqcnp/fYWGioyOjpKesbq+wb67w8rIvL+2s7CpmoqSl4ySnZ+bnpyXk5GN
iomAgoJ/eHRvYmJpbXF4goWEio6UkYmLi4yPkY+Uk5KYnZiSkZGRkZadoKqpp7CytbCyra6tpp6S
jouJkZGGd3d4icOhbWFVanh8fHt8gX19eXpzcIB5epKkraeqs7WzrbCxurWXlY+EgoiLioWAf3t6
f313fYB/fIZ/eYRwVVBZX2hyhI50a29tZV5cWFJYXGp8hIWLjpWanZyenZuglo+UjoueikkxKiEj
IyclHxweHyIlKy4yNUBBPj09Pjo9QE1VV1leYGZnaGhucnN4e3t8gHt8gH16eXdwcG9oYldgZmtr
d3x5fIF9eXlzb1tkaGVqaWprbnNzcGtkZG5tcXJ5goB9kpSMobKLgH19fXt6e4SWra+vr7rA07ip
p6qjn52YnJicmpyhpJ6dqKaWk4yGhYKDdHBwc3Z6dHp6enp0dHd5g4uUj5GRjo+Pk5ykpZ6XnKGq
ra6qqq+vqbepoJ2Je3d4e4WPk5iWj4yLj42IhYJ7eYKKj56hpKGdmJWPiIR6fZ5vUFJpeoWLj5GO
kpKMiYaLioWDk41/hYF9fIqjhXl9hIyXmI+Rj5OTkpGRj4+Sl5aTkY+PkY+LiXdcTkpVdI+Vl5WR
jI2KjI6Pk4+PlJWWl5ignZico5yal5WSlp6nr6qttrGzqqqloZuamI9/a2JlZWhrb3FuaWZmYmRm
amdnaWdreYJ9fHeBhYuOjpKEdGtkWUs6OVdtdHd7g5ajg4CDiYyMi4+SkZacnpyYl5iYlpSRj42N
jYWBgHdtZ15gYVNZa3+dqqaqsrK2ubi8wcO2sq2pqqqlno6FhIWKjY+OjpGPlZqXj5KWlpKPlpWY
mJqanqGTiomEfGtWR0VQZHyJhouKg4B5a2RlXltiZmtra21ranFcR0dJT0pER0pUNSkjIzEnFhYU
ExQYHiMsTV9oam5zeYCJiYuNjoyMkZR8dHB8f32Ci4mMjZSamJSXlZiYmJ6fnJial5WMgH2GiI2T
nqGXlpaRmJeUmJufnqCVf2lPRUc+PkBDSVBUVlVYV1hcXV9ZWFROVl9fV19kbnZta2tra2prbW9u
Z2VcU0xLSUVHW4iLkZSclZiYnZ6Yk5GUmp+joKGopaSgo56YmpqXk5GPd21rdH2FhomGgoGChHyG
jXFnYVtXWFledH14eHh9eHN0cGtoaWJianSJoZqanaChoJuWnKiupKWuqaOhoKSqrKqnpaqopqyx
p4x9e3x9eHZycHJpVEY6NTJBT1xkb3R3eHFoXmJ0fISJf31/fHp0gWpxdHl9fHx9enp8e4iGgYWI
i4yOmJSTk4+Nhn14dnFxZ2ZhZHZtZ2uMfGViZXJ0fZqegH+Kjo2Rko6RmJiamJSSkZSOlIqFem9Q
RlBijaqmp6qur7O8s7a3vLu3vLu6t7GsnpePjpyKfXNmVkVJSUtNUFBZbX+EhIJ7f4KIiIyPlJKW
mpiWj4mBe3l0aGBZVl1vVUtHR0dHRDs7NT4+Pj0+PkA9Ozk6NTU0NDE5PkVARkxYcKG7npacn56d
oaGfnailoaGXlouEhYmDio+pr7C2xLm1ub7At7q8ubOxqKq4t7W+w8myoaGclY+LjYWCg4GBgn19
eXNxdmVUUkEsIyEfKS81PkdSVVNNTUxFPjcrJik1OkJMZniBiIqPlp2lo6asrKemqbbRuKiqrKOh
qKquramqr7O2t7KnqLG1tbWwoZWMg399f319g3t9d2tta2pnX1RHQTo4MzA3NTcxMDUyMzEzNTEs
JicuKiMlLC81Oj5DQklYdIyXjoqPi4qPjY+UlZSdpqyvtbGpqqGVjW9XR0FFS0xTXmJlXFteYGJx
c2tveYWIg398fXd2cGtzeYKIj5aaoKGhn6OkqKSdnJiPioOBgouXpb/W4NzZ2t/b19rRyc3R1M7F
xNTFy9e6srOnnZaOdGdfYmBugo2Pm6Gkqq2zt7atrq+vrKqnoaGdnqetr7m8wcTL38S4ubm2sqqX
dIrr98WxutnXxby5rqyhqrqvqqysoZqXk46KkpaKla2zs7y8w8vOzc3Ty8zQycXFx6+Yem90fJ2n
pKiwrrWysrm8s7Kspaeur7Gvqa+giYR4e3p9fYB9dnd5enR7f4B/e3l0cnh0dnd5eXFwbWRdW1ZJ
TFie6f77mFtoeoOIhoaAgH17dHR0ZlVHLyosVFIzNTs7Oz1BQDg1ODs4ODtBRUdFQzxAQkxoiJ6h
qaqwrrWhmpifm5SOiXNiZWtnaXuDhIWCipehqbeqpqOhqKmypqPQ0rKtp4ZoZG96hIiFho2GdGVW
aImDhoyOlJiWlZWXkpaPj4uFgoaEgHlqZGJma0Y6Pjk+O2dhVlZnb25xd3yAfYJ8fYJ9fYWSnKCg
oKChoaGYlpialHZ8ipOaoaewrayzrqysqaqhrqGVimRHXnOEjZqUnp+qnnBVU1VbW1tdWVlZWVli
X19iYWJoaXuOjZaXl5iYmJSThmpdV15iboaToaignqywpp+YkpONhH99gH17eXt0ZWFcWVJWYU1L
T09ZZoFqYmtxdHt9ho2MipWhr62zyqmgoKOkpaamoaCenpuWmqWqr7GppqmqpaGnpKGenpqXjnJd
TViGkpqzt66pqqqusKWhoJSGcGFhZGZiXlhYV1BEKxoaGAgUOEFHSkxdYneOj5qbnqeopqSqr62t
qamqqqaloZeMiK+FanSBgYKLipKUj4+nub6+wMXCwr+7uru4traghX2EiY+YnZ6hm5yYlJOPjIiC
goiKe3BdXWRqcXeAgYyTmJWVlIuPko+Pj4+RmpaVlI6GjI+RlpudnZ+jpqqxrbC5s7OyoZ6clI2P
hYB8eYGWxceNZlRgg4N6e31/e3d0cGtlYmd0hZipqq6vr66tqq67n4aBgX13fYCBhIN9eXlybnJ2
c3F0b25vXlNHR1RpZmd0em9mZ2RhW1lXVFZbWXN9gIWIjpGYoaCdnpiXl5eVinxoSTszNTEsJSUg
ICMjIyUqKzQ8REJHSUM+PkBCTVBQVllibW1qZnByc3l8gX1/e3p9e3x7dm9va2ZgVFlfZGlzgISG
iYZ7dG9iV1hiZmZtbm5yb21tcmFZZm5vcXSKjn1/iIqMg4CEenh0dHR7gY6psrG2uri8s6+qqKGc
mp2emJibm5qoo6Ghm5iShoF9eoFvb2tpbXB3fHh0d3R0dHBweX2hmI+KiY+Tm6OqpqGhpKGprayw
pZ+gnJKOiHx4fYiVm5iUlJqdl5iSiomGfXZ7gIWPm6moppyVj42KhXt9e2pia3h/f4WOi4yGioyL
iYyGf4OWiHd0eHp4gKeNenl/iI6NjpeUj4+PjI+UjZOYlpicl5aSjIuIe3NdTmJ3jpeXnJSIk5GL
jpWRlZabmpeal5iYlpygnKGhnZian6iusrKys7eqpKSknZqWkop3bWdlaWlpanxrXWJiZ2hkZWZo
ZmdydHR5f4KFjIqMjYSBeGpgUj40VWVxeH+GiIaFgZaRg4uMkZWWmpuYlpeYmJaXlY+Ni5OYhnh0
cWpiUERBS3qVm6assLG1tbO1ubu4t7W2tbOxtbKjjoSGho2Oj5KTj4+Wk4uRlZqalpKYl5ualZec
nJeRjYN4ZFBMWG+InZaSlZOSj4uIgX1vXlRZYWFnZFxdZ2JEREREQ0NHTEswJyUjJhoUFhEUExYX
IjNPZWpucnR5g4mIjIyKhoaGfHB3enuAgoSJjo2SlZKTlJeUlpqYnqGgm46TkZGPgH2Di5KYqpaM
kZSWmJydoKCpqKGdkoFgR0NCR0dLTlNUWVdYVFlcWVlvaFRSVlVcYWJrdG9wcGttcG9xbXBqZWJd
Vk5MTk5ddoKGiZWYlJiYmJqamJydo6ehoKeloKGgn5qbkpaRjIZzbXR6hoyKi4mEfX2BgIakgGtf
WVRTV2V2d319fYt/fHlydm5nZm1xeY+ok5WYmJydlZ2mpKStr66wrKiqp5+gp6inpaGnqbihm4Z/
d3BxbWlpYltiWDszNDVCVml2dnR2dHlpZmZweIF9fXuCfYnCcXF3eHx/gX18eXl4fXuEjI2Nko+W
mJiPj5yRfXZ5dGtpbWJiaW9yd4V/fH2EkZueo6aYlpaUjYyMkpSPk5SWlI+Wk5OOg4J7ZUtFUGeE
mJ+prKyws7u3tbq2ubu+vLe5uLKlmJSOhH1/dHJfS0dKS05TXXKDjIODhYSGhIWGjY+RmpyYnJaS
jYN2bWhtX1JNUl1KRUZFRUVDQz44Mzk5NTk7PDw7NzUyMi4vNDg5Ozo9QEdZhKGVlpOVmp+fnp2Y
lZidnpWWj5OTiISJj6qusLi8urm/wrq6ucC2r62tsrPIyLm7vLmkm5aUj4qGiYmNhoSEhoWPi4R9
ZVJFNzA5RTEwNThAR0tSV1BVVE5JTUo3MjQ6RE1qe4aMjY+Pmpyeo6GlqaeqsLCpqqijn6CovLas
qK2xs7CspJ6Ymp2alJOVnIh9dnt9fX95dHZ0b25qa2ZeVUo+ODgyMTg0NTg7OTg1OTk1Mi8vKjc4
JSYpNDU+R1ZYXW1zf4uMj4+PlpOOj5WYl5ihqq6sqq2nnYpyXElCR0pHT01NXmJeWWBia2tpcHNy
fH19fH14c3RrbW94goiMk5qenJicr7uspJiYmJKJf2ZulaGlwNXe3t7d4t/Z1tvW1dLQ0dTQ6NDK
17uyrbClmIp2aWBZYHSUnJucnaetrLO5ubaxraqwsaqopKCgr7Wxs7O8vsLIu7fAwLmxqZ1/fcnR
srG8w8W/vLnC0KqOhIyIgn1yYE9WU09kfImhvru2vsTHysvMx8zNzdDOxcK+qpGOeHaDpKynqLCu
s7ezury2sZqVrbOzs7KvsKGamot3e3t9f3t/g39/fHt/e3x9g8WocGt0c3d2d25kYl5YU1BTWWKG
2cR2cX2BhYaChoODgn10bmlkVTkxMDRWWDU3SkJMXkc7Ojw5Nzk+Pj0+REVGQ0NER2GLoa6qrq+l
oKamnqChpJ+XknJpand6i318enuDjZ2lo6Gkp6ChoaGdoce7m5+XjYp0goaKjI2MhoF3bmFieoSE
hoaPlpaYl5ualI+NjY2KhIOCem1oZWtzRjxCUzgmQU9XZm1zcXN4eoB9fX96eYKIm6Cgn5yhpJ+d
n6GepY98gH2FjpObwrqopqmqqaioqqSboJ6TdFhvf4uMi4yLk457XlVVVFRUYlhZVFZWXV9ZW1lc
XFlif5OVmJqcmpicmJGNfVtWZmhofZWepKaqs7eyo5qYk46Jgnh3eHNybWliVk9HRktLTE1OVVxh
ZWdnbXB2goGMj5ORio+foaOqrqihoaevp6eppJ6clY2PnKWqp6Sop6ShoZ+anp2alp+GaWJPVHeW
lpqbmp6lqKejoaGelIhtZGZoZGVhYmJZT0osHBoYJkREQENJT2BheIaMlZ2fo6OmqqmnqayqrKOj
o6GYlpOJgHhzd3yDioaLioyOkZyywsK6wcO+v7y6urWwp5iEfYKFgoueqJ6en5qYko+NioSFiY+D
XVhhaG90eYKPt66jm5iYlJWTj4+Nko+RlZSUjIaIiY+VmJOXoaOjp6mys867qq6vpKGeloR0eoCF
homIhYJ9dHt7eXd5f316eHNrZVtXW2h4ipaeoKGnqaWno5R9cXNyb3R0d3d6en1/dHJva21qa2pq
ZGFQR0NHSkxSVllmYl1bW1lZVVhZVlZTYHiBg4aOlZabn6GgnpyalJKKfG9YQz08ODUwLiorJSIo
LCwvPU+fwXNZUEJBQ0RHTFZdYmhrdG5hZm10eHt9gHx8fHuAfXRtcW9mYVhSVltha3qEhYiCgHp0
ZlxZYmJmbW5raGhpa2t0XGJxdG9xeoB9gXt6gYR8f3x8dHJ0eHmGpdm4qK2zs7WwraSfnZuamJqV
lZiYmJyhoKOem5GNjIh9dF1YZW5zc3FxdHp3hIVvZ2twdoaCiJOXmJ6hqqywrLC3qqaorqadnpSJ
gH10d32MmpudmJWXnJudn6G+mn19d3d8hpaup6SmoJiSi4SEgn1rcoaAiYSBiIiKiYqPiYSFgH19
ofLSeWlxdHNydHeCfHR9jZKNl6OSjIaOj5OXmJeWm5uel5KWj4+Sc15ehY2Wl5qbmpWUjpGavKCR
l5yYm56eoKGbmKGeoaWhoJ2jqa+wsLOysbKsqqOenJWNi3xzaWRlZmJnYF5ZWF9kYmliZWdlZXma
fXZ5g4qNkpOPi4J6c2VURTdSanN6e4GChYaNmJGJiY2VlZWXmJaSlZiWlJSRj42JhIGAenNuYlhH
QENQgJijrK+xta6yt7i2ubi2trewsa6oppuPhoOIj5STj5aUko+XlpiVmJiYmJeXn5yamqGalZOS
intzYl9zgY2WoJ2anqCeo6CYjoB0X1ZUUFhQS0RBQ0FBR0dHQkRANyciIyMfGRwZFxcZFhUeMEtY
ZGt8eHmJiIqNiomFhIN3dH2AeoKIjI6MipGVk5aal5SYl5ehpJuYlpOPkoaDhoSGipOXlJKUlZub
mKqzrKytqaGglIFqTUZBQkxSUlhdWFteW1tbW21wVlJXWV5nb3NvbXNyc290dnRtcGlmZV5TTk5M
Ul9/hoKGkpiYnpKRl5WYmJ2foaelpaakpJ+coJ+alI6GfHhvcnqBipGKhoaEfX19f3dwaV9dYWhe
ZHJ8fXp9lIJ8fXhuamtpcHN4gImMlJOYmJeYnKOqrKqzra2so6WkoaWlpaepqKalo5ySgnRzbmlm
Yl1WXV1USTEoLDVDWWt4e3RziXdnZ2twcXR4eHFxcHNigYR6gYGCgnx8fXR0gYmPj4yPk5iRjpKR
i4mChH15cm9tZmpvc4+Gg4aPm6Ggn6WopaepwryMgoWLjo+PkZeTko2KjYiIfWpXT1VlhY+NmKau
s66vsLW4uLq4tby8uLe4qp+Vk4+FgoB5d29QQkROU2V6ipWVjImKiYSDiIuTlpedobOjlZKVjoBx
aGJeRkRHREVFTkVCRENAPTQwNTQ1NDM3NzU1MTEuLC81NTg7PkI+Q1Khy5GGjpKVlZaTkY+PkpSW
mJiYmKSYiIiJlKSyrrGytbq8u764vLm1sbCxu8fAuL7Jv7CplYuMj4+SjoaOjIqLhpGIg3t/XkA5
MEFQNzE0O0dMTldcVVRXWVVZXUpBREdOYHaEhoqKj5GToKGam5yfnJ6joaGfnJugpKXRy6mkrbOq
rqyekY6UlZaXj4+YgnN0eHd3dnNycHFta2tyaGJXSj43NCwzNDg+Pj08PT07NTUyOTgxNzIyLDA1
Q1VdYmVna216go+WlJaPk5eYmJyRoJ+oqqmknZiPdFxNRUA+Q01LS05dYlleYWJrcHJwdG95gYB9
eHZ2cmpoanR4fYaPj5OSl5+lxK6cmJqXkpN/ZGuNnKS109/f3+Dd2d7a19bX19TT0MzT2dLCubi2
rKOflG9hWVlid4+coJecpKistbmxsbOwr7GvqqOlqarDta+tt7zFy8S5ur+8t62qnI6KobG4vLy8
w8W+v8TIp5N8d3d3a2RZQUI9QFVrgp28v8PTysjFzs3HztbW1M3LwLuqloaBjJimpaess7eys7O8
wricfYqntbi4s7Ozp5ybj4KBeXt7fX17fHx9fXx9e4CX5veSW2JwdHNqYmJgWVRNTlNdZHiGeoGP
hoOCiIyFg4WBgXt3aWBZSi8mKCYsMjc5OkNHPT09Ojk5PDs+Pj5ERUVDQUNCXYaan6GkoZ2foKGn
ppyempqNd2hrc4GlhXt6fYito5igoKGgnJaXlZSPj5udqIuEiY2PlJeWmJWRjIZ8dHh9goOEjJaV
jZGTmJSPjIqKiYSChoN6dGtpXEtCQURARUdCTlxcYm5zdH18fX+Af318g5Welpufnp6hpKChp5+S
iIqGfX2NlJulqKquqaetrKepo5uYnJV7ZHaDiYiEhIN9gX9cUE1KSkpQWFxNUFJUUlNVV1lcXW6M
lJKSlJiYmJialI54bmZfaW6BkqGmqrW8v76tpKOdj4GBeniBhoJ3amBUS0c+PUVHRklcf2JYYGZo
c3l/hoqGhYuMhoqJmNChiZiopqenqaWkoZ2oi4iTlp2jn56goJ+em5uVlpiTgHJocoCToZyTjZSX
m5ihn6SfmpGTlXFlYmZrZ3BnXFhTRiojHxoeMz1CT1ZWa4J3io6TmJ2aoaWgpKmgp6ehoaesoZ2b
lpGNgXB0fX9/ho6XjYmNjpSuv8G8vry+u7a7s6ymmH90eXx6hpycm52fnJiXk5GMi4yOj4lmV2Jp
bnZ7hpWdoaebmpiUmJugnY6XkoyOj42JhIOGjI2OkZWcpqelqKqtsqyssrC2r56YlI2IlI+Tk4+P
hoB5c3R5f3l5e3t2cGtfWE5TXGpzfX2DkaSmpJiPeGtiXWZvdHh9fH2ChIJ8eHRra2lqaGJZX1A+
OT1GTFBVWVlXV1hWV1JSXXRZU1BXZXR9g4qSm5+XnbmqmJealIZ8cGBJR0dBQUA9O0E1KiosMDM+
Ysr5tVZKWFNJRlBYXmJlb3B0dG9ibXh5eHh4e3t6fH+CcWdlZmRdVVVZXWJxjIaCgnx8cmdgXGFk
YmFnZWlucW50jnFZYnN0c3d5eH2AfHx7hn12cXJ0dHh3fYWbr6+4ua+zsa2kn6Ggnpqcm5aVlpaY
nqqjwqSUj4yGf3hrT0F0em9rb3N0c3F5f29mZWlwdn+JkpWYoKOmqq2qqaqoqailpKWKgHt3d3N8
ipSlmJuhnaSfmJ6fmp6XjX12f3p9jZ2do6GfmJGLgYF8fHJ0m5GIjYuNiIiDg4OEend2dniW05J0
cHR4eHRua3F3b32XmIaDhoyLioygoJabm5iXl5iYko+RkXtnVFByiZWdnZqXlJOUl5OVnKGenJyd
m52cnZ6en5qjo6Gjt6Ghrq2ytrKzsaqqp6Odl5GIdGlnZGRiYlVQVFdbX2RhZGZoYWBhaG1vgX+C
jZaYk4+JiX92a15VSVhmc3eGj5Sln52UlZOPj5WTlpidn5SNjo+NlZKLioSDg4R5a2JcVEpKZX+T
pK6ysbK5srO3vr6+zsKysK+trqmmn46FgYySj4+UkY+TmJiWlpiWk5aWlZupnZicmpiWkYuDd3Jn
bX2Dj5WUnaeqqKmho5+Si390YklAPjo7PFJQT0VBPj47OSolIyMgIzEuLjQsLCAaGBUvVFhgZ3x8
e3qEiYmGg4OEfXJwdHuNjIaLkY2PlpWUk5WVl5KXmp6gmpiXlY+RiHt7gIOGhY6Ojo+vt5uYqraz
sbazqp2Xj4ZkSkVETFNWVFtYWFhXW1lVVFheXVZZYmlveHZ6dnh0d3t6fXhxcX13ZVVTU1JTW3SC
goGIm52cmJaYmJienaGqpaCho6Wgpaiem52YjIR/dG94gJKOiouJhoOFgnpwcWthWFNXWV9nc3x/
g3+GfXp6c29vcWFqfHd5fYaIiZWYlJufnKGprbGzuK6mqKilpqilo6mno6alnYx4dHJtbWlgX11Y
UE1ELiYnL0JVYmhubnRzc3dzc3J4d3Ntb3Jxc4GNioWIhoaXhn16d3R4hY2NjpOYl5uTj4uMj4qJ
f3t0dHRygIWMkZaan5+luranp6qxs7K1qqCPioODhomLjYiGhpKogoF4a2JeaHeDhoaXpq+wsbGt
rLO2tbm6ubm7vLWnpp2WlI6Ee3RzalJFSVBifZGVmJiUiImPj46NjpebmpiYnpqYj4yPjXRfTURE
Q0NER0RBRENEQEA9OzUwLjAuMjQ0MjEyKyoqMDI0ODg6PkBCaNHKbmuBkY+Pj4uPjoqPkpSXl5iY
qqGGg4iVo6equbXEw7Gzt7m5tbWxrLCzv8i8ub6+s5+Rj5OSj4+PkY2IioKBi4mAirN9Sjo0Ojc1
OjtAQUtWWV5hYGFhWVZUUFJZeHNpeX2EgIiPjJGal5eYlpiem5Wbl5ODhpebl6WhnJ6qqKmhoaGa
lJSWlI+MioZ6dnRycnFza3BxcXFzdGtkYlRHPjQuNDc8PkFCQz5AQT4+PDs4ODU6NTU0OUFVYmlq
ZWVka3SAio+YlJeYmpybm5udn6ispZ6dlYlqVUZCQENDR0lLTVVZWVthZW5za2trcHeCiXhxbnBu
bW5qc3qAiY+TlpqkoKGlnKGbmJuakXxxeoaXpb7X3d3d3d3f39nb29za19bSzsnLxLzAvLOqpZyL
cmBXT1Nwhpigr6Whpqi2tbKysrCnp6OnpKGhoaWprbW8wbzDwr/BwLq3s6qglpiptba+xMW+vLy7
uKqhmHlycXJoYlkzMTM8XG2AmrrI0tzHxM3T19DMztbOzcnCvK+smImXpaqqrayvsba3vLy8w6WL
mqiusLOzr66ssqOScnp8eHp9fHp4fX15dHx7fX2Vx51oXWJraGtmX1tbXFZSWWKSoX99hZWGfYSJ
i46NhoSChnpwYV1QPC4qJiMqNzs8QDw6NUE+OTs1PD0+REZCQD5BPj5fiZifnqOfoaajpaSloZ6g
mpOPjY2XenR5eYCGhYqWnJ6dmp6Ti4+OiIKIiY6NhpeUmKehmJGVlpqYmomFeXd5gYadn5WPi42S
ko+Mj42Ihn2BgHNuZV5US0dGRUE+PEpTVF1ianJ9gX9/eXiBg4SOmJOTlJ2jqayopKSmnpSPi4qC
hYmUnp6oqaahqKqpqqWhmJefk4J/qI+JgIB/e3p6cFA5LjE1Ojw8RUtMUFNYV1ZbaHB3o7KblJaU
m52YmJeLintdW3aCdnmSoaettsTIvrayqaOajX2AkZaSi4R9ZkZQQjE+Rz4+QUZQV2BmbnR3enyG
v7aJgIWNjIKJoXmBqLm1uqGnqaepoY+FjXaOnaChoZucmpaWlpeUnsqPjJKXoaGkn5+blZKVmJWY
m5iPhoGFg3tuaWppb2ZdWFNQOUArHB41Q0dPUFh4dJuUjZSbnZ2hpqGgoaaloaOlpqqzppuYmJaV
l312eX+DiJeRjY2NlJWouMPEvL+4u7GpoZ2Se3F5eHt/j5iYnJyYm52alpGPkZGSioF0bWdwc3mI
lpiYnJuTmJeXmp2YmJiUl5aKi42GfYCFiYuTlpieoaajqampvt+3qKyopaOempWTmJuSj4+Lkp59
bm5yc3J3dHNzaltQTE9QWF1la25ye42Tn49rXE1TYG5xf6CGgYOGfXx7e3dlX1xZWVBZYUU1NUJL
TU9VVltYWV1bV1dXV1NUUFJtb3SChI2VmJ2gsKacnJaLhIR3aGFoUEY+QD4+REY9MCwuMklkhoNw
YV5fXFlbW2Jlc3RyfX99eW5lb3p6en14eX99enhwaWRfYVxdXF1dZXKGhn19fXJoZ2FdXF1hZmhq
a2tua3SGdmtud3l7fH16d3x2dnqvt4FvaWt4dnd8jKOmrrGtsbWppKOhmJaVlZWXlZOUk5adoJ6c
mpyXjoZ9dmJLQUZZZXeAb3B5cW1ybmhmZmt3hpWWnKGhpqqxs62trqyprKqhkn95d3N4fImYp6Sf
oJ+cn6Cdnpudn5WRiHlrb4CMl5Wkqp6Tj42GhH15e32PjYyPi4iFhoOBgXZ5cXZ0dn2biX19enZ0
d3FwgHdubXp7cXN/hX2GjY+UpJaUmKGalJuclY+nj2pZXXODjJSUnp+Ujo6UmpuhoaGhnJqcnJqb
m56fnp6npKahmJ6kqKywsK+vrKejo5uWl4ZzZWVhZV5YST5FUltfZGRiYmZkXXKGa2t0gYWGpruV
jY+NiXlwampoaWhueZGdl5agm5aWlJSRj5GYmJWSjJOSk42OjomNmIR8dG1lX1RNTUxwqLykpayt
pqmyu7a3u767t7Ozra+vpqGYj4qIhpGSk5iSlZOXlpqXmJePk5KbnZ+bmJ6jpKWcj4R8fYmOhYaM
mJ6lpqOtr62srKCWjYV0YU1COTU6RlBlU0ZHQTInJSUlL0dFR0VAQUI9MSghHSVCU2F0a3F5eXyD
g4GAhYJzbmtxeI6PhoqOlY2Oko+TjoaMk5OVmJ+hoJ2UkZiSgXd8f4GGjYiIjpidl6e/ubezr7Ow
paGdj3tYTUdHT1JYWVlbW1dWXFlYU1ReYmlydHh6dnl2gX98fHqAfXZubWtmXVZVU1dZXmp6hYuR
k5KOlZSPkp2do6GpqqGkpqWzqZyYmJGLhn13c3J5hYiJhoaFgoCDe29pal5VUlNTW292e3x7hH2A
f3h0a2ltYltwdHd5gYSIjY2PjoWYoaOvtsDbs5+nqaeopaqkpaOnpp6UgnRzbmlnYl1bVlBSVEco
IykyQ1ZhZmZrdm9qbW5rb3F0dHJ3gIqRj5aNi42JiZOEhnxvaHKDiIyTlJiUk4+Oio6NiYmDg315
eYWUmJqanqGho6WztbKqp62ytqyopqCIgICCgYaMhoSEhIF6cW5wfICKlJaomp2vqqWlra+yvL65
vL+4urizraiqoY+PjYWCeXl0WUpOYniGkpibmJeTj4+SkZKWmJ+YnJ+emJeYmJiUdGBQRENERUdg
TEA9QkFEPjk1NC4rLCgyQUEvJycpJywsLjI1OD49OzpGVkdEZYSNjY6LiISGhoqOj5yhoaGgj4SL
jpOlqqi5vru2srO5trK2t7KysrbF6de5vMC8ppGPko+UlZeLho+MhoSLjoKBiX1iRz45Ojs4NTs8
SlNYX15eX2BgXFtbXWd9eXN7fX+GioKJjYaKipGWj4+LhIB/dG55j5WLjY+PmKGkpp+fsaOTlJOP
jJGGgn1ybWt0cGtubWtta21yamZhWE47Lik5PkNDQkNFRENDQkRAQD0+Ojo1NTdAUGVramZlam1r
a3qJj5WYmpKYm5qcoJ6hpqaflpGIgGtLPTo+Q0ZLS0dLUF9iZWJkbnBzbW1wc3+Bd3F2dGtxbm9x
fHyAiI+bmpqWl5ecmpqVk5iOhIF9ipikvNLT29va29/e3Nza29nW1dPTzcXExMO6r62moIVkUkZD
UHmMlqzgyp+erLGvrrCvqqepo6Chn6Cfoaavtre3v7/Cxb+8ureupZ+dn623u7zDw7yzubu2rqOO
d3FtaWViRC4sNDxOX4KYtcfS0svFzM7QztDV1NPLzcW8uqaVmKqwqqmvs7K2ube7vsTUv6igprGz
raqtsayvo5h4eHR3d3l0dnp4enx9e3h5eHJwamRkZGJoZWJcVVxZVVlkkrOBhoaBhoWGiYqIiouL
hoB/e3FlW1BCLiMjIiw1NzxBQD49PTg1ODs+PD1BPkNDPEQ+QF+ts5ianJ2bnZidoaOhoZ6em5GR
mqChj4aFin2OpaGXlpOemJF7cmtra3OGjIySxKOVn6Sbmpidp666j4aLhYGBhIuOjZGOjo6MkpGN
hoOCgIB5cGliWU9HQ0NDSU9XWVxZWVhlb3R7e3t9hYiBiJOXk5abnp+lqqSjpaqmmJaVi4iBhpGY
nqGfpaWhpKqhoZ+Ylo+FeH2JiIZ/f396dGtSOjgwMlhUVVlDQ0ZJTlSCeHR6gYWKmJeYmJWWlJiW
ko2Ie3x/YFxofJGYnaa4wcPAwLixrKmdjYiFhZKTiXtmNRkPDyI4GhQmPktUYGdncnR4ipaTkYyK
jIqRi4iAeH2WoKOkp6OjpKWdlIhbU2uAmKGemJiXl5eVl5SUjJeoqa+5srCupJiYmJeRjJaalYZ/
hYSFjHRua3BrZmFfWU40HhkaKTpGSU9UWV1gaX2Ljpefnpudnp2lo5+co6Opp6ejpKeooJ2YhHp9
gIqKiI2PlZORmpqjyMnBwLy1sqqemIRvcnR3dHOAjpqYmKChnZubl5SUm5WLf32Ad2tzhpaRj5eW
lpiYmJSYmJiYkpGPi4aMi4N7gIaGioyMlZicm52hp6y6wqmjoaapt7GwrZifnp6jnY+PiH1zbWlt
c3Jxb3NxXVNNRkdYXFhWXGBtdHR0b2leW2p0ho99gH2BgYJ4eHZ2a19WUkpOR0RTOywvQklJUFNT
T1BbXFliaVxfX1NQT1Zmc3qFj5Wbm5igoJiVk5OMhHx0b2JQR0RHQkdGQ0RHSzg7T1teXGJkZGRk
aWtna3R4f4WKhYaKiHFib4GjgXdzeJKadGRiXFhcXlxfZGdvdoWIhH16c2tlXVxcW2BmaWtzdG5x
cnR0dICDipKRhoCDen13dLLrxWtXaHBve32Up6aqr66ts66loaCblZSSko+Rj5GUlpibm5uYl5eN
goF0XUc7NT5VW2Vra2ttb25wbnF7k42Nk6CdnqGqsbu1rayurqmnraeUd3yKcnSJmKGopJubmpiX
n6Ggm5efm5eRhmhecoucmKCknJiNjomFf4aNho2Sk5KTkY+Og4J7aWZiZnF8f4B7fH17eHh4d3mE
a2ZiV1BMUF99oJa4mIuPlZqfm6W3oJiboaWbjn97gIGJipOYlZWPk5aYnZ2gqKGjnqOamJ+gpKGj
oZ+hoZueoJ6qsrGqsrGvqqOhnpief21rZGJcWVlNOz1HWVteYWJoYWJdZYVqZnKEjIqSkpiYj42G
fHR0dG5rb3N8iJyhnZuamJeXl52YlJaOj46Pk5GSkZGdnomEf313b2JWT05OU3Gdr6Chp6mqqbCz
tri7wL67tbCoqamkpZeKhoqNjJKWmJSWlZOYmJSUlY+RlZyhnJucrLCnpqOdl5GPj4uKiI2PmKGl
p66xrKeqrK+ej4JxXkpCPkA8PT49Q0M7MComJSkzPkJAQENFPjw1NTkqIztPWWRna3N6fYF9fH2D
fW1pcXR6f4WGjY6Nj5STj4yKiYyMlJucmpyXmJSTj42JfHmIgnuEiIaFhouTmK+7uru7s62tqqCT
j2hPTElNVFVWW1lYVFdcXF1XTGB6gYSDi4V/f32BiIN5eXt3dHRqZV5bVlJVW1tdYnGCo5SNj5KS
kY2SnqGenJ6op6ilqqqhmJyeqZSDgXR0dHd9fYKBg4SBgHdxb2ZfW05LUFZihHRzfHyAgIF9e3Jv
a2hUSkpZbnp5e4OIiIWEgJKYoaqzuMi4rqiurqmsqqShqaOhnI+AdHFqZ2JfVVRUVEo8MiYjKS5G
XWJkZ210cnNubnJvdHmAgYyVkY+Pm56ajo2Gf4B6cl1QXoOOjJOVj4+Pjo2OjoqOi4WBf4CFlaSq
s7Gdoaeqqqiur62zuLWzs6+qoJF9eHiDgH99eXd5dm1rc4GLlJyhp6agn6Glpqmvubq3t7a8ybqx
t7mzpqSfmpSLhoWAcGlUT2F0gI2SnJibm5WTj5eWmJial5OWmpqYmpOPkYt3aV5OREZFRkpDQkFD
Q0A+NTUwJyEhITVmXisdHyMlJykyMzU1OFVUODcwMDVEZ4yOhn+AgIGBg4qSmKGdnJaLhYaKlqSg
pq62u7y2urOzr7Gur7Gzv8vmzLzAv7+unJOWlZWUj4mNjIiKioyKi4Z6fHRZQj0+Nzs6PENKTVhg
XmFdYGBiZmRta3Jyd3x8g4mIiYaLhoaGiIZ4d3ZycG1laHSGgH+Gho+Ym56gmpidmJOSko6PjIuE
gIl0cG5qbW1tbmpqZmRiYFtQTTcmKjVAREVHTU1KRkdHREJBQ0I9Pj45PlJlb2trZmJnZmttdH2M
kpeglpicnaGdoKGgoJiLiYJ9c0s5OUBDSlBJTUxOYnBnaGpxcHBzc3Rxd3RvcnZ6dHRxa21ydHuD
ipWYj5OXlJaVlZKNjp2Vi4WGlZ22ytPW197f29zf3Nre3NfS0tHR0MfFwLiurKCYhmRMQEBMe5OY
qtfBnqSwrq2vqKqqpaOgmpqjnZiep7XHv7i6wcLAwbu/yq6koZ+lyLe8wLy+u7y3s7Glk4Jxbmhi
XlkzKjA7PkdZgKG2x8nJyszLzdHW1NXOzM7Fw7+6oaa4raemqbC2uba3urzAwsC/vLOqra+yrKSn
qqqmj3Z0c3R4eXZ0c3Z5eHh6fX14dm9iXmR8YFRdVlBQYWVfZWV2dHN9o4WCkY+Oj4ySk4yGgn95
dG9fUEMxIiElQktGPkJEQz46OT5BPj04PD1ARD5AQUBYhpWdmKCjn52coKSko5+hnp+amJaYnJ2X
kZWek5ucmJiYmJaPb2diYl9rl4WJjIudlZifn6CYk5uco56ntZKBgIWFi5GNiomOjZGSk46MhoWG
hnRrZlxSTEdBQUBKW1tfXlxeV1lmc3h4ent7fYaIk5SYnaGmo6GhqqemqaebmJSYsJGGi5igpKGh
oaChoZyfoZeUjn1xd4KGjYaDfHRuYTovMD5VYmZtZVtPR1NQfIxwcXyGjomPkZeYlZWUj5OXlI9z
YlhWYWt4j5+hqbPDzMrHwbu2qqqdinp9jYuBdFwrDwsNFBQUGCNBTVRZYmlxe3uDhoOFiYyOi4mI
hIF7j5WYnaGkqKOXlZSNgGB0dnR6hqCfmJqXlZuWjYGVqK6zub66uLWspJ6WnJWKiY+JiIiJhYaE
dHR2a2dhYFxdUj4gGBkvRUtNTVVYXGFhcYaOl6GclJSWk5SUlpqanKGmqaSmqKagoZJ/gYqMiIya
k5GSlpidn6OpqbO/v7GnnJSJnn1qaGtrbXSVnaCeoJubn52bnaCUjYaDhYaDc3SGjo+TlY2RlJSP
j5KUmpiWlo+IfXx5e4ODhIiJi4+OkpidoaSppaitqq6knqqprKehmJ2oqaGmp76dfHFfXGVla2tm
Zl1ZVFNJPT0+RUdPT1ldb3Rwa29yeHqAiYGBhIOEf4aAe3ZzZFRKRkdBNTEvLCw4RUpMUFBQWGtx
ZYO/inSCb2hTTlhlcH2Ij5OYnp6ho56Wm42BfH1yaldMR0ZHSUZLTU9WUEtQVltfYWVgZoaPeXl6
gIKAhYaMkYqEb2RlbXJubm9ykcd9UFNPU1lZYGd9goWFg4WFgoFxa2dfWVlZYWJnamtvcHd3eHuC
i4+WlY6Pi4mMj312cX2feGZrcXN4fY6psq2tsK6vqaWjnZaUkZOOjY2NlJidl5yalZ2alY+Dd2tg
UDwwLD1SaG1uamlra25vc4mmo5+fpKemrq+xr7WzsbCurqqqqtKPZGlvfJSnv62dnZqgn5ygm5yb
npubl5WOemFmfKq4l5OWlZOLhoaDhoiMk5WVk5KUk8Ccd21eUFJlcnd6fH18eHp5dnl3cGtmYlhP
SUlLTHHRt4GFj5edoJydpaempaGhnZ6TioiBg4+DiJian5OPj5aclpumoJ+foZyanJqbmpyfoaCh
pJ6boaqnoaOqsa2pqKGflYh7cGhiXllXXk07QE1WW2FiYWdmV1BMVGFncYGPjo6Sj4uSiYOAgX93
bWprb3uRm52UlpabmJSdm5aUlI2JjI2PjI+PqKeKgoaEfHh/gFZHSU9kg5KWm6aorKqlsLOzsrrA
vLewrq2tqqqvjIaGjJKUl5ecnaGhoKWej5GarJ6WmKGYnLO8s62vrKqopZ2YlI+Nj5Oco6mqqqqm
qa6xrq2cj4ZvYE1APDg8PT0+PDcsJSYsMjM7QkVDQkVGRD49RTEnPkVVXGJqcHR4fYCEfX96Z2lo
cXeAhoiNj46Oj4+Tj4WGj5GYnqCcnJiYmJWXj4V4cXN0e32Bj4aGhoaMo7O+zb+vqrOuo5uRcV1V
V1dWWVlXWVlZV1VXZVxdcoCSj4mNj4iDeo2+jXZ0d3h0dGpnZl9YVlhVVV9hYnaahHqOuqCFjp6b
m5ieoaOloaGgp5+dl5O6nnx7dHR3eICGfHp/e318cGtoZFlXT0pLUFxub3N5fX16d3Zxa2deV0c+
Q09tgnRueHyAe2tmcYqhqq2ytbOtqqywr6qhn6elqsSbd2poa2dfW1VVUE1KQjgpKCcrNUtVX15h
aG9yb2tvc3Z2d4COkpOUl5eYlpqPiYuNgXlxUkdSeIaKkZSSkZGNjIqLioiJgICFhpObp7jDu6ym
qayxsbOysq2ws7OupqSglH14dG90dHJxb21raW2Ll52loKShpKOkoaGor7nHu7jE0Lu1trGxs62o
oaGcv6eYioqEc1xXaXuGjZaYn56YlZSTk5GUlJaXlpeWl5aTjpSPgnBra1xKQURAPj48Oz4+QDk1
LiwgHBwgLFA7IiAfISUmIywzNzU3Qz09RzUsMUFdfIaFf3x8e3Z5g4yboZ6akouIhoaJkqOnqKqy
urzQuKqqqqqqrrO8wsPDwsrJwLOem5+em5ORj5GUk5GMjY+Wi3t0b2JQRkI+PTg7RUdMVmJgZWVm
ZWZra3R5fHt/goWJjI6Ki4aGiIKDe21nYWhnWVBVbXx3e4CGjpKWn6Gam5iUj4+PjIuIiYqDgHNw
Z2lla4xwZWRlYWBiW1BEKiYvQE9QTk9PT1JPT01FR0VGREA9PTxMXGVpZ2RoZmlnaWpufYaPm6Gj
oJ6ho6Ojn5uWko6Gf31xUkBCRUdNUlBPTlBYXmdudnl/fXNvdHh3dHh4enRzeXl0b29yeXuDjIyM
j4+VmJGNj4qMn5iPhIaVn6m3w9DV2t/c2t7b2d3Z2t3d1M3MxcO+uq+no5qDYUxHRlJ9kpylqqqp
qqmurqehpKSknp6cnp6XlZidssW4tbq8xcDCv9Dit6Wdnqezs7m7vLKzt7G2tqiMdGpnZmFZRSss
NUNqf4CGk6i8wsjKy9HTztHR0czKyMK8urywqriwqq6ys7O5u7y8vL/Fx8XAu7atp6aqrK+ppqOY
bWtzcXR2dHF0cXZ5dHd9eXNqaWVVU1RQUE9QV2BiWVlhZWhvcXZ6g4SOnI6Gi42OiYaDf393a2JU
RDAdHTE+REVFRUZdSkZGS0c+Pjk5Oj09PDw7Smt7dn2KmJqfo5+anpyfnpygn6bCn46SlJeUk5ST
lY+NkZORj3trZmBfYmFzhpKLjIaMoaGhoZiYl5eXmJidnJGXlIWGkpGKhYmNiImGhoWEf4N8dGlZ
UlBFQ0NFSlhdYmtkYF9bXmJpcXd5fIF9gomTnZuboKOlp6appKSjoJ+blY+KhYaOmJuboKWyt6Sd
nJuYlIx9fHR5gaOPhHp3cGA+MjFDd25ram5vamFWWUxgcoCGhoqOjYqPkZKgo5iXl5eRiYZ4YF9i
b4CXoaixuL/CwsXDwLqyrqWXfG1xdG5TLA8ICg0NERMZIj1JVF5lbXN4en2AgIOIho2IhoZ9dIOY
lpicoJuYnZeOjJKGfHR0dHR4jYyMkYqIiYWBpLWwrbO3u7y8uLKspqOalJONjoyLiYqKhouMiXtx
a2tkYV5QPCkcHTplVE5QVlxdX2Vrfaeel4+Oj42Kj46OlJiXnJ+kp6iuqqWfmIqGhouNjo+Pk5iY
o5+goaass8O/t62qmJapj3prZ2tzd466vJ6YmJebnaOdlJWTiIKAgISBgIOGjpWVk46Rko+UkpOS
k5KTjIV5ZlxmdH2GhYODiI6XlJWbnqSmpKijqqakpqWgn5ihoaGqrK6zrZ+JclxWbWJeXmFnZGJb
VU1GMjA3PEVQX2JpcnNzfHt/iYaJhISFjIqKgX19dnBlWE1FQj47MywsKzBDR01KTFBkjI97fXd0
d3htZVlZVldmdn2KjZabmJiam5yTj4mEgn10W01HSkdGSk9NU1BWVFRTXmRgYmJhdoKCgIWGiI6J
i4mMiIV/a2RvbW1taGVmYmtTRklQXGl4gYOFlqWMhoZ8c25qZ19XVVliaWRlaXB2f4WFjJGYnZqW
k5OTko+NjoJ4bmdnZWlzd3yGmqenqbnJp56hoKGakpiYj42Li5GWkZSWl5eVlJiYjYV6b1hCMCYp
MkRVXmdnZ2ZwdIGPo6OhoaeprK2utrCxsbKytrKsp6qll3hucnaEmKOho56XnJ2XmpaanJyfnJiY
mJKKe2Jvi4+WlI2PkY2GhYCGi5elmJOUlpiUqaGLnGhMUmJ0fYCGioGAgX2fmH10bmdlYVlyimFH
UG+Pjo+eoZ2gpKmhs9uvl5qjoZybj4iNrJKAhpOPjJKXmpiYnaGfnaChpqCfn5qanaOcn5ygoaCe
nZeYn6Cjp6WhoZuulHRuZWBdXFlcR0ZQXF9iZ2ZmZFtORkNfZGZtcXmGlJSWjI+NhoCBen99d3R3
jKWjnp+XlJibnZWWlpaTj46DhoqNkZiWlI+KiIOBhs3KdENAUG5/jZaYoaanpKitra21uLO8u7ey
rqeln5OVnoqLkqmyrrims7qwtbijnJuPjpSUl56hrbOysbOzr6mmpqGcmpuWkpqjpaWtsq6vsrKq
qq6ej4R6Yk9GPj09PD06NScoJzA3PkJCQkVHRktHRT41My5GR1ZWYmuKhnJye3x6a2RgYWt0eICG
j5GTlo+Rk5ORjYqMlZWcn5iempiWkZOPfWdlZ25wb3J9epOWgn2cs7e2sri4rqqloZd6Z2BiYmBf
WVleVFVZV1BUYnp9iZaVm5aTk4l9g4uEfHR2dHJtam+PdFtXV1xYWVtZZYh/e4+8oYKLr5uWnZye
n6Opo52dnZiYloqChHp2dnRydHh5eHh2dHZwbmJZVlBQTlBXW2hydHR9f4F2a21mW1BKQDxBR1Ju
am5udnppYmFldIyhqbK2srCur7OurqypqaGjvI9pZGhmYl1ZW1NQT0xQSjwyKi46TVZhYmVocnl0
c3FxdoCJjpqgoJyYm5+gn52XlIqBfW9NRVBwf4OPkpSOjI+OjI2JioaFgYSKmKizu7y3urOssbKx
s7e/tbO4tbGsp5yYiXdtcHN2c2dmZWdkgJ+foKGjpaOnqKqqp6qyusDAwMXLurO4srGyr6aboZ+l
rrqvoJ+fi5iFfYaTnKGhm5ecl5WWkpOTmJ6YlZqYlY+RjoZ4aGdxeVZGQkA+QDxBPj48NTMuJh4a
GR4dIh4dICEhIyIjIycvMC8oLDIwLy86UGZxeXh0eXt5d3+Ij5uYlZKOhnx6f4SNoaSlpqqur7Os
qbGhpqWvs7e+yMHEysm/uqmdmJublI+TkZWSj4yNj4uCfXdwaFRNTVBUQDw+QklZX2Bma2lqZmtv
dHh9eX+LjJKPjYucmIR9f5aOa2FYYm9JPjxZcG99hoWNj5OYmpiYm5qTlJaPhIKDgH12cWtrYGRo
f2liZmRgYV1cTS4mPEROa1hSU1dWVFBNUE9MTktLSkNER1toZGhuam5taGtrbW50gI+VnZ2fn6al
o6CbnZiNjIWEf3RbS0lQUFJTVlZYUlNUZHSOfYmNeHN3dH19e399e3h3dHNybW10dHuDhoqNj4+O
kY+OjZSzmIyGhIyTnqWxws3X29rc29fX2drZ19nSzMzIwbyyr6mcmIlnUkdJV4GYpKqqpqezrKGj
o5qYlLKqk4yOj5SMjpSovLq4uL6+wry5vLuyqqigoaazur+5sq2trrKzpINtZGFgWWBZMTFDYoOG
hIOPn7nExcjQzsvLztPUzczJw8G4u7ahqKqqsLWytr65vLy6xcXLzMfDv7qqoa6uramhm5tpa3Bw
bm9yb29wcXZ4fHlzb2diXVNVVlhUVVVbW1lcXFxmaGtyfXqGjYuKg4WOiIiEg399c2thWU88JSA8
R0dEREZFR01KSURHRkRFPjk3Ozw8PUpucXBtb3SJlpubmJScnZecnZ6gpp2Xm5acs6WWkY2OjoiL
jY6Aa2lnZGZkXXOGg3+BfYGPqaOYl56bnZuYnpygm5SRk4+Rj4iEhYWJiomJiISAkY93fGFNS0Q+
QkVOXGJrcGFfYVxbX2Zrbnh7f4CBiJKcoaWpo6apqqakoaChmJaWlZGDgIidl5iXlZibnpuVkYqI
f3R0cnB3fHB8dmh5RywrOVJgaWhxcXJua2JQWWV0gIiKiImOjZ2alJSTlpiYl5WXj4qEZV92iZen
qKaxu7/ExcrHwbmyrJt8ZmFXUjwjDwoNDxETFhgxR0tZYGhxenl5gH16gIKCgX2Ig3uIqJyTmKCe
nZ6aoZuUk5KUoYt0cnt9goOJhoGGhoKfs7i2u7i1t7O6u7espaGdqZGFiI+Ki4aEipOUlJF5aGFq
eVlAKhocOEdQVF1ZXWRlaGZmcYuPjIuMiISFhoaOkZaenZ2jqKqspaGVhoaKj46Kj5acmpueoaOp
qrGyt66tqZ6RkpOPioKEdHKIlZ+lp6OcrLCXjo+Tk4aCf3x/iIR6fYSIjo6MjY+TjYySlY+Pj4iF
fVxTV2Bodnl5iYuOjI2OkZGXl5uloaCcnaSon5icn5+jpqqtrLCsqI95YlNVWV5dX2JdXFdWVD4y
NTtFUGVxcnJyfX16f4CGhouMjo6KhoqIf3l4cGtiVElEQUBCOCwpKyw7RkdLTFBzhoZ2cHFxb2tl
ZF5WVWRreYiRlZeWlZaWl5WPj46DgoZgTUxLSkpNT01TV1lWVFdXWWp7YmJzi4l/fYOGiYyPkY2L
hoRxanx0Zl5fVEc+QEFASVdrgY+Pj5SUj46OhHx6enJoX1lZW1xiZWlxdHd4hpSWm52enZqcl5aT
lI+UiXlvaGFkb3R2hJqkpaGkpK2loaSempeXpZF9g4qNj5OWlZGUmpiXlpWNhHhpTz0wJiUqN1hi
a3ZwcHF9i5alo6GlqKqsrbCws7m4sa2ytbCup6WMa2h9f42bqbeon6Ggn5yenpuhm5yYoKGem5eF
dGqBsMGRg4WSmIuFjoyPj5SYmJOVj4+MioZ9aFtfbX+Ji4qFiIJ8dHZ3fXRta2ttfc78rEQ8WXSX
oJ6fn6Ojpqiz1bOjoZ+kp5uTlpeLiIOAhIuOkpicm5ucnp+goKOlnqChnKCen56gnaGmoJqWjpKU
l6GelpiWjo6Cd29rZmJgYm1YU2FufH14amtiXldFN2FnYWRpcXZ9go2LjY+Mgn2Jj3l2fYOUnp6c
m5ibmpqXmJqfm5eSjIOIiZGVnJ2gnpKKiIKX08uaTkVdfIiKjZOepaOnra+ysbW7uba4tq+qqaGV
ipWTj5Wjxbmop7Czs62ys7e+w6eWjY+PlKOwtbW1tbKur66tqaejoKWhnaGoqq68vrGvsK+sqrGf
kYZ8Z1NKQDo4ODUqKCowNT1CREJGREVHRUlHQzs0KSg+VFthZ3BzbnFrbmtiW1dgZ3J6f4KJg4aW
kouNjpKalo+Plp2dnp6fmpaWjYFwYWRiaWlrcHF0fHx0fZSpr7O1s7Gwqqesn4t8b2luZmJiZ2Zh
VFJTVWF2jJOSk5ORmJWTjIF/gH14entxZ2hkXW1gVlVZVldQUFlZWWJ3hImFf4aJjZSXlJuhoJ2Y
lpaYmo+Oi4N/fXyDdm5zeHp3dndza2diYVNQTUlOUlllZGlwb25xbmdkYVlSRz07PD5DTFBXVFtg
XVlYV1xmgp2qsri4sLGzra+trq+qno+Gc2Frb2VkYV1YVFZQVlJOS0Q4NWaEXVtha3Nyc3R2dHd/
f4KRn6Choaahn6GjnI6LioaDclBHVn1/gYOMkZuOhoWGjIiDhn+FhY+jt7+7uLy6vL7Bv7O1urit
qq62ta2ln5uKfGpnamtxbVdYX3SJnqqsraqvt7KtqbGtrri7urzAwL68vLy6s6+vs6mqqqeysq2u
qaWqsqOLjJKYmKGemJWWk5WTko+Pj5uXlpeVl46JfHBmYmllVkdBPUA8OTc7Ozc3NCwhGhoaGhgZ
Gh4eICMjHyAiICIjGhoiKSoqRFtmiX97eoCBgoZ9hImNlJaYiYF9f3x9iZGVl5ihpKWqqKiqo42P
n6yusLjDwcLAvLy4pJ6foJ2YnZaYmJSTj5KUi4WEe3RtV0xGXGI9Oz5CRVJeYGpua2tucXR8fYuG
hIyJmJyMiqGdhIJ9iYhrUktMPi8sNEdkdoCAhI+Ul5icnqCcmpaKhIiGgoB9eHl2a2RfW1ldYF5Z
VllcWVc8JStHS1JgXl1ZWFtZV1lYVE9OSkxLREdSYWlobWtqZmhtaWdua3Z8ipKcmpieo5+hoJyb
koyKioGEhH95YVhTVFZbYGJVU1VfbXtzgnh2dHt5dHd2d319fXp5d3JubXF0dnyIhYWGjYuMjY+X
tq2MhoOEj5OWnKWtw9XX19nd3Nva19bX087JzMXBv7isqKOYjXpdTU5fhp2jqaqxsLKtqKGRg4KA
nJSFhYaPjIuOkZysuLm2t76+v7mzsK+zrqWhoaaxsa62s7Cvua+NgHdpYmZfYVU8R2p9f4aYsZeb
s7zAyczOzcnJzMnMyMTDvLe4sKOwsLWzs7a7urm/vsHEy8vNzMW+sqWlv6mho5+fl2ZhaGdrcG1x
c3R3d3Fxc3BrZ2RpX1tXWVhWV1ZXV1lZXGVqcHZ4gIZ/e3+BgYqIg4J8enh5cmthTC8cM0NJalRK
RkpLSklGR0dHR0ZFPj08MzVKaHBramttbnN/jZqdlpiXmJidoJ6dn5qbnbanlZKSlYuDhIZ/b290
gIJ6eXt9f4CDfX2AfX+Ll5yYkpWbnKSkqKymoZiTiIuNhYWFhouFhomGhoiRfXR9UzUwPD5NVmVp
ZWFiZWttYFtZYWduc3Z7fYSemJOdnKCjpKWqp6Sen5iTj5KRiX+GlZqTmJiXmJqUlJiOiYV9c2pr
dnhxaWZfQTUxLCw8VGZrcHJxdHp4cGZ6dnuDhoWGipGVpqSRkpial5WSk5aRk416a3mPm6WsrrK5
u8HIzMfDwbitoYl5WTxLVUEvFBAODxwaHDpESlRiaW1zdnp4fIB7goSCgYiAeJ+un5iYmp2fnpid
nZqWjo2Pg3x7dn+DhoCBhoOIjqi1uLe2vLO1t7q7urClpaWci4aMjYyNiYuMlJWRi4l9dGJWUEpA
OkdXX19dYGJkYmdmaGRoa3B/g5OPenh/hoSIjpednaGkpqWtp5WIjI+Sl5aUlpyYnaGloaaqra2v
sa6ssqGWpp+TjIqFho+XmqCmrp6blJ2WjYSBgHx8fXl8lnt3goaPjo2LiY6Lj5GTjYaIhYB7X1RV
X11nZmtvdHSBkZSTk5aXmJ6uqpiVmqGdm52fo6WqqK6wrq6qlntfUFBbeGhhX15cWVdURD1ESllr
fYaAeX15eHx7gYSIhoaLi4iJhoKCenR0b2RiUExHS0c+NTEnIycxQURDT3F7dHJxb3FvcmtrZl5Z
YG52gYiJjI+Sj5KTl5eOiIaIfWZWT0tPR0tQVV1eXFRTUldWVVlYXGeKmICBgX+Gj4yJjoaCfW5n
ZmRgV1JEOTUzNDlQYnKMmJiVl5aPjImDgHltamdkXltfYWFiZ2txcHiBj5yppbatoZ+alZaXmJWR
g390Z2hvd4GTnaGmoaCbqayhmpKPlJKCYmeAjZaTkpKUlpeVmJiTkpKJemtJNCUjJyo0S1ducHF8
lpWUmqGopKWusLCwsLGztrzCtrCvraqhnoxrX2hxkqGfpKaooZ2foaGeo5+cn6CfnZ2cmJGGbWaG
tZGGhoGGsZJ4g4+YmJKSkpeWjoiGf3lucXF7ho2Pl5GEeXt4d3aPgXJ0doCInMq+Vj5Te5yjpKak
oaGmqqalpqalpaqjoaGYlZSRhHl3fYqTk5KXnpiVm5uhqJ+enpyamp6hm5qbm56alI2PkpaanJyf
l4+KgoN8bmtua2ViZGJhcHeEho+MhG9qaVs+TWFcYWRna252m46IhoKDhIWLfXh9iZyfnp6foZaX
lpeTko6PlZWKhoyWk6GxqKShnqGXhn13XEpKVWh6hImRlZqkoaGhqrCxsbO1t7GwsKmnoJOBj4+O
oKywsKqusLC3t7Kzt7Wxp66hj4uPoaWqrq+1sre4tbO1s6qpqaaYmqGkqrO3s7Cxsq6qrqabkop5
a11MQ0BDTTMmKC84Ojw9PkJHSUxMTktHPjgwNUZSWV1lamtrYmJdWVZSWWFmaXx9e4GDgYWOj5uT
i4yTlZSSlJaWm5uakomBdGFXWWdlZGhpbWhgX2R90ryqqa+ysbOurq2hloiAc2hmZ2poZmVkZVlV
aoGOkZKUmJeXkpWNioJ9enN3d2tkYFlZV1RWV1VPVFVTU1BUXHF4kY+BhoWIk5SWmq6gmJeYmJGS
ko6KhIaBgXp0c3Z0bnFtcGlhVkxJR0dFSU9UW2FiZmtuamVgXVxWTkA5NDU7Q0dTW1dTUFNTUk5P
WHCGnKautrCqrrOtsLOyqqahjn1cWIWnc1tcX2BcWVdXU1BSUEtHYnReXGJocW5ydHR0eI+IiqCh
mqGgoZ+jo5iUi4mKiIx6VUpWbXt/goaJmI+LiYiMioqGhoyVobW+ur68wcDBwrzCxcO5ubawtrOv
rKegmIt0WFRZT2dxTUpVeZafqrOxsrOwsa6vsqystry/vsLDxbq7vLqzqqqqp6mtqqy3sa+wraqs
s62ll5iYnJ+Yko6MkpWTj46VmJaRlJWShn10aWVgXmpeR0ZFOzs6NTU1MjE4KhwXFhkaGhwaGhof
IR8eICAjIB0VCwwTGixhb4CcgXp9g3+AhISDhIWEj4yBfHZ2e3l7hImMj5SYnKGprMSngoaYqbO+
wMHAwcO/vLWnnKOmqp6Ym5SWlJaXmI+KhZWVd2dQRkNWTUNFPT5DTVhnbXBwcXJyeYmGiYuMio2N
kY+TlJGKhoB7c2VMOCoiICYyPllue32Cho6Wmp+gmpaVjoWEhoJ8e3pzdHRtYlxYU1ZXU1ZZV1VW
SUI6LkBZXFBYX2JhYF9dXl1XVFBPT0pHUl9nbWtrb3FrbW9ucG5ucn2Mj5SVlZihpaefmpiXlY6J
goGLn5JgVVthYWJkX15YVGJkZnB0dnNzenRzc3Nzd3Z3fXx4dnRta2ttd4+JgoGGio2KkpGloYyE
hoaPl5eXnqW40dra19/a2tvg3NXX08vBw8SztrmonpqTiGVUWHCdraqusKyutaqlm39zdnh8fX2A
hpOJgoaKl5qmqq2ytra4tbKzs6+urKSlpamfpqqqocT7431ZaGtvZmViWVtodHuEiJGdlJqywMDF
0dnOzMrJysvEvL+4tbGfoKm/uLW1urzAu7/Dx8rS0sjMxb66p5uupKGko52bXGFhZGdraG1xbnZw
b3ZvaWtraGFWVFtZVlJTVFVXVlhiaHBwd3aAnYR9fXl/fH2BfX13d25pZl1MOz44QkZHS0pOTkxH
TVJSU1BNTUtHPjo0Vm9yam5vcXJyb3J4j5Wbm5aYmJWYl52joaChoZqSj5SPioWGhXhxeYaTj4qL
ipGUi395fX9/f3yYrryzp6WjoaShoaGhnZiSiYWFhoiEgoKBhIiKiYh6bVU3Ly4vNUFdYl5gZWlm
ZGZiXVxfZGlzc3SCiIaLlJicnqCfn6GeoZ6bm4+Lho+hkaCjlY+SlJWVmJaRko+Ge3p2aW1oamhh
SjwyNCwoJ0deaG1wc3h5eIB0b3x4fYKJhYmMj5KUkpKSlZeclZKPkZKRkYR9f4yapKmvs7zFxMPF
wsfFvLanmIZ0WFhfSxwMDQ8PEBopO0VMU15ibW9wc3R0eXp7fHh5dH+qp5uVlJudpZ+emp2bm5aW
kpKWt6R8eoCEhIiAg4ihsLC1tbO1s7OzsrO2s62npKCYjoaJioaLlJaWlo+PkY+UgllQSkVHTVhh
YGBdYFteX2JmZWJhXllQPDhqdnF0eYOMmJycpKenpa2gjIyMkpOVmJedmKGho6ikoaepqa6srKep
nZaYlpqTkpGTk5STmKrFo42Oj5KLhnx6fXx8fXl9d3F3f4OGkZGOkZGUk4+PjoaJhH9nUFZcW1ti
ZWBiaWtudniGj46Pj5aXmqGcnZuam6aqrKqtsq6wrqqUfWFQVlZfYWBiZGJhgY9eWWlteH2Di4+K
gHt6e3l6goWGiYiOj4uDf4F/fXhqaGRcR0NHTEc9OTIpIyY7RkNJXm9zcnR0cHFybWttZmRha3qG
hoaEjI+Tj4qOl6qVhouCdGhiX1VQU1VTWV1bWVNSVVhcVVlbYXB3gH99hYaIjYiDgYN9bmVlZWJX
UDswMDQxPlZthpShoZ2Yk5KUjIl/dG9qZ2FbZ2ZkYmVpa2tyhY2OlqGhw9bOn4+YnJuVjYyNg42K
dG94jJ2foZ+bmJWwzJ6JiXRcUk5LXX2VlI+LkZWUlZOUlJSTjoSAYj4rIiYsMz5FTFl0hoWKmp+c
oaenrbOwsLOzs7W3t7iwqaqqqKihkWZWWHiloaCfoaemoJ2eoZ+joKGdnpyfnZ2sqot5Z26JhH99
f3qBjYyIlJ+Wj5OVjYuPjIWCeXR4fIGGjI+Tk4l/fXh3eX19fX+Ag4WFhWhHR1yInaGfoKSmqKiq
qbDEvqimpqiupqCalZOOZmR9i4yRkZqgmJiam5qboZ+enZuYmJicm5SSlpaSkY6KkpiUjY+Rj4h9
e3RzcW5pZWZqcXl9homOjoiJf3N3aVk7QVBZXl55b2dogIOAf4CAhH9/f4GMm52bm5eWl5eal4+R
lY+SjIiFgI2erLGkoaqppqOYim5ZSkthcIWIi46UlpihpKanpa+3ubW4s6+tqaGbk4GAhJKsrqen
ra+yubaztrKzs7Gyqp2IjZSfqrOzrrGzuLO1trayt7OqqKCevLKtsrCyrq6zsKqonpeYl4Z4a2FP
RUJCODMzMjtAR0VAQkdLR01WYmdENzhFTE9UYGlzfGhSSktQUFBTXmdyeHt/goGPmoqIhpGSkZGT
ko6Nj5iYj4+PjYBqUkVHTlhhZWdmZFlJUmmhqqiss7i1t6yppaCSin95cm9wb25vcGpqYF53jpOU
lJycmqGflY6Gg3h3dnCBbV1VVlRQVFRQVVBWU0xKT1BXbXmChIKDhomGlK6cnJiYmpeUkY6Vj4iB
gX2DhntzdHFvamdrYEQ4Oj48PkNHUlJZW1tkZ2JhXFZWVVBGOjQ1OD1GS19gU0dOTk5OTUdbgpyf
paaqrKmqrbW1rrKspqCGaVJfkbx4XV9kZ2BfYV9dWVdTVldVU1NdZmttb2t9fXR5gIOboKSqqaSm
paGblI+Oi4uFf3BiW2Z0f4Z9goiJiYiAiIyMhouSnamxtrq/vL/Bw8TCwMTJydHOs62yurWqpqCg
nHFQPjUvNz05RFyDmKWvtrOzr7Oysba2ra+4ucDDv7zBwry8trOxs66srbGys7CurKyus7C4urGc
lJSWk4+MjI+PpbiWho6RkZGPj4+EcGlmYmBeZ2ZPR0dCNzM1NDUxLzEoIh0aGhwaGh8fIyMhIyMl
ODspIx4VCBEfM1ZldHx/gYaOjY+LiIWIhoqKioSejHuAe3Z8hISGj5OVmqGsuaqoo6SnqrW5ur6/
wbyxqqSlp6Ohn5yhnJubmJWSjYyCioZ4a1BHQkRETWVFPkBOXmRqdHqGenR5gIKCjI6OjpKUjZGO
hoiAeXNrXkApIx0eJjVHXnJ9gYaOkZaYoaGalpONiYWBgHt3cnRua2ldXFhXT1BOT1JOSkxMT0s7
QWJrXV5idGtiZWdxXFZVTUpMS0ZOXWtvbW5vbmtub3BubW1tfZGJko+UraGlpaCdmJaPioGEfYOL
dFxfZmdra2ZeXltUYmFkcnN2dHFxcW5zdnZ5dnd6eXZ3dmtvcXN2gHt9houKjI+OkZiPiYmGgHiI
kpWdoLPBxM3X3drc3+be0cvMzMnCvLrW2aGTk42KaVVegsrasqOsuLKzs7OedGprcXZ2fH2AjoGC
gYOTj5eppKauraywsLG5ta2wqZ+pm4uLk4+KpeCta2tzd3FqaGlianR3gIyNkZWWl6a5wMDK0czQ
0NDNysXBvrW1u52drse8uby/vLy+v8HEycrJzM7Lvr+zl5aYm56enqFXVFdcWWFlaGRpaHiFb2Ji
ZmleW1NSWVhZVFJSU1RcXWJnb3FzeYCIgXt3dHp2eXd0dHRwaWdfVUw0NV2SXURFSVBSTVNVWVlZ
U1RQTU1GPDdJYWVvbmhobnBuaXF0gYyMc2mGlpiUlpuemJ6XlZSRkpKJiYl4a3aDkZWWmJKUk5iU
hXd2dnSDprmzvLvOvLGnqKalpKOdlJaOhYB9fH+Af3+DiI+VkoaEYklGQ0M7Mj5cZ4qGgXhtd4Nr
YmePcmZveoOWlo2htaqalp+gnZiTk5KVl5eXlZihqJeUlp6blIqOjoyPgX1/sptwaWhqak4+NTMw
MSMyT2JnbXJyeXh0d3dxdHd6fYaMiouNkY+SkZGPl5+YlZGTkY6Ti4KIk6GorbK4vMDJyMXHysfA
vLGgj4B4bmtQHQsMDw8UJ0ZCQ0xUW2JtcHBzcnFycnJ6eXl4dJidm5qfoJ+cmJeempyzo5aSmJiY
hnp/gYOJoYuEmKatsbOwtbKzsq+1ta2wsa6ko52PhoaMjY2KjJObm5WPi4J7a11TT01WWWJkZWVi
ZGRiYVxiYl1bVUcpIiosOVZha4WcnqGlpKqvo5+Oi5GXl5SVlpygoaGhoKSsr6yqpqiqp6SmoJ+f
m5uak5WPkpOYqJyPjpKShoV9dnR3fHl6eXRtaHB0gomKiYuSko2LipWIgIKAeGlSUFBTWV1ZWVtb
X11WW1lWaHuNiY2TlpienJ+hoamwr77ZyqykoZOCYlNTUldbXV9lYmludHBtcXSDiIiTtaCKf3l/
gIKEg4SKjIyTj46JhIF8d3NtZllNTUdKS0dJQzUsJzNAPkVbZnN0dHR2dHJwcXJ2dnF0e4CBhomO
k5aOhX9/hoqJjo6LiXp0amJgYF1ZW1lWWVZTUFNUUlZZZ3Z6fYGFiYWGi4iAf3hrYVxfW1lLNCgm
KzdMZXqWoJ2bm52alI6Lhn13bWdlYmJfYF9faG5rb3SBi42Vm6GyzqqYl5qblpWUlrOfi492bXSG
mqGenZiVmpiclY+DcVlQTEdeeY2VlJOWl5WTko+VkY+Rj6B0NyEeIyw8SU1KU2V7hI+PmKGkqbGz
s6ywuLy5sbCytbizrKqlpqGUbVdYYoijqqyppZ6fnKGkpaCfoaGfo6OlpMDHjX1vWVt5gXlzdnh8
gYmSlZqTl5aPj5KRiX93fYSCgoOKioyNkoZ4dnd7fYKBhIGBfXRuZElHYIiWoKCeoZ6ora2wqqqu
r6+wqqWpoaGYj49mV3eEjpGVmJaam5iUl5udnaCfnJqWkpKPi4aKj4+Lj5GLjI2OhoF9fHx9fXR0
cmtuaWt7hIyOlJSTlZaMfHZzZ2E+Rl6OYlddXm55gouKhIOBfXt9hZecmJqWmJebl5OTko+Pi42P
i31zhKGqrKiprKqqqJ+PfWBSUmpzfIaMiZOXmJqeoKWusK2vt7GvrKmmnpSBfIGIlqeoqrCxs7Cw
sra7t7e2uLCsrZuNi5ifp7Kzs7m7ubu+v7uwr7KvpJymr7q4srvAtrrAqqaknJeUjoR8dHh6RzU3
Pjg1ODxFQkdHS01SUltxbktDRkxPUlZcXm6GT0BCRkZKSkxOX3d0enh9fZOyjoKKi4yMkZKtmIuP
jY6Pi4qGgWhELzJBUmFra2traHRoaX2ToaWqrbCzrKWbmJiShn1ucHRra3Fxcm5xeouOlZaUmJWY
oJyqmIt5c3Jua25oWFRNSktOVVBLUFJUTUxQVFlod32Ag4iGiI+araGYlJqblo+Pi4uLiImAgISF
fXt0eHRkWFhHNTNBQjtCSUlLUFdWXl1bV1NXVVBHPjUyMzc+RkREW1BMR0ZJSklHTnGco6Shqq2u
qqeura+lrrGqlW1HS15veHFramhkZWdnYGFgYV1cW1hVWFZeZ2lnbXNwcnh5gJinpqqppaSfmJON
j4yMi4KCe3dzeHh5eX+Fg4OFhYaLhoqYo6awtby6vMLDwsXIyMjLzs7Nx8rCurO5y7KhoKCcbUUo
GhoaHi5EZY2cpqy2uLe3u7yzs7OzsLPCwr/DwMPEv7y3u8GxrKWst7e2r7Cxs7a2tri6tqaVjoyT
j46GiYypo5GMjYyKjYyGgHRoZGJiYVdVUEdFOSolLCwsMC4sLCMiIiEgICAfJSosKioqLzlHT01O
RzMpKC5BWWhzfIaMjZOTi4+Sj4uGhYaEgYx9eHh2eIGGhISOk5ifqrOzr7Oyqqmxtby8wb61s7ax
pp6eo6CYnJuWlpiWkYyJhIZ9eXh/VEJAPkFFTz41QFNicHR5d4R6fH+BhoyLjIyOkZGSkYaEgXZy
ZGRYPCIaGBw0Q19zb3eBiYyNkZqbl5iTjoaBgn14eHFvb2pmXFZXUF9WTlBrVVJgV1NlaE5JV1tZ
ZGJraGdiZG1gVk5PU05FR2J0b29tcG5vcXNvbmtpaW5zd3mPlKWqoaGdnZ2Yj46NhYN9e2JgYXKa
kXRxeXRpXlxWWWVrcXJra29yc3F4eXR2dHhzdnR4b2tqcXN3gIWKko+Nio2OkYmNioR3cnSCj5id
rbvCzNHO0dHR3NrNxcXIyMG5vOPDoJiYjXJlX2uOs7ixsq61xbGoqZh5cHBwc3d3en+Fe3R4fIOB
gKOXlJ2kp6ytt7atrreurbiTfX1/gX9/inx5fHx8dnBucXZyeH2Dho+SlJGVnKy7xMnIys7M0MW+
xL6zrrOtlKG6uq6zt7e4v8C+wsfK0NTTysXCwK2Sj5KWmJ6fnEtNUFRWXFZWWWJkdH9zZGFkZWFh
WVdiWFNOUE5OUFtfYGhpb3J7hoJ7d3pzc3FwbXBub2piX1doaDw6Rk5HRUdOTE9QVFZTWVlVUlNT
U1BCOltra2tua25vbm9vbWtrbW1ibYiclpeal5ibmJqfmJiWjomLfWRrgIqUm56XmKCampqahnJy
gpufqrO4xcC3sKyjpqikm5yjno+EeoB9e3p8gIqPlJKLhnpuXVhOSjkwMlVpeYaFgoWbqI9/a2Jv
i56jqa+1s7Gzp6WlpJyfoZiWmJeYkZGSkZOSk5SdnZiWk5OPhH16cm9ubmloZ2RdPjk0LyslI0NX
Ymlzc3J4e3x3c3J2fX2JjY6MjZKOj46VlI+NlJKUlZGTj4uLjI2YoaqzvLq3wMTIycvNxcW/u7Ok
k4aBf2crDQwVERYrNTpFTVhZcHZtbWtobXNxe3pxb3KIjZGdnJ2bnqGfo6ihnKqflpSVlZGKhXyC
g4aLhoagrK6zs7OxrqqqrbKvsLKzqamlmpePjI6SjI+Sl5aVnpiLgH19cGlga2RhYmFkaGplZmJg
amJcW1dPQSslKSwsNThMa4SOk6Onmo+Kk5SPkpaOkZiYmJucnKGfo6qnpayoqqempqSbnqWdnJ+d
lo6Uj5SMfYCNlI5/f3d0dHd6dG5vd3NoYnB5ioqFhouSj42MiIiDe3t2Z1NQVVhZWVhVVlhbVVJQ
R0VLX4CMj5OanZ6gn6OmqqmuuLi2rbClj3hcT15uV1VbX19qcXt0dHl5gIiNk5iXlJOOfX1/gH2E
goaIj4yGjouKhoSBd3RpWUpNTkxLSkdHSzkuLCkwPFxiam1ydHl3cXl6fXt5c3R5en9/hISJmIyF
g3+EioySmJiXnqqJd3ZqZGFdWVZZWVJPTUlHUllnbn19gpaRhoSGhoiEenFrZmJxeFA0KCYsQFRv
k5yhpaWemp6elIqGe3hvZ2JldGpTVlxfYmFncniEiYyUo6Gfm5uVlJqXn5ihnpKJhn17hI+Ymp6g
lZOhnayUhX1wXVJJSn2jlo+TlpKRj46Sko+Pi4yGcksxJScpNEdOT1JYXXKFkZacoKWsrbO6u7m2
t7/FurKwsbWqqaippKF5WFhiepumrK+ppKWooaWmp6alo6Wno6mqp6CSjIRpU11wdHFvcHd9l5+T
lZOXl4+PjpaKho+fn5qSi4+PjYmLi4GAiH99f4KCg4F6d29fU1R9hpGWm5+fpKessb+xrLCxs7Gx
rKilo5qakmtUVGp9iIuUmpWWm52cnZ2foZeVmI+MjouIhYOFhomPkrqdfYGEiYuBfH+AeXR0cnN4
eoKIj5GbmpuYmpqNfXdqXExHTVNWW2BpeH19gYWKr5Z9fHuJk52gnJybmJSWlpKRj42JiYWDdnKT
pqiqsK6vqqmmpJ2Rcl5nbnSou4uBi5GXm5+doKmvrq6ur7CqpaCblISAf5S3uK6psrm4srKutby4
sbOzsrOsp6CPiqGqsa+xtri6vLu4vLy3t7apoKGxs7Oxs7iwraenqqienY+NjIZ6cF5FQDxAQTo8
QUdHS1BSVFhhZGhhWFBPVVNKT1RTV1RAPD07Q0VLSk1ZlYNxcHd8fHuDiYSChYmJj46Kj5GPjIqN
gn13XTcwL0RXZW5yd3FzgIR0gIqVmJ6hpqOhpJqblIh7fXlzcXFxcG9tanGIjIaGlJaXlpSen56U
k4F7c3BrZlhOTlBMTlROUlJTS0xMTVhZUFlndH2Bho+hhoCCj4+SkpebjImEiYmEgX2BioJ9end4
hmJMSz45KCMvOD1DSk1NTVBYXVBOT09ORjcwLC45PEZHRUdHRklMQ0dHRENNbpyjnqStrayspaWl
qKqkqq+VWUVHV2Jrb3F0cnJva2VpYmRlYV9bXFxnVVdfaGVnbW90d3mGnaeqrrGooJqYlI+Mi4uD
dHFyfYaGg3x9g4CBg32BgYiXqrCyu7q2vMLCxMPDxMrLxc3SzsjExcXHytHpxaOXl5t4RB8RCAgP
J0lzj6Oys7rK3MO4t7PIxbOvsr/DwsPDxcS8vLy2r6yvsKyztreysrO1vL+4vLixrJiPjYyIi4uJ
iI+PjZKUj42Lj4Z6a2hhXltZVVZQS0U1IiAhHyYqKSoqKiMjJicqKjE1Nz4+PkVSWWJpbWtwZ1lZ
TUpca3l/g5iPkYyPjo+Vj4qCg4V/eXd8fXyGiYaIlZWYoaWnrbK4uri2s7ezurq2tbW4vqWenpqg
n6yfm5uVkpGMiY+ajXx4cVlLRkpHRj03ODxGYoF3cHh9fYKGiIaFiY6NjYyKi4mGgX16eW5nX0cv
IxoXI0VUaXRzfYKGjY+SlpKUkoaGhoN/e3t0cXJpYFlVT09HSUxMU2RZWGVcXWZlWVxbXWdta2tp
aGpkYVxYVVBOTEtJVm5rdHpxc3J2c25ram1ucGVcZniLtZ+Tl5ycoZWOjoqGgoByYV5rf7GPc3R0
dndqYlleYmVwbnBwbnFxcXR3dHJxdHR0dnJzb3FyeX2DjJaYlY+Pj5OOj4iAeHNxc3SDj52ltsHE
zMPEysrMysnEwMTEvry4t6ign6yPhXZrdpaqsbKxsK+7tbCmmIN3a210cnRwd4N5eXR2dHh0iXt/
jZWbpq2tsLO1rayvrIp2d3l7eXlvcn2BgYF7dHJ0eoCDhIaMkZGVlpqfn6e+ycXFxL/Av7i4r6Ga
im94obuzrK6xt7Wytb/KzsvJ2drJw7uukYiLk5aVmJ2XRkE8Ojk7Q01SWFlpaml0eoGJhXpuZldQ
T1BOTk5WXGFnZmt0fbPXk3dzdG9paWpxbm9nWVNQRz4yNz0+QEFLTU1OS0xOVFtXWFhXUk9VU0lH
ZWlnZ2lna25ra2praWhoZ2hrfZOSjI2Pk5eboJiTj4aMjISKa3SGjZifpKCanqOgoaOjmn2mpqWm
rbW5vLqvqaedm5+hoKCYiH16dGtweXJze4iOjIWAfHhiWVBHOTEuPmJ5houNkZeYmKiAdKGwpKGn
qqiqrqeloaSkoaCdn5aYmJWVkpWSjoyOj5iXmJiRi4x/dG9wc3Rubm1uZ2qFVDEqJh4fPFliZ2pz
eXl4eXd0c3Z4gIqGhoqMjqqejo+PjpKRjY+Rj4+MhouUmqOssry/wL7AwMfEx8XHx8O+uq2fj4iG
clwyGhEZKTQ7PEJMUlhka2tqaWtobXBxc25wgY+TlpacmJaVmJqcmJibm5iYo6ORioiFgo+Lg4WG
hpiqsLGsqq6xr7CqqqqqrKynpaSqoZWGhpGUkpKTlJOVk4qDfX1/e3RwZWJrbmlucGdkWV90fVlP
UEk0KiouKysqL1Jrj5eEhIuOjIaJkpSPjI+NkZSUlpueoaShnqGkpqmpqaekn52anKGco6Gcl5SW
loV3c319eWdoc3R3dHJ0dHJxdGZeXmJ6cYSKjY+DhoGDgnl7eHBZT1dbWV1bW1lVTVBHQzc5Q1Bo
hY6Plpyan5+fpKesrLCwr7OtsaGJdGRXV1lVVldcYmtucnd9d32DjIqbn5qUlpeNhIKFgoCFho6J
iYygk4aGhnx0dm1gTU1MT05KSkRBODUsKSk1WWlqcHBxdHx9d3h7e3t/eHd0fX+GiIWCgISEkZKP
lZicnJqanKGXhXhrZGFcYm5ZUk89N0FLU2eLs4Z2d4B/goZ9e3Z2cGtvfXh9RCwpKDVKZIOdpKSj
o56cm5iUjYZ7dnJtZGJZU1JVWFlZXWBqdICGjJOUlJOXmp2Wko+XnJifpJiUj4+TkpqfoZeVkZyU
jo+TjoVgTkdLYn2PlpWWl5STlJGRj4+Ohn1uRCwoMUVSZF9SVldke42km6Ckp6qvsru6ure5t7m7
trK1sKmsrqqjnY9uYWp6m6aoqqqnp6aoo6OlqqekpKWpo6WooZ+SiXtZR0liZmhrfYuGho6Wk5SP
j4+JhoaNpbW3rKGalI2Pj46Ge3uEhoOFg4aDfXt0bWdgUFl0i5KUlpymqqeprqyys7OzsK6wrKml
qaqVaUtNWXSIipOWl6GcmpiYnZyYmJaSjIaGfX19gn2CgoGDfXyBf4SDhIOBe3l9gaGGcW52i42R
kZaXoKGbnZSEeG5oYldVV1NdZXF/hIWGhYWJjIyGhIiPmJiXmpiWk5SSj4yPi4aEhHdld5GhqbGt
ra62railo5yDa25zerzVjHh8jJ2Ylpufn6Oss7e2rKmlnJeGfYKIj56wsKyzubaytby6s7Ovqq62
s7KvrKeqpKauube5t7+/vLu6ube8wbmtrbW2urm5vLavsK6oo56hqZiOjpd8bV9NREJqWTlDUFBV
WVZdXGVmYF9hW1VQTU1JTEpJQzc4OTVDRklJSlJqZ2t0d3d7f4SEgoOJhoyIiIuPkYqJfHRzZ2BP
OCw1T19qbnh5enx8e4CEiI6Tl5iboZ6XlI6Mhoh9eXR0eHhya29vdIGPiJeSkpWUlJOXlYuDfYF8
fXlnUEdBR1BOV1BKS1BQTEtOWFdTVmCGfHyDio2ChoqMj5GVlo+NhoKGhoSEhoiGg4OAe3h9dldC
QEknFiI0QENHRklJSlVYT0xDREI1LC4zNzc7PkI+QkNDQ0ZHR0VEQE1nkqGgqKqqrayppaepoaCj
t8x8RD5QYWtxcHRycHNvdG5oZWRlZGJhW1NNUFtiaWtpcHN2eoONnKatrKWgmpOPioaEgXd0b3SA
hIKDgIGJi4aGgYGRoK2yur/Dx8O8wMDFxcrHysvOzszLzcvMzMXF0924mpqSiHtiKxMMEBouSXma
p6qzu8PFvLa7wMO8srCzvMXHwMTKxcPBvry6td3ErrG5vLWztb7Bu7y8trKsloiJjYuIjpGOjI6P
ko+Pj4+IhXtwZ2RdWVhZW1BHQi8aGBQZHiUmKSssLzI0OTc9RU1WZ2hgZWp0fIaMkYaFg4FyZ2dt
eXl/kZGPjI+VlJKKhoKFgn17fIOBhY+NjI6TmKCnqa+zt7y7vsS817qqrba2sKWknpeTlJqbp56R
lZOLjo2Lx+ecZWdfTklJREdFQD0+QU9vf317gYF/gIaFhomNj4+Kio+Cg4R/eHNxZ19TOyggGh4w
Sldlcnh6goqMlZWTkYyFhoJ/f3t2eXNra2dbVUk7ODxCT1JTVlZdXWFfXlxbZGJlaGlta2hoZWJk
XVlWU09QTExKYXFxbm1wbm1rb3Brbm1uYWFiaYaRj5SYmpqamI+LhYGAe3dyaHJ9hIGEfXh5gm5i
XVxcXmJqcGtpa3BubW9wc3Z2d3F5ent2d4Gbj4qPyMWPjZGPkZSojoJ5c250cnyGmKq7w8THxcnH
wsnFxMPIzsTDvLKqpJeRj4KCeXmCmKWvsLa2s7Oyraqchnx0bmtram5ucniCcWdnZmdmZmlugZWh
p6epsbOzr6SSfXR7fXh6cm1vipeKhX18f4CChoyNjY2Uk5iWm5qYoa+4ycDAv7myqpqIhHlnXG61
zLiqqqy1zLitr77Iys3WzsrFvK2Sg4qLkZGUlZRZW1JLQCsoLz5iYm1/gYSDiIOCenJxa15QSk1U
Vl5iZGdtbXmJlZyjj4J3g31eVWptWUxKQjw1LDE4O0A9RkpGSkxNT1BbWVVVVVdXUlBPQkVhZ2hm
ZWdoa25ramhrcmlpYmFqf4KEio2PjpKRk4+OioV/e1xhd4mVn5+hrKypraqtqa2qo6apqbWztrm3
tbOysrCjoJygmI6EfXRnaWpxdGtvgoaDgYKAeH1kUkZCMy5WdoGMkpqfmpiWkpijrKapqaqtsqqo
p6Wpqqehmp2YmJiVmJKVj4iLjpGMkpeampKOko93c3Fubm5vb2tkYWA7MSomHx87WGJqa3F2cnR0
dHRyc3h/g4OEiIuLjYqKiYuMiYuKjYqPjYmJlqChpa+7vr6+v8PDxMLFyNHLx8S8s6iflop4ZlA+
KCAnLzQ+RVlfVW6BdGpqamtucndxa256i4+XmJ+olJWXlZudmJaTmKSWjYyNi4V3e4CDiYyJlZ+q
rq2oqq6vqqiop6ampaiooaSgpIiEjJKTlpePmJSKhoSGhYSDgHxxbm9qa25rZ2RgYF1fXFZSPi4s
Li4rKiowUmt2f4abmIqJhouNj46MjI+MiI+Rlpqan6GhnqGnpq6hmpSYmJ2hnJ6en5ugnZqbfXZy
cH17aWVocXB0c3FzcnRvX1lZYGlpaHaGioWBfHx7dHRzalBQVFleWVdZUk9cVDgvLzU7UnSMkZaV
lpuesayhpqqvsbOwsKynmIl7aFlXWFdZXFxkbXZ7dnp/gYiPkZaWlJaalox/fYOBgoOEiIWJjYuM
i4iKhH93dGtUSktLTkxOTEZFPDUsKS87VGBpdHR4eXt9goCCf3R0c3l8gIKFhpHDmoOarZiVoKCg
p6yspp+Ogn1xamdrjmhWSjU0QVBZYGdrcX2BfIR/eYB8d3R0cWplWUc1LkBBPVJwj5+28eakipab
mJORiIF0cWdhXVlWUGFmWVdbaHF0eH+Gi5eYk4+Wl5SUlZWaoZ6eoZuWmJyjrKSVmKqakZeWl5iU
gmVQT1ZqiY+UlJGPj5GOjo+JjIiFeWRCMj5gZW50a21uX2ukxZiPmqGpqbKzt7y+xcm6v7u1sK2u
raqqp6OenYtucX+WmpigqqqqqqmoqKejo6qopqatp6GgpJiTi2RDQEFVYm92gIqSlZiTi4uPkoqJ
jZ2w1sCusK6mm5GJiYuIjYOGiImGhn99e3ZzaGBUS01tho2SnZ6hqKqzsK6wsLCyqqysraqmu59u
TkdKWXuPqpiPk5acnJiVm5qclY+Mhn97enl9gHp5fHd5e4CAhoWGiIZ5fH17fXlzc3+PkpiXlJig
oaWgjHh3dnOPalhbX2JmcX+bqY+JiIiEhYmJiJKnnJiXl5aTlZSRiYmIhnpza2J3j5+qs7e6urO2
r6ajqpN0a3J6hYqJiIqRmpeanZ6jpqSnpaGooZyUiH2BhY+Vnqq5v7i2vMG7urm+vrm4vryytrq1
qrCqpq+2uby8vsLAwLu+uLW6vLGts7i3tbq4wrivrbKnoaOfl5SRj4yIgWZORkVCSlNZVllZXmFk
Z2hdXWBeU0tMS0pHRUU7NUNtST1DREdJVGtXYG5ud318f4KEg4aGiYmGjaGPfXhzaV5QRkA0MkpY
Ym5yeXuCg317e4CChpGPlpiXkpKRhICCfXyEfHp4eHNrcGpzhJSGj42Kjo+RlIiGiIaEgYiJhX1g
T1BFQD5GR0xMU1tSUFdWXFRPVGlzdniAhISFj5WblJaTk5OMj4yEfYKIhoaGjn96dG9rTzUwKxwZ
MDs9QUdLRkdFRERHRjgxLykpLjE1OkBFRURbTEBHREBHXEdEUGCGnKWqqqivqaehnqWkoabM6alF
OU1ia3Z/fXp8eXRzcnRua2lkYmVdVU9TZmpiYWptcW10fH+KnaCkoZyWlYuGgnl4cGttdHt9iYmI
j5yYk46Pna+5vLq7wsPCxcnFxczLzs3MztDOycXLzsfDw8zJyL+ypZaIclIpFhkaIjhPfaOts7K2
vMS8ubm5tbe1t7vBwsK+wL+/0s28trCst7Gwr7W5vLW5vL7Fw768tq6Yjo2MjoyPlpiTmpiPj5WR
j5GDfXFnYl1ZVVRUSkQ4JhgRFRcgJSgoKjM5PkRJS1xza3R6hYB5fYiOlJynm5WUkot/dHR8gICK
jpORjo+RjoqIhI+EfX16fIXAqouRlJiho6SqsLa5vre3s7K8uK+srq2toZiYnJiXl5iXmI+PkoyG
goG43Y9oYFhPTFBKSUdBPj5GXXJ4g4R9hICEhISDhoyLiYyGioJ6dHdxbWZkWEcsJyAgKD5KVGRx
fYCBhoyRlZWSlJGJfHyAenNvcHFpW1dQRDVJTkxPU15bXV1kZGZiX2JkZWVnaWpqbmtkYmFgYllS
UFJMR0lUdHt2bm1vbmtycW5rcJFrYmRqeICGjJaamJaOjo+Kg4J7lX10en2DgYaFf3x3cWtmXllY
U2ZrZ2drbWttbm90cnB2dnJ0d3Z6gI6JjJS/v5KMlJiYkpyJf3lycXB0e4qYt8vRxMHFxcXEwMK/
xMXSvL/atZWMj4V7eIKAfYybqq+wsbC2w7mtpqGciXhyb3N0b21reHJoYmFbWVhYYWh9kaiqqqqu
treqk4mBfYGAfW9ydHmNjYCEiYSDiIaPkZGPoLOYjpSUl6GfoaSqpqemrZyDbmVmYWBoearEta2u
sq+4qq+ztr7K0tXMyMvFoYGFiIqGjZOOi2JfWVdUTD41OT5VbXJ8fYOEiYaBf3p5d29nZWJiXmFm
Z216ho+SnMS+in1xYkk1ZFs1JicwLycpLDE4QT4+RERGT1BOT1NUVVVWUlVZWE9GU2ZmaGpraGhp
ZWJra2tmamdhYWl4e3x9gIGCgoSKi4WFfWtTPmKDkpemxbOzt7e2ubawra6opam2t622vLW1vrq2
srCqmJaSj4J7cWdrbWRnZGh2gIF9gIGBjndgT0o7WXqLlZ6empiWlJWXpa+poaWqqrCqqq+spqep
rKmlo6ChmJSYko+NjIyMhY6PkZWUk5WVkntzdHRva2luamFhSjVCMSYfI0dfYmtwbnB0c3d4dn13
eIOJf4WIiYiPioaJiYuGiomJi4iGjJSdm5+wtrzBwLrCycHDw8rOycTFybu3uq6fjXx2aVI9Liwx
PD4+RE1dX2JiZWh2bmdmaGhrcHeGj5ObnZaXk5eWm7iwko2NlJKRlIaGhoV5gHuCgoKPnaGkpKep
pqWlp6ako6OooaOel7HDhXaFiY6Sj5eUjIuPj4+OjYuNjoyDdm5pbXFwa2RiWVlfWFNAMzhOR0dN
W1Veb3l6fYWChYOIioqOhYaIhomGhoiLjZOWnZummJGTkpWPlpuenJufo6WooaOcnp6aqpV8iI5i
Z2tyb3FzbnF2dGtdXFtgZGJlb32AfXl4dnBra292U09XWVlbW1hdSjouKionMEJefIyRlaShm5yf
m6GlqayvrqqpqqmXg3xrX1dXWFhZXGtudn17e3+CiZOTlZWVl5eTj46GfYKDhYaKio+ejomMi4aG
gIB9c1dJRU1KSUdKRktBNTErKSxBW2Jnbnh3d3R5gYJ9cmt0j4aAfIGMkpuOjZacoaGnp6atqqi5
qp6Xinx8dmllWV1TOTVDVV5kaWtub3R0c3OCend3d3ZzbmpdRy8qLDNBXIacoajn/vCkio+Wj4aD
gHRpaGJiWVlZYWpiYllbYHF6gIKIjZWUlZKMkpiYm6qmpKGkoJuhp6WloZubn6CYnpibpJJ8a1xV
WG6GlZKOkpSPipGSjoyIioh/dkdOX2Zrb3Bxdm9mZoCMk5iXnqCnur7CzdLKyry2trOtqa2urq+q
qKGYmImDjJeYm5+hpKywqaOqqqqsqqqxqqqqo6Gcl6a8dEk5SV1re3l6gYyPjI6Uko+Li4+bpbjC
xby3uq+qp5eOjYmGgoSGhoiChpqDdHBraWFORk5ufYqRl6GlpKqqr62vr6yuqqyppqGWkm5TSkdQ
ZnyTlo+TnJ+bnaGfnpiVj4iDgn14dHRvYGdtcXZ2fX97e3qAfXR8fHl6dG12gomOmJ2bnqSmpaGP
fXl6hsqMWFxfaoC4uev9voSBhoyIhpWYo6agm5eXlpSSjI6Pi4R/e5prW3ePnLO4t7Wzv8S5rJ6Y
hHZ7f3x8hYyNj5eempaWn7fNk4qLio2LiomIiIGAhYqfsLays7y5urm6tra3s6yytbC2trOzrK6u
qrm8uLm/wb+/w8LIwrm2sa+ssbe/u7rCt6qppaajpqabj5KVkpGVmHNoUD5MVVdYW15cYmZlZGFe
WFhUUEpKREVDOTIrNUM8PkVES1BLR05UX2pyeXd5fIF/gn+CfYGMoYl4a19ZVUxCPDg1Plhka4N9
fYB9fHh4dHqBioaLjY2LioZ/gH12eI2JfH+EeHFtb3Z8gIGFkaaRiIaFhoaEg4SIhYmEhnlrfV9N
R0dJR0lQWU5SUE5kXFRQWWtrdHt9fH2GmKOSm5iSk46RiYCBg4GEjY+Yin93a2FKNSwjGhw4QkJL
R0dLSk1DOjUsIiMxLi8uMTk+PkBARFlMQUFAQEdkRTxKaI+gqqqqqayqqKignp2blKS8dz5CW2hu
cnl9fXuBf3x2cnBraWVlYl9WR0l0clZWXmVva293fYONnqGfmJKMhIJ7eXNxcW95gYKFiY+qsKOd
o62ztr+/u8DFwsXEysnKyszMyMvQzMzO1tDIysrIyMXEwrilk4ZzXTosKC41S2aOpq+zs7vAwLmz
vNa/r6+yuLzFw8PEx8fDwbu1saqqrbO8w7m6vLu8wcG7uri5s5uJjqibj5SYmJeboaSUjo+Vj4SA
cWJfXVdZXU5EOywhFxMVHCElJiosNDpBR1BbbYWKhYmIio6Lj5SWnKizo5uemJqFend8g4WKj5qW
jYyRkYqNj4aBf3t9irywj4yWnaCoqLO1s7m8t7m+tba1tsuzo6CcmpaVlZyRkZWPjIiFhoWDgYOF
c2lgTE1LR09OS0dESV1wc3uDgIGIiIiLhYGFiI2MiYJ9f3hwaGJgX1VHNSkhIiEqPkdQVm6EjomM
ko+Tko2IhYmAfHl2cnJ0i21URzkvMkJNVVhbX2FiYWVkaGdiYWZlZGtrbmhoa2lnZmJYWVhTTUpN
Sk5ofXRra29rb3Fxa2tzgWJYW2JreHp9fYSOjo+PjIZ/eXiYfXR7f4N9fYF9enNrZmJZWFVVWVZW
YGp0cGltcm5ub3Jrbnl6e32BhYqPlpubmJiYlZeSiYaCfHR0bnh9jaW4xcvEv7+/u8DDvLy8u7aw
s8CkjYWBfHx9gYaEipugqrKzwLaysqqnnaiSdG9vb3RrZGJtZ15bXFRQUE9UZneGlp+kqqyvpZuN
hIJ/fYN/eXRta3ubi4mIjo6SlZSXmI+amJSXmJWal5eenpKWmI+XfWZSTnuKg4aPr7Wss7e1vrmu
sq+mucHa1M7S182XgYObjYqNjY6FaWpoYFxUREJHVWBvdnt9hoqKjIWGhH9/ent4c29vZWZpcYKR
jZOToZyMioaJeTgrJycmLDRJMCUpMkQ+PkdLRUNGRU1UU1dYWFJUUlJbWE1om21gYmZrampra2do
YmhycWtqbnNzc3R2dHR2dnZ2eHtyYDAsWYOYm5yku8W7s7K1tbmxqrCsrK6usLO5wMXBxcO6ub6h
lJSUg3drYmmacFldbn2Cg4aFhIZ9dHFuYkxrhIuWnZ2blpaSlpqgpaimpqeqsa+xsqqpqqytqqih
oJ+YmJiVlYuJiIaDl5OTn6yWjIiGenBvbWtraWdfXm5lOi4rIh5EXlddam1qdIR7dHZ5d3N0eX1/
fYSGhoaIiIaEhYiKhoWFhoKKl5ibqrO7wsnEvLrBwMLIycXBw8PDwMG6uK2ciH12Z1ZAMjI5R3FV
Rk9XXl5iZGlra3FtZ2ZoeIGOj4+NlpGOj4+SlZWNjo+ToZWJhoJ/gIWAenh5g5Slo6Gho6Smqamk
pKGko6Cem5eVin90iYKVk4mIjYuKhqCumKiWiI+WkouGdGlqa2ViYGFVU1VYcYRZVF5ZVVheXGJq
b3N9hYCCgoCGg4KBf4SFhYOChYKIlZGUnI9tc4GMj5OWmpibmJyhqKqho6inpZyMjYmJcmFiZWlu
a21ranJ9YFReYWBkZ2Jodnl2b2tqZGJkXlJSVlhZXV9pX1dQMyYlIyk1QVl7jpOYmp+hn5qdnqaq
r66tqqquoYx/cGdZWFdbXmFcanN3eoSMhYOUp5SSlpiUlI+Pj42GgX+DiIWKjI2NhoCChoOEg4KV
a0xJSkpHRklEPD0+NS8qLjRHj31tbnJ3en9/gnBtcnh2eYOLiIqYoZqWl5igpKOlp6+ur6WjpJuS
i4V6aWFhZVs8NEdXa3NranJ7eHZ2eYJ/eXlwdHR6gV1HNCgoNUlujJueobby4KWNk5WPiYF7d29r
YmhzV1hVVVZWWGBlb3Z7fX2Fko+Ojo2MkZ6vraejpKiopaWlrKqvvrC1t6ippaSqo52WeWVgfYyR
ko6PkpOPio+Mi4iEemdQWWVqbnR0dnR8dG1wgo6Ulp+hqLrL0c7OzdDc0MG3uLWqqqypqqqloJ+W
kY+RjI2WnZqhqaquqqypqKqpqKqnoKeoo5yaj4R0YE5baG5xfHyDhouNjIqLhoOCip+ytbnFx8LA
vLauppyVlpGGgoSGhoaChIF4cWtkYVRFRVdvfYqVn6GloaqprK6sraynpKGdmJqPbk9NT01fe4WK
k5iXmpudoJiYmJKPjoaFenRrUDg1PlZqdnt0dnJ0dG9ldHB0cWpqcHJ9hI6Ym5ieoaSjm4t9fHyA
f3FoZ22DnOn7/v7uqZOWk4yMmK63qaGYlpiWjY2UioaFg3ZrYlZiepGptrWxtra1uru4saSSkpuO
j42FgoqXlpKTnZaYpZiGhIqJjo6KiYOChYGJkaTOwayxtbi6ubeytbe3s7Cwsba1s7CqrLKzsrW3
v7+8vLzDwbq5ta+vr7W5t7m7uLO2pqWloaWjnZiXmJSSlZWPiZNiR01WV1lhX2VmaGZnYlxXUlJS
R0ZDQTwvIiUvPUc+Q0dLTkxOTk5YZ293e4B8fICDgH+Ag4iLhWhdWVNNSUZBODFCWWl5ioKFhoJ/
gXd3eYKJio6GhIB/f4GCfHR2fXl9fYyFe3NxdoCEi42Up499gYB/goGCf3+GioyMhnxya2FbWU9H
S01QT05MV19NS0pNXm90cXB0f4uUmpWbnJaYmJiXj4uFhYiPj4qGiH90Z1U6KyMcLDxPUE1PT09P
VEs1HRUXICsqLDM3Mzc+PjxAQ0RDQ0M+QEFAQVN0k5ujqKqusKagoKChn5V9dI9iR1hrbXB4eoGB
goF/end0eG5ra2llW1JFO0xNQkdOWWVhZmtxcn+VmpiRkYt8d3Zyc3F0dHqCg4qNl62woai1vMG8
vr/EyMjMztDNy8zMzMfM0tLS0tPTzsjHy9HQxcPEw6qSgHFgS0NHUFhcfJ6psrm3ur+8wL/FwrWs
rrWzucXDwMLDxcG6t7CwtrOzs7zAuLrHw7u5vL+7ucTCr5GKmpuVkpiYlpidoZaTjIiFf29iX19d
W1lWSUQ7MB0UExMZIScsKiw4PkJMZY2DgomNjpiWmJaXnqGks7OlpqimqKqFfIaFiYmRvLKVj4+S
j4yKhoaFiYGEkZiYmJqhpaitsbG4ubm2uNW/rbCvrqqjoJqek4qNkpaPho2MioaFg393bm1qYFBH
S09ZW1ZVT1Bdb3yBhYODiI2GiISGiIOLj4l9fX97cm1nYl5XTz4sKyssMDdDTVJfdo2WkZGRj5aY
i4qFgXt4dnFvaG1wXFhJNTA1TldWWVtgYWJkZ32Gc2BgYWRqa2trbnF0cGZiYl5gVlJOUExMR1Ji
ZGpua2pub2tqbW5nWFhZYmZra295eIGEhoiKjYNxYnaPhYGCgIaIgoaAeW5pZ2FiWVRPR0xQZXRv
a2ZnbW1qc3NycXN4fYCDiZKTlJSYnpiYlI+Pi4R9d3FvdHuOo7K7vsPFwcLHwr6/wb65r7CwqJqF
f317f3+Gk4memJunr7CzrK/Brqmjmop8dG1raGVmYl9fWVVcUExPSVBneoaOlJegnp2Sj4mKhIOG
fHZubmJkc4SEhYuVlJOYm5yWkY+VlZSUlpGVnJ+XkZSSiYBoYWFggYiKlqCzubPAzb63qpaJjZOg
tcrHxM7K4M2RgJeKg4OKjHNoaWdnZ2tvaGpob3p/e4WIj5OUj4yMjIyLiH19fX13cHSDj5GMk5OY
k5ijkZd5PiwsLywlKSYgHh0pMzc+XkpBRkdLTE1YVlNWVlZWWVNMR1BiaGhnaGZka2phYWdwdH2P
fHBrbnBuam1vbWtqamhiYmRQNDhmi5ueoafDzruurLa4tbKtrqqusa21sbfFycjAwsKztrOPg4F2
b2pgX19bXWeIjHp9goSGioF8e31rZnyGkZOYm52amJKUlp+lpaSmqa+zsK2ws6qtu7enpaCcnpuX
lpKUjY+JhYqYjY2VkouUm4x5b2trcm1rZmtrWUs1LjApJTlPWV9laG1xdHRwcHR3e5J8dnuCgoCA
goSFiI+EfYCAgYWAho+en6Sxu8TFxcTCvsHKyMDKzszIxMXIxL+4saqdi4N2ZFQ4MkBknGhZXWty
c3NiYV1dYWFmcYGGjoaJhomMiImFioyOjYmMjYuFhoaDgoZ3cnR0fX13fY6aoaijnp2bnpqao56X
k5WSkYx9YV5naHF8jYqGhomJj42TmpyVlZ6blpF4a29taW9iWFdbX3Jrd21rZ2tud5+EaGduen16
enKGf3Z6eHl5fH19gYOBgoCChYp9Zlhoj5aOkpSPlpaWnKO616+Yn6ahl4+Lg4ByYl5pcm9ramtq
Z2BZVVlgX1teXmZoa2tra2ddV1tPTFJZXmBeW1tZWVViRCYlJjI6VW+Bj5iYmJ+ny8Whn6msqaiu
qqWYiH15dGlrc3R0e3lucYB9fYuOhYqPkaGcj42Tj42MlZeEfXl/iIaEgIWFf32FhoSCg2VORkdN
R0RLTkc+PUE7NTA0Nz5/lmVicXd2coFza26Ff3R4goOLj6WYmJSdn6OkpaiorcG5pqGgn5iPjH1r
Z2Rma004QVdnaWZtc3h3dHB3cnN3dHFvcXN0YlVCKCg4UHqXmJecpaehnZ6dlZKFhH12aGJiYXRe
VFNVV1lbX2VtdHt7en2Gj5SPjo+UoK6sqq6opKmmqKqxsrCzu8C6wMm/t7CppqqxiHh/i46Pj4+I
i4yGhoaJhoB2ZV9nbW9ydHd3f3x4eHGPj5KYoKG2yM7V19HMycrIxcK4trCtrq6mpaahlo6MiIOG
jI+Rlpugp6mqrK2ssaqmqaioqaaglo+Og3dtZV1tcn2bgH2ChomDg4F9gH2No7O4u8DFxcXLxby2
rqOako6GiIiGhoiDenhvaGFYSUtMUGh4gI6bo6Ohpayvrqmqqaiup6Gfn5V0V01NUFiMl42PmJuf
nJebnJybk4+NkYl9ZVBDOTs+UGVvdHNza2dkXlBPVFxof3FucneBjJaem56jqKaYhnyCg4SAe3Jr
cnmc6f7nzKeepqqfmqGut7aqo6GjoJiSjIqNhoR6a15OUGWCo7a1sbe6urm6ube3s7m/v5OGjoaK
lZWWkpebnJ2enpWIi4uhmIR9gnqChI+aoKqvs7Oyure5tby5vra4t7W4uLW1sayurLW2uLe8u8HC
wby8uMPJuLO2s7O4uru5ubizoaGjpqOdnaGhpLyxlIyLhWBTU1dbYGJhZGdoZmJfXlVQTkdFPTkz
JhURHjI+QENFSlBQU1xoYGJoa3h6fICFfH2BhHp6enhkUFBfYF1cTEA4OElga3N3e4KGhH16eXp5
e4CFhoJ/fXx9gX19dnh2enZ8fXRzcXiPhYaIj42Ign18e3l5fH+AfYGLj4aDfXZtamliX1RPSUtN
TlBxe09FQ0lPYWltb3KCkpOXnKCdn5qYlY+PhoKGioqNjomBfHBlWDUnISMyQVBTWFJTVFNNPC8a
EREaIiYrMjc6ODk8PD5DQkA9QEA9QUBGVnCJmJukqK+sqaGfnJuak3ReW1xqbnN3cHx3gIR/goWB
f3t2cW9uaWdcUD4vMDQ5PkZMTFBcZG90dHuGiIiFg3d5eHBvcnR7gH2AiYaXqaemqLbXxbO5wMjX
ycTCxMrJw8rKy8zOzM7S087RzszLzsvIw7y2pJaKcWFXXGRmZWpylaqztry7urvAvLy7tbWzsbK5
ubzAwMTFw7+5s7C4u7W7vL/Bv8HBv7u7vr+7ubvFnoaGjJKanZqcmJWWmpiRiIB0XltZXFRPT01D
Qz4zIRYTFBkgIyYmLDpATVRxiIqGjJSYoZ2go6Cjp6Sqqqqus6ykoJN/f4WYnpigl5OYnZiUj5GL
ioWGjImEjpiXoKako6q3ubq4tru7uK+vqqqqqqmpnpqYloaLiYuGgo+hgHh4eXdwYllLSU9QVF9i
YGBeYm10f4KAgYKIjYmKiYSEhZKLgoF4cWprYl1ZVUdCNzAqLDE1R01KT2B3iYaFjo+Ik4yIhoOD
gXZza2drbWRZX19JOUFXbWJhYmJhYmFhdHhlZWRnamtrb3JzcXBtYmJiXFdQVFBLRUdKRkdLWGRk
ZWhubmRiYWJZU1toZ2VnaG5rb3Z3fIOJfWVOYYKKiYKDiYmGnaR0bmViXldWUlVTSkdWYVhYXmRq
am1yeHFrc3h/goiNj5SYnJuYk5OVkYmGhoV9dnh7gI6hs7e8wrzAxMXFwrzCvLe4samkoY19fX2B
iIqJhqmXl56nqayzs7uqppiPhoJ9cXRuaWVmYmJfW1lSTUxMXXd/iY+Pj6Gqk42MhomBfXp7d3Fv
ZmhufIGGjKCXmpibmJWPmpaSk5aYmJqanJqXkZORj4J9gH+GjZScqrnCxcTBybyql3t3gpiovMDB
zqrM/eOmin+Cg4V3ZV9cXWJnZ25uf3h0fIKGiouPmJeUk42KhouMhIGBe399g4yOlZaWn5ydlo6S
jHthPTQwKisgKywWFRoyOkFhSkJCQUdHSUpQWVlVUE9MTUtPYV9lZGpmZmplZWZnbXmLeHBwcGtv
a2tqZWdoZ2tlYmJfXVxOW3OMpaGhoLPHt7Owr66ws7Wvsa6us7W6yM7Hw8LJxaqqqIqUgXJvamBf
W2BfYWt2gIiIiYSFgHx5e32GiJKWk5uhnaSamKGYmKOmp6qqpq6zraeqqbGxqa6qp6ahmJWWmI6N
jYmFhYaGiIyMiYyPinlxa21xbWppZ11YSTArNU1XT0tSXmJla3JxcnN2dHN7fXd3enx/fXuDhYSC
goKEfX2CfIGGkpahr7e/xcnLwrzCw8TFx8XHxcXIxcTFv7y+uKqUhXpuZWJia29uam9zdHd0dHFu
YllZaYWYnp2hk319fYOFhYaOiIWEiYyGhoqLhIODcltfYGdocmprf5KYoJ6Yl56bnJiVk5ORjoiJ
j3NZXWJhYmh4f318gYqNkpWWmJuYmpackYBta2hrbV5cXFxycGtxdHiPeGtub2pqam6Fd2hmZYZq
XWRucXBzdnd4eHp7f3liVFBTWXGAiYqLkZiUl5+hobjguJqarKOTj4uEf3RrYmFpamlmYmFeWVZU
WFlYV1hZYWJhYmptYVRST0lPT1RXW1xdW1xfW1Q7KCYoMkBQcIOLk5ecm6GmqqWmqaWhp6yon419
cXB0eHd5enZ5goSBfHqAhIWIjY+TlZqPkZGTk5aWi3p6fYCChoKGg3x9gH1/gIF4XEpERUZCRkZH
REE8PUNDQ0ZFPj4+R1ZiYWl7a2hmdINyb3yDhY6Vm6Wfm5+8qKGoqaqqrKmopqObmJOPiXtxZGhn
XEdOWWuKbmpram10b3NzcHN0bnJqaWJgfaBHJTBSeIuSmKCanZ+do56Tj4qBeXFramVkVlVTUFZY
WFdeXWJyeHR4fYWBfYWEg5HEs6Ggoamqqaiqra2qqrO8tbjFycG8ubOppqqfl5eRioqIi5GMhoaG
gXh4dmhiam1vdnp7fXt/fXp2bX2Pm6CjrrvI0tncycTFxMvCv7uysKyqqamooJ+XjoyJj46RkYqP
m56jqq+ztcCno6ChqaCcmpuXk4h9c2lla3R5eHp8fX2BfXp3c3h6fZOpsbi7v8fMzsjFxMW+uLOq
pJ6dmIWCgX99dHBoYVdPS0xKUFxug5HIuZidpKGjpqqtqaWho5+eqo5qZl9eYnKEjpaYmp+coaal
o52YmpOSi4CKZVNGPTVHV1lkZlhSU0xKTE5PVFliZGpveHyIlJydl5uhnZKJhIKCho2yhmtyiJu2
uKqora2pqaeqsK6zr7Gqp6ChnpeOjYiBeHRiTEZcd5iquLevsLOzs7a2trW4ubWulIyLhoyYmJua
l52fm5WXmKyWhIGGgIKFgoWLj52gqrWztbu1s7K5vLm6trOzt7q5s7CxtbeysLWzu8HDwL+8wMC7
uLm2r7O4uri4vLW4ubeupKChqa2mn6GhqqidmpeOemFhZmtnZmhoaGlhZWRcV1VMRUE6Lx8UDQof
Nzk8QklKUFlmanh0cXB0enyCi5KGg32DfXp9eF9PUGqhnItoV0tNWWRvcXp9f4SEhICBfXF5fIJ9
e3x6fYF9iYB6eH18eHJxcXBtdHuAhoWLioCEf3dzdnt6d3d6e4WKiYR9eHdvbWZmcGBPTUtLTVVX
SkZLXllkZGlqdICUn5yYnaCho5qNi4uGhYuLiYaIiYF3b2dZNCMiMDtHUF12XFBTVlBHMRwUDxkh
IyxBNTc1ODpBREJAQ0BCRUJGSUtWZoKYnqijqaamn5ybl5KIcFhQW210eHl6gX1/gIKEg4WBgHp5
cnF9ZldOQzIsMjg3PT4+R1xpZ21ucXKGhYaGfYKDfX18fX2FgYKGjZaepKaqt8XCwMXHycXT0MnF
zM7Qy8zHztLR0NDS09PR0dLU0cW+xLuolH9tX2hqaXBvcnqcsrm/t7q8v7y+uLOzr6mqtby/urm/
x8XAvLm2t8PSvLa/wby8w8PBvry+v8LEvrGjmIuJlJujmp2dnJWUlI+Jf3JfWFdrYlBMTEtDRTws
IR0gISIpLCwwOUJOW3eBiY+UlJigo6Wlqqqlpa2xsLWzqqmop494jMTTm5Gcl5eftZuKiIqMiYqM
hpiXlZufpKips7u2ubu1s7O2s6qnsa2koaShnpqMgoGCiIaFjIh/eneDfWthRz1ETlNYXIB7ZGtz
eYB7gYODhoaJj4+GipyPiYV/fHZraGBZVVRHPTMyOjMyPEtQTEpQYHR5fYaIiY+NjImDgH97c25r
bWhtbmlidnFVWV1iYmdlamliXGJmZmZpZ2Vmb3Nzc3NvbWtnZmFZUFBPTE1FRENCPkBGU1leXl9h
XVVUVlNda2hkYmViZWhqa3BzcXRrVlJneoODg4KAf4CUinJxd2hfXVlZXVlQR0VLTlBQWV5iaGlo
bWt0eIGGi5OUlZeVmJaUkoyIhYSCgnd4d3uElKayt7m8vMDCvLzDv7zHvrezuKqbj4aCiYmJj42I
ipKlnqGnqqqmpaagmJKXhXx5dG5raGdmj2tTYlNKRkdmfIKGhoqMkZeLjJGKiIaEfHZ6dG1paGRt
eIOIjo+SkpGdkomGiIqOjpOVkY+MjY+Ok6Caj42Mi4uUnaOvuMHIwb7BvMTuyH17jZqjrKqpoanB
5PXOiHR3hnhuYWBfaGtobY+4j3Z0g4aTlJSXm5iVlZSWkY+Sj4mGg4SNnp2Rk5WYmJOUl5SKg4Nl
OTEvLCwrHRcVFholNzw9PkJGQ0dNTVBPU1VUUFBOTlNeWV1gYmJnYmRqcXR4eHp4dnRwcHBubWtv
cHBraGVkZl5hXmJqb4ydpaqqrLq2srWxs7y6t7e3s7O8ubvAysnFvLmtqZuRfXN2cnNtaWpkYmBg
ZnZ8gImJiIaEj5h4dH2EkZOYmpWXl6agkpKXnKfBtayos7GwrK2wrqytqa2wpJ2empiVj4+YmHt5
fYiKiImIiYJ5dHlrcW9qbWhiXlhBLzA7S09SVFdeZ2lrb25udHR0eXt9d3l2c3h7fYCAenlydn1/
gn19hpaPmKmztsLNzsK/vL/Aw8jLwMDBxcTFwry8v7u1rpuDeXh0a3d6en2BfHh0eH93e3p0cHmN
nJydpKShm3h0fXmBhISBgX+GiIaDhoR9g3x/ZFVMS1ZhaWp6jJiYlJaSkpaWj46Oj4+Khn1tWFZY
XWJiaHeBfH2AhoiRl5qYmKCdmJWNemtmam1wamdlYm1yc3dzc3N2fXtya25wc3JpYV9eZ2VoZGJr
bm5vbnJxcnFrXFJQUFRXYHqSg4mPlJecnp2gp6ilqaenoZSNj4qGf3dpYG53eGpiXlJHTFBQU1RT
VFldXl5ibXFXUlNSVlBZWVxWU1dcXVteWFRDLD4+Q0tieYmOm6ahoKiqrKipqamno56TgXR5d3aA
gn98fYKKiIyGdHeEhYaGj5GRkZGSi4aIi4Z5cXN2eHl4dn18fHx7eHp3dHRcTkFBQj49QT5AQUVE
Sk5MTU5US0Y+RE5UYm5qZmlwdHN5gYWLlZytoJWYn6ajpqeop6qqoZyenJWPioiFf3duamJdVF5o
YWJiaG1qZ2pqa25tbmtqaWdhXllfczsnMUlripialZibmJaVl5OKgX10cGtiYF5YVllbWVhbWFld
XGtub3N3dnR0dnl/hJKfrKSmqqqsqKekpK+xtba5vMXFwMC6r6emp6GhlImGi5KPjIuIhYF7e3pr
XWtzeH98fX2Cf3x9eXJreJKXnaG1yszI0dPRzM7FwsLAu7y6r6+pqqqqvLyto5GCio6MiIyUl5+m
paiqp6enpqGcnJ2PlJKKf3ZnZGJrdHh8e3t4eXRxc3JraWp4l6qtqrO/w8TEzdDQyMfFwruzsqWh
joaEfXRvZ2phV0tLSUpHUGFyiZibm5ibpKion6SjpKGgoaGdlqjRs3NidJOms52en6SjpJ6jnpie
mJSEgHlrX1VJPjk+R0pJSUdHSUZGSVVWWV1iam9wfYSGjZefnZ+amI2Gg4SGj7iSd4aTnp+lqq+x
qqmxsbCwsrOzs7OvraOjmo6Mi4mGcVVDT2qRqqywsrO1t7a6vLi4u7u4trComI6PlZ2cmpqdmJOP
lZOPm4+DgX+DiIKEj4+TkpiquMLAuLyxs7y8t7u4t7i1t7y7uLy8tbOwsrq6vLy5u8PBxL+1t7Kx
rbK7wLy6usS8t7Kkpaekpaakn6OhnZ2hnJOShnBucnRzcWtoaWZrZ2FiVk9MWzEfFAsEAxAiM0ZN
XWhrbnN5hZF9fHt9gIaIjIiMhoOCd3h5ZU9JZrrFgl5cX2BiZGtpbnd9f3+Af3xza3d5hZ+Be3l3
dn2BgH12eHd0dHJvZ3N6ho2JhYaEhIF3c3d3eHh4d3Z7g4mKiYR8fHx0a2tkUkpJSUpJTU9PTVBk
YFlfam9yeo2mn5ugoaOdk46Ji4yGhYiLi4qCeXNvZ1g8LzE7Q0tOV2FXU1RVT041JRcRFCAnLjkz
NTw7PD5BQ0BGQkFCSk1PTFBhdp+no6Chp6SenJePinRlU1Zpc3p8eX99fH17e3x4fXl4d3Jra2lg
WVBJPjk1NDU1OjlMYGVpamtxe4+Pi4aFg4CDgoKGhH+DiISLm52foKS3v8THxcXEy9HNyMjMzc3M
zNHOy9HQzdHR0c3QzMXJycTDt6yahHRrgXptbnR4faa6trnBwby+wLy4t7azqqqstsO/u8LFxNC8
t7a2v8LCwb67wLzFwMLDwcXJwbq1sa+jlY6al5qcnZiXko+OhoSjgFhQU2FgWEtFQkNDQj01NDQz
NzQ0Nz5ESVVuf4iPsKGYm6GmpK+vsa2qsLW5tbCqqqalnpGTn6WYla6vmJiglpSNi42Vj4qOi4+X
mKWsqre1tbO4uri1sK6vqaqqraegoZyXhXl4f3+DhoWFgoB/dHBnZlVBPk5UYVlec3Npcnp6e3+G
iIiMiJKRmI2LqJaGhH15cmZhXFBJRj0wLDE9S0ZHR0dKTlRYanmIhYuNjYqNiYZ9eXJub2trcm5v
cm99eWtmZ2hpaWhma3RlYmRiaGlrZWhxb3FxfXFpZ2RiX1ZQTk5LRlBYQT04Nz5CRElZXVBKSUtP
WFxiYmJmZGFhZWVqampraVlWU2d2g4OGhoaCfXpybm9zamRiYGJyYlVNRUFBSU9SV2ReW15hZnJ0
e4OKj5SVlZSVmpeTjIyJhH95cnJ4f4aXmqiys8C+wMHFw8HDv8G7u7e1qZ+TjJGSjIqNiYWEi5KV
l52fn5ugn5iPj5KIfXp2b2poZ2aBYk1QTEdHTWJ0gIiOj4yNkZGPioqCgH16eHRxdG9nZGt/gX2G
lJGPkpORiH+EiI2VlY+MioaGjI2Rm5uSkpSTnaOnsLe/wcTFy8fExd7cp5OXpa+mqaWhnZWg1/Su
fXR6dG9iYmZoen18eHd6f4KGjI2Ump2Ym5+elZOXlpWXlpGLiouPmJiWlpydl5iUj4+PlXNHMzE1
MS8yNDQpHBguQjk9PkBBQkRHTVVrVk5VWVdmWFBOVFhcYGJlbnByd3h9fXt0cW5tbmtra29wa2dn
amZiYmJfZHSAiZaopJ+hsLGwqq6xsryzqa61trGzucjFxL68tq6hlIFvd3Rzb2tvdGtra2ZqgIiF
jI2IiYWBfXx6f4KMkpWWlZialI6LjZugpayhoamzrKqvsa6qqqqwsa2oo52YmJiWj5OEfXl3d31/
hIWMpH9ra2lqaWdqcHBcUDs1PUVMT1tZXF9kaGdpb21tdnd3fHyAdnN2d3Z5f314c3FzdHZ6en+G
iJSuurm3v8PCu7m8wMPFxMrMy8rBwsXFv7q8u7OvoY+DgHt5fYGGhoOGiIaGhYWBgIaPl5WWoaej
o6GVfXR0eHR4fYCChoGCiIaEiYV9eG1xbVtZV1tkZ5ihjYiNjouPj4yIhYaBf318b05OXVleXmBz
c3eAp5KIio+Vm5ecoJ2clo+DbWhoaGZkYmJkanR9e3Z4d3h5enh2cWtqZ2hhW2FeXF9dZ4Fqbmtr
a2tkXFJQTlBUV1VdboKJiI+XmJiYpMOxpKahnqGdjo+RlY6Ce3NiYGdra3aYWDhATFBOTE1QU1Vb
Xltka2JYWFNZWVhceWReW15cX3hpWX1dRFBGQ1R0g5KfqKqtrqypqq6wrqicm4t9d5iGdIGLgYWE
iYyJiYiKfX+GhoWGj4uOj4+NioaDfXJyd3R2dHZ4dHd3dnl4eXl5d19QTUpFQDw7PD5JYFBNTE1N
UFBOSkdGRk9ZXWZmamt2gHqCiI2Rl6CjlpihoaOqqqysp6ilm5eUkoqLiouFiX1rYmFhYl5dYmJm
amtrb2tvb21ra2ZnYmRlX1I9KSIqOlyDj5eWmJyhpZuPiomCfHZtaWJhVE9QVVlcXV1cXV9hYmdp
a2tvcG9vcXZ4hpuoqayqrq+mpKWqs7e7ubzBxcjFwrm3trGqpaqkmIuJhYiFhoWBfX17YVlrdHh9
eXyBfYCDioZ9dGt4iZierra8x87Qzs7My8zFw7y4ubqzsbOopLzFtaqno5aKio+WlZOUoKSkoZ+j
n6GfnqGXk5KRinxpXldSXGFte318fXx8fa/t1mtQYnaInKixubvBxMnN1NTOxcPBvLizp6aMg4F8
d3FtYl9rWUdHR0ZLWGt6jJOXoKOlo6GhpZ+fnaGlp5+qqr+ukoiToamoqaGbn6CgmJienJyamI+G
enRkbVg+Mzc7PUJCQUI+PkdOUE5WX2lua2tweoOOlJWWk5qThoiKjImJhYSYmpuepaqoqrCxqqeu
s7e1try2s7axrqijmpSPiHxwYGBzj6ixra6ytbq4tbi8vMO8uby3r6qck5KTkpyfoJyXlY+OkZeX
hnx8fYWDgZfatoaJo6y1uLO6ubq4u7q3u76+u7a4u7m8vLKpqbi8t7i4uL++t7y+urezraqxs7a2
ury6vLu3s6ymqaaqqKippqWlpaCcm56NdnJ0d3t4cmlra2JeYFlYTkM+JRYQAwAABxo3V2Zpbmtw
dH2BgoB/fX2GkpqonJONg4F3dG9USUpkhoJwb2tqZmZmZWdtcW90eYOBdG1qamt5g5ushHZ4gIKG
gXx2bWVlZWRgZnaOkY6MiIZ/eXFxcnZ2dHZycnl9hIiAfX96dHJyc2dQTkxMSkdHRk5WVlJXXGVq
c3N3hZSbnZyamI+MhoGGhYWMlJKLiYB7d29kV0Q5PkVJTVRUUFNXXFNZdGQwFxEQHSUpMjI1ODpB
QUI+QT4+R09PVFNQUldmg5qfnq3Or5uUlpaFcFtSXHSBgn19goV/enl8fHp5dHNwa25rYVxXTUdC
QUQ+NDEzNUtZYGdqbXF9kZeTjIiGhoaAhH+CgomGhouSl5uhpbPDxcXJyMjFxcnIx8zN0MrLzs7N
09HR0tHW19PT0NLIwL65rZ6GcWp0dHN4eHmKsL+8vMDBwLu3tbm3r6yoqqGqurrCx7u6urW5v8LD
vr+/vMLBu7zEzNPEur7Awrqzr6eYkamflpeWmJeOi4x/cndiVlVWVVVcTT47QUFFRUJERkVERUZH
S05SYnqOl5ujnJebpa6ssrOyrK+zt7GtsLCqpaGamJaeoZ+gnpyYmJ2al5SWn6qPiISNlZqdoaaq
qKmqsbW+s62ur6eqpZ+dn56hmIB0fICGiIaJiIaIiIJ7cmFWTU5MTVhuYF9kbXR5e3yFg4WLi4mI
i4+cjYyOjIaBe3RrZlxNRj04MS4sNUdeWE1NR0tPUFZldIiLhpGSj4+KgYF9c3JzcHNzcnJ0dHd0
c3Nycm5pa2tqaGFfXl5eWFddYmtvcXRza2ReX11dVVVQT05MUExBOzUwN0I1NUdNPj5DRk5WYmtm
ZGRlZGJfYGBmaW1rYVVSWXF/hIOCgYJ8em5oZ2pnaXRra3prXlVPR0RGR05ZcGFVWWBibXeBg4qP
k5eYmJSSj4uNioCBfXlvd3x8hIiKlKSzvLzAxcPBycjBvru4trasoJaSlqaYjY6PjoqKgYmcnJiU
lJePj46EhoB9e3RzcG50fWRVUFBJRkNQaniFjYuJjIWMiIOGhYSEfXdya2tvc2tna3RuaXqKjo+L
i314d3R8f4aIhoSCgoSFiJSWmqGfm5ugo7C1trq/yMfJyszFwcezsKakqqSlo6Ghmo6x97d9cXN3
dmZoa29wbnF0en1/goiOj5KWmKCenJicmJeanJeSjI6Sko6WmJiYnpuWmJiduafKoVMyMDQ1Nzo6
PE5JMysnKzU7UEE9Q0tWUlBWVVNSVk5OUk9SUlldXWZtgaqPdHR6dnBucXJvbmpram1ubm5nZ2dl
Z2tqbXJ/jZidnKiwqaqqqqqvs7PCvLW2sbO3vMG+tbGxqp59a2dubXR0d415cXN0fIZ6hIOJiISD
hX16ent9hI+Mj5iWj4+TkouMkpeepqqpqaeoqqqqrKmkp6+pqKmfnZyUnbCSfX9/dHpiVltqiYh0
aWtub3FtbWhgZ11NNU1vVFBUamdiboJqYF9ia212eHl9gX18fXhxeXl5eHBiVl9oa3F3fYONpbi5
urzAw7y2u8HIxcXFxcfJxcLCx8O/urmzsK2gjX12eIKJiY6Ni4WLj4mChoGKmJibmJWcn56epKap
gnBubnR8gISGhoSGioaGgoB9e3hyaVRLUl5ncHKEkYaAf4OGgn99fHt2cGdPQz5FSlBUVGJweX9/
goSOk5KVlpeWlZSPhHtwa2pnYmBiYmp9eHR5eX2CfH+FeHFxc21oXl1eXF5bXFtkZGFlZmVmXVtb
VlBNTlNcbnl9hIiOj5KXnJ6fn5+hp6apsaGLiouRlY+AeGtqa2tqaqCFQENLR0VGRktTVl5mW1hb
XV1gX19iX11eXmBeZF9fYmVfWVc7PkFHVHKKmKGppqmtra6urq6qpqGbjnhrcG96iouGgYSIiYWJ
i4Z/en2Ag4+LhoqOhn16dnRuamRpcXJycXBudHR5dG90dHNnU0xLR0c8OTlAREVHRktMTVBWVVBQ
UEU+SVRfX2Roamp0fIyKjI6Ul5SXn6Gop62wrKmlnaGdlo+JjIh/e4J8e3RpaWdoZ2diZGlmZGVo
amtraWJkZ2diX2BdUEYqHSc4UnKPlqekkpeWko+Mhnp7cWdmX1tSTFNbVVlZW1lYWVxmeHFiYmRp
am5yc3aBlqGsqKmppaakp6qwt766ur7ExcvDyMK8uq+sqp6cqo+CgYKDl4h6a15NXnZ5fYOGg4GD
gIGJkn9tYnSGlZqpucvHzs3IzMvIxcHAxb68uLCpqKy4uritrq6qoZaLiI6PkpegvKOem56fnJiW
lpKNhnlvZV1NRU5bXmlvdHuAfIXS/f7sgU5ZaXSJna6wuLq8xMXKzsnHyMjFubGxr5GFg3x4cWhi
WU5JQkRKTk5ZZXJ8iJSenaGfoaSno6OhnqOjoKalqKmhlZugpKamo6yqn6Ohn6ChlZ24noqAeGph
VD4yNTc1Oj47PEFDR0tQUFVebXBranF0fYuhi4iLjoyJiImLkY2GiJWXnKWqqqqwsa6vsbO2uLy6
sbC1sbCtp5+fm4+Kem1oeJKlqbKtsLa7trG2t768uLq6uba1saOVkZOXlJSUkoyPkpKSi42ChYmM
fH2Fwu+hiZKhsbe2trWxsba2ub+/wbu4uLzCvLO4srO2y8Sus7m8u7i6vLOysKmurbCzs7a6vLy8
vLOzs6yqqqysrqemp6OlpJ2cm410d3t7fXZ0cnNtanBgWVNOSzEgGg4BAAAKI0NTYmZrc3d3eXyD
gn99ip2moaGooZiYj3dqXEdKWWZubmpvcGVmZmJiZmlrcXBzdn10Zl9ianJ0i5eEg4SKjYiGg3Nt
amRfYWZSZ4uUjIZ9e3x7cGtranBzcXF5eXt9iXx3fXl4em5rZ1hPR0ZHRUdHUFZYWWBkaXN2d3yA
kpuanZSPjIWCf4WKiYuPjoqEgIF5a2RTSkVEREtPT1NUVFNVVl2WpUcWDRMaJjA6QUNHQ0pGRUA+
QkJKUE5PUk9QVFxzipeYmqemvpyXknpcVlRbb4iNf4KBg4KBenp0bXFwampoZmtXU0dGR0ZAPjs1
LC87S1VkaW1tdoKfqJeNhouJhIaLhoaFhoSEgomMl5ugtcXFxcnLyMXFysjDydPUzMnMycvO0tXV
0NHOy83NzcXFv7ismIV0cXh5eHd7fYKYtbq6vL68vLy8s7e1rKaqpaqpsLiztbW5t7q7w8S6tsHA
wMPBwMfFxMPDu8C+tru7qJ2UkpeYm5qXmI+LgXhoVU5NTVRVT0lFQUNFRklOTk5OT1JZYmFnYGJ9
ipSVlJihoKaquLOutbOusrO8t7ayrayjo5iTl6GloJ6hpJ2cnZqXkZuYkYuMi4iMlaGjqaq5s6eu
sq2sr6qus6SdnZuPj4uDbXJ4fYGDio6GgYSGgHxzZ1JNTEdOUFthZmlxjH17gYKDj46KiIqJj5KM
hYaLgn18cGFZVUY7MzAxLzdCS1BMTk9PU1BUWGJreIaKi4+OhoSCgHhwcnh6eXh6d3p6end2eXt9
enBtamZmYVtUVVlYVVBgb2txbmhlZ2BbWVhciW1KRERHRUM+OjQvKSMnKywrLzU6Q0xdZ2dnYmRi
Z2lmaGhkYmdkWVZic4SLhoOBenRxcHhyb2txcG1wfYRvaV1QRkBFR1eAZFVVVFxib3mAhIaMkpKS
kY2LioWDfHx0dG9xdHd4eX+Ekqa1urvBwrq8wcPAvLi3s7ummpSSmJWWlI2JhYKAhrqdhYCOkoyK
hoaEfHl2dnRta21tYlxhWUlBQ05keJGKiIiIiYyJio6KgoF6cm5ubWtxcWtkZF1fZnSAgoF/fXRz
cXJ2fH97d3d7fYaOk5ihoaejpKWqr7W+wcXLzcrQzs7Jwr+3raiqpp6eoaOYhpjLoXlyenh4Zmtu
amtvdHh5e4aLi4WRl5ebm5qcmp2clpabmJKVlZORkpGVm52Yn5yYlZiekY2AZ3JHOD5AQ0RLTmFL
QkEqHCMwLzM4Q0xTZldSUlNTUE9OS0xSV15fZ3OAmIF5eXR0dHR0b29wcHNva29vb3FrZmRobm1r
aXSGmJuXobCtraypqq22uru6try2trKzvLWurKWfnoB5fXt6e3t6eHuReHF0cmd2fYWGiIaEg313
dH+IjI2NjoySmI+MjYmLjqGkqqqqr66lp6ysrq2z0LGloJ2cnpOkqoyFf3t0clhQV2RrbXFram9v
dHdycm9hVko3PE1eZFxdYmJiZGVhYmFlbXR4fIKDgXt5eHt5eoB7SzA1SkdTXHZ3f4+tu7e3uMPE
urnBxMXHx8XKxMLBxcO+xb66trexn5SGeHiAi5GXk5GYlpqXko+PmJ6fnpqYoaWnpqOhpJt0ZWZ0
fYCBhISCiI+KiIaFhoF6gXdrVkpTU1tbXWdrdHR0dHJ0eHJraWhqZlI+PkFFTUlQYnN6fHx9ho2S
kY+PlZKOjZWEcGdpZWdoZWJlcJqbfXd6fX2ChISCjHpraGJZWFxgYFtdW2BgYGFfW1xZVlZSUGBg
aHR8g4WIiY2Ij4+eoZihm6GboaS3p4mGhJGSj5aShm9pa4J0ZEk5O0w6Mjk+SVJSUFRTVlhZWWVe
ZWVlYmFiYF9hXWBgXFdZW3pXaVRZdJOgqainqq2vsbGqqqimnpWPfXNxdHl/gYSBhouJjImOhX10
cXR9sLaAenl4eHNoYl5hYWJoaWhuamtrbnNubW9zbltTTEpFQ0FCPkNBREJGTVBQUFhZUlRWU0dC
UFhZYGBla3RyeoSMkY+Pl52anKSlpaeqrKajmpOOhIB8gHp6enh3d3d8fX1zfXNqa1xcX2BiZmZm
ZGhlYmBeXFxUQykjJjJCWHqLj4+RlJOUj4Z/fHRuZV5ZS0dJS1hVWWBfXFhZWFliXmJgZWlpa3J2
e3qLnqGmqqmqoaOhpqqzvMHFx8XKy8XFwbq+ubKtp6SklISAe4CuoXdfVFtxsY97gYKJiYSFgaDr
n2JWa4SVnaawv8XKysfIxcHBxcC8u7m2t66qsra5s7Ovrq+qnoiIiY+VmpWPkpKVmpiWm6ePhYF0
ZFtSR0I8TVdfZG92en2Ait/+/txvV2Z0fXuLnayzur+/wMjLx8XCwbqztbqsi4N9eHBpZ1lPSkpL
S01LUFhgaXeCjJeamJ2gpqOjn6GkoZ+dpaWkwLWcmqGorKqlqKGfm5qenJidnJaWj4Z9dG5bPjAu
LzM7Ozo6RkNER09QUl1ub2trcHR3enh4fYmUlJORj42MiIKDj56hpaeprbCysK6st7i1tbW4wsO2
qqenraqhk4Z4d4yhrKqsr7GzuL68uLezubu+u7ezs7OupJiSk5KTlZyWio+SkY6NkoN5e3x9e32R
waqPmKa1uLO2tbu8srK3tbe8vLm8u7m2uLOxqqiprre5ura1uLy3ramprKqqsK6ssrO4u7q8u7Wu
o6ilpKSpr6ynp6afo6Caj4F0dnp6fXp5eXFrdGddV1RZPCcgEwUBAhM0Tl1maXN3fYCDhIWIioqV
p6yqqbGto6GYg2pPQkxkaW1tam1ubmlnZGRmZGFibW90cWRgYmdrcnR3gIWIjI2Pj4+Gd2phWVNQ
XUVWeYiFhnx0dHNram1ra25yc3d2enl9f3RydHZzc2tgWEtKRUJERk1UV1lcYmlvdHt6d32Ol4+L
iYR9cWhvcniCjI2NiIJ/eHdxaFxQTFNHRkdOUE9OUFNXYnZ0NRcQER4rPHBtVkxLT0dDRUM+Q0dO
UFBSU1RZXXKGi4+Pj5ihj5aEa1lUWV1rnYaBg4GGg395eXZ3amdkYWFZUk5OTEdGR0RBQDozKjVH
V11nb3Zyc4+gnZiTj46MkpKNiYqEgH19gYqRoKXLy8HFxcXFyMzMy8zRzs7QysjKycjO09LS0M7S
0s3NxcC8t7Cok42Vko+LhYGChZe4xL/Avre4t7Kys7Copp+joaqztba3u7u8u7m/ucDEv8HAxMTC
x8fEvLzBwMK8u7Cml46Rl5eampqRj4V0ZlROT05USUlMREVDQ0RKU1JVV1VVWXR8d3N0cn2IlJeX
m5eep661sbGvs7q8t7O3sa2toZqUkZGYm52joKCfoJ2Ym5yWlZSUj5KIho2Plpieoa6uqqqlqqyo
pKq3oZWLiIWFenRqbnd9gYWGhYWFiIh/dG9lWE1OS1BTWV9kbXR5d3yPiYiakYuKjI2JkYOIhYWC
em9oYVVJOS8uNTM0OkdJS0tQUFJXV11dXVxic4GGhIqKhHp7eX18gn+Ae32Benp9gYJ9f4GCfXJx
bWZiYElKUF92YlhraXZoYF1ZWFZkaFVuWUdERkdHRDw1MicfIR4dHBwiKjE7R15qZ2doZmVmZ2ln
ZmhlZWBVUmJvfYmLhIR3dGlthXhxdnt2d3Z0eXBwaltGPkFHUmJbV1VcXWFrcoOIhYiNjo+TjomK
hnp5eXRqZW50d3Z4fXp/kZ6xuL7DvMHDvLy8uLWzsaWampiXnKGXqpeIf3x5jYOCg4SCiIaGf314
enZydG9taWViYmFWTElFSVxyj4iEhYqJiIiJhoSFgXl0cXFvb3h0b2dgWVhgdIF3dnl6eHd2cGtv
dG1qam96hpGSlp6kqaivr66zt7vDyMrFys7My8TCw7qtpqGmoZ2anJKIipSPiIWJf3hiZWlrb3Bz
dHp9gYiLj42SmJiRk5uVlJiclpKUmpOJiI+PlZeboZ+YmJedmJOLhX90ZEQ6QUdNSUxPS05LTUAl
FCU6ODJCR0lOUFZUVlxXUFBNYV1SVltlbnh9eXh4c3R0dHFydHNwbnJxbmtra25wbW1raGVkZ26F
k5eas7iso6asr7CwvMfAuK+us7K2tambm5qXj5OUmJOGgH19fXp7jXdnanJ9g4F9gYCBgYB8fYSI
i4+Oj4+OloyGlqCer7OvqbGuqqmxwLCtrq2wqqexrJiWmI+DfXt9c2tqV1Bdb3Jxg4BycXZzcm5y
a2lcOzVASllcW2JiXmJmZWJoZmZrb3N5fX+FgX2AfX2DgXtwPTdDREdVdIOStcq4trOzvL+xtrbC
wbvExcXExcXAyMXBurm5rqWWjH1ye4mLjZeamJqYlJeYlpicoaGjpKSlpaWopqSblXtVUmt8f4CI
hoqYkY6Ki4iLiIN9d3FzdFZKT1VYXWFndl9ZYGVkZGpiYWBWXYBSR0NCRlR2dHl9gYWJjouOj4yM
iYSGhXtraGlrcGplZWhncXZ5fICBhH1/hoN7bWloXFhUVVdZWVlZW1hZXV5fXVdST1BXanN6gIaJ
jI+PjpWOj5eYmJybmJialIyIiI2PlI+Pl5OEbmlua2RhWUQ9OSYiIzFgVExQU1Z3ZlxbXmZmYWBh
ZGJgX2Jfa59yXFtZWTpEX3iPnaWqrrayrrCxsa623cWbj4+BdnJ0doCDgoOGjY+MjIiEdGppb3R8
fX14cW1qYFZQWWVeXF5haGliYmJiampnbmtkV1JMR0ZHRUNGQ0FDR0lPT09TVFdYWFVSTUNJUFdc
YGhranaAfX2FjpGXm6GcqKqkp6SenpyVj4mBenRycm10eXp3eYSGhYSGeWl5al1YXVlZamhgYV9g
W1xfXFhKOjMzM0FQZHiBjI2JioyPhH10a2ZgVUdER0lKUF1ZV1xeW1hZWVleWVxiYmhrb3Z7gJWh
prG6rqWeoaSnsbe3usDFyMzK0snBvMXEuLGuoZ2Vhn97fHp2cGhlZmlyfIGGjI6NiImMs/ataFBr
hY6Vnay4vMXFxMXFwcC4vMG3s7m2ta+xr6+vs7Guqqq+mIOJj5GSk5GLhoyglI6Xt4hrZl5ZUkdF
QT0+SlZfaXN9gH2CpayqhnJ3m5aBfYidqaemrbi8vL+/wLm2ubqqpJSIkY53cWVgUkdJTU5MTk1Q
T1JicXR3gIyGj8KqlpOgpKOhoKWmsLWppaOtraanrq+wt6Oan56anZ6emJWPjIuAloVAKyUjJjEz
Mzk6PkVHTVBTW19qbmhrbXNwd3p6i4+SjY+RjY+Ngn2SmJylpqeos7Kwr622wLq4vLWzt7iyqaal
oJuOhXtxeqazrrOysrOwt7u8srW7vru4vruzs6+sn5SMhoaNj5KTk42OiYp/cXJ6d3p8gYaRoZ+f
trq4srC3uLO3ubW4ube5tbq1uLi4s62pqqmtsLO1s7O1saenp6qqqqyqrra2s7i5vLa4tq2kqKSh
pKiorqqqoZ+npp2RfXZ5gIKAfHp5eW5mZGRfU0s6KyUeDwcMI0BkgnBudHR4fYGEhoiGjaGmprCv
rqmtp5+KaElDWGlrbW1rampvb2hhYmVhXV1la29mXVliaW5xc4CFk5GNkZuWkYNxZF9TRzg5PUdi
eHaAg3doZWRgaW9xaWtxcXd0fYR9dnd3cXJybWpYSkJCREZKb21iX2Jqb3N6eXl8f3l5dHJvYlNL
TF5na3mEiIqDgoF3b2trXVhUST5ARUlMUlBbVlRSQzUgFhQXHipHbmdPSUpLTUtHRz4+QExUV3Ni
T1NdZHuGgYSIi4yLgXRlWVlZYm15cnN9gIWAf3x3cmtkX1dZUFBSQkRFR0dMTEdCPjEuMklbX2Vq
cnB0g4yRlpaPlJOMj42LhoV9eXNxd4KWnqW6zcfHxcTEx9DSx8jRy8nIysXJztDOysrRztDSzcjD
xMC4r6mlqqylm5ihnJKKlbDAwLu6vL63tbOxqqGdo6yorK2xtba4uLO6w8XAw7+8w8LDxMPHydvJ
vL6+v76zpp+SiZ2dk5WSlIx9dF1FQENGT1BLSUREQURJSU9cV1VfXGKAgX2AhoiDjJSYnJ2gqKis
qq+2srKysbW3u7y6ta6mnZGBkZybpqGenaGgm5+fn5uYkZORlYqDiJSTm5+cl52lqKeqo6GloZyW
l4+EfXliXmRzgIB9goaLjIuJhH92cm1WUk5QUlhham9xcHN4ia+YiYWFiYaIhoiJjIN/gH1xZ1xS
RTcwLjE4MzVCTElNT05PU1hZXmFiXWFicHuBf4GBhoaDgoaBfYGBgoWEg4SGgYGCgoSFiYZxb1xQ
TEpQZWpTUFJXX19fXVlWV2t8VUdHREVHRUE8PjwwJhwYFRQTFBcaJTI+VWhobmppaGVta2lpamho
XllZbnd5gYOPjXJqaXB0d3h7gH90enh6dnRvbXRJPkNHT1NTVVlfXmJrd4WIhoWNjYuKiYN9d3Ny
bmdhZm5ycW5teHd/iaGzu8PHwLy+vLu4t7OzrZ6coJ2ampidioWFenF0c3R4en+Ce3t7f4Z3cnJz
cHJxa2Jrd2FPSUVBVG+Ff4CFiIyGhYiLioh9d3l0a3Bwb3FramJbW2J7hHN/jn10dHR0b2pqYFxi
aHKGjZWcpq6sqqmqs7u/wcXMzNPO0M7Oy8fAt66hoaWhoaCeiouOjIyGiZ+JemdoZ21pa290fH1/
hYiKjY+SkZSWlpWWmJ2YmJaVjouOjpKWmJydoZ2Ynp+Yko6IhntpS0VGTU5LS01OTkpLST0jHCo0
UKBmQkdOVldWUlBQUFBTUFRZYGZuc3F7dnhzc29wcGtwcW50eHN0cWtqaWpqaWRmcW9VV2t5iYuF
l6Gkp6qwrq+6wryxs7O2s66qkXRwhJSYlpiYmJiNhYKDfH2Bd3RpZniBhoB9gX95eXR4f4mJiouM
jpeYjI2eo6GnrrC70LGhp7CzsKquqKeknZ2dmJGKgYB5dnBubmJia3d3dHZ/eHd0dHh4cW9xaWtQ
QkVSVFlZYF1iZ312XVtZYWt9f3d8goaPg4OChIaCfWtAOD5BRVByfZqvs7W4uLWztbe5uL/HwsTF
xcLDwsTFvLy8trCsoIqRiHd8iZGVmJianpuVlaOfnKChnZ6hpKWlpqejnJ2ci3lSVnOBhYCBhYaJ
i4qLjpKbiHx7fHFbTkxOVFJOUEAuHBowRk5WXF9iYFtpZEc9SUxLWZeGen1/gYWFhIaEhYF9fXd0
cXR9dHB0a2dpa3BweX2Cg3yCf4J7eXpza2diXWpzX1hVWFxfWVxbXVlZU1NTYmpzen+FhYqOj5GR
kZOPl52al5iYlYmEiIiEjImOj42enpJ4aWloZmRdTTc1MCclKURQTlBWW1lcW11iZGlmYmJiZWJh
XWFldGhfXFlYWGR0iJalsKqsur6zs7i3ra2wqaOYk419c3R5fXt/hIiPppeOiol5YltfZ3Jua2pl
W1VQS01QTlRQVFdbX2dfXWJlYmdoYVZQUExKREVERj49RERGR0dMUFNYWVxUVlRMQ0RPVldbYmBn
dHR9gYGLlJiVm6GfoKeqpp+alIuLf3pycG9tcnZ0d3h9goaEhIR0aWRlYFteYFlbXmJfXVhXW1lZ
VVBFR0dLUFVZZXF4gYOJhoN8dG9nYllHOz1GSk9TVllcW1tbWVlWVFZZV1tiZ3SBhYWGmL6yqqqq
qqGnraqtucK+vsTFyd301MXIx8C8s7CmoZqIgISFfHt6dGplZnB8hoaIioqapJqRkomBdn+IjpGY
prq8u7rDyMPDw7y4urazubi5w7Ossa+xsKynoaGJiIySlZGRiYaDhn2GjYN9bmFYU09JRT06OjhB
Tl1qc3h5fYWMlJKGhoSFiYqKjZ6tqqGkqrO2u7y2s7a2sqqqlI65kXJrZVZJRUpOUk5MR0lMTFlr
cnN8i3hrb3KNeH2RoJqXnqqz17qfo6qxr6qvr6ypo5+emp+hpJ6gnpSPinluWz40Ly4vLi4vND49
QEpPTlRbZWlpbW1ub3R3eoyTj4+Tj5GPjIN/gY+bpKemqqmqrqius7W/u7e6u7W4s7WtqKOgm5GG
e3uLs7a1tbe4t7i2s7i5uLy8u7q/u7GwsKqekZiPhomRk5aVkZSPhnBka3d5eICEiYyMl6azsrCz
tra3u7q6u7e4t7W7vLK5u7y4ta+tqaqws7u7t7Otpqaopqqxs7CvsbK6ube3v761sKOnqqeorKiq
railoaCfn5iLeXp9f32Fg4F9d2tkYF1eWEYxJiEjGilNTWFub255enp7fYKFhouLu7epqK2ts7Oq
moNuVkpZa29tbW5tbm5tZWBiZGJbXl5ZW1xfXmBne3t3e4OXko+MnZaRinhqXEQ3OTo7PUlTYpeX
Z1ZQUFtiYWdnYWVnaHB2eoJ9fHdzc2tnZE9HRkRJR1RqamJkaHB0c3p7eHN0dG1oX1VHPTU6VFxm
b32FhX90dHFrZ2JZVEpFQj4+SU1OT05OTj0xJxoWHiApOExVUk5OUFNQUExHQT4+RUlQjKhiUlxi
a4B7eH+AgIWGZllYW19nbW5vcXaCf4CEg3lxZ2BbUlRMUExCQkpMUFBOSkk8MiopPlRha2ptZ3KG
kpaUnJaUjo+PiYaGg3xxa2Vmeo2cpbvHzMjHyMXJ4NzLxczOycTFwcLLy8PFzs7V0dDKxcPAuru3
tbOvt7WzrrGwsryorLfAw7i1uLaxsKijmpWYoaWqqrK3vLy2s7+/vrvBxcG8vsS/xcTJxL7DxcW3
rKWYlIyOj4+MjomKfGJPQDs9QERHSlBiUEJCR0NFS1RZWF5lanaBiImMjIiIl5ygpammpaqwsrO2
s7OwuLy5v7uzqaeehmZzkqOgoaShpKChn5ueoJiYl5KUjIiEjZKXm5ianaGfnqGgnaGcm5KNhHJm
YVZbaXN7fYGDhoaMiYuLenFpYFJVVlZYYm1zfHh4fX2Bj4+MhYqKhoWGiYyJhX97dGtiV0c7NDAy
MDEzO0VLS05QVFhZXFtiYlxcXVlbZGl0f4CGhoSDiYmJiIaNj4yKi4qMioKIhYOPwIlfSUpJR05V
U1BOS01QUE5SVVBQV1ZJR0VKR0ZHR0VAOzUqHhcTDg4NDxMcKTVQZmhoanFwa2lobWpoaWBUU2Ku
knuAhpGNb2tydnh3fYB9fXp4dHp6dnR5g088REdQVlRZWVxiX2JqdHmAfHx/eH99en12dGplU1Jl
bWtua2hudnp/jJqut7q+xc28s7mzssG1n6GkoZ6clpGLiIJ7a25xc3J0c3d3eHx9gXp3eZJ/amtm
X2dqXlJKQDlMZHF9hIaGlIaGiImJgX96dHRycGtucXNtaGJXYXF0dIWWfXd0dHNrZF5ZX2VgboKK
lp6ksrOzrqy2uL7Cxczg7M7FycnI0Mu6qpydp7KqoZSLipSUk42OjH9/YWBiZGlpaW1xf4WGiIaI
houRkpeYl56Yl5iWl5aTjIiSnJWYmJicnZuamJudjoaCf3ZgSkdGTUtPUExNS1BPUEE+VGV0gGBQ
T09OT05PVVRQUFNYWVxnbnN4fX16dnR0eHZxdHJ0c3FxbnBxb21rcmtramdmUDQ0R2GGhImfqqqq
qK+zsr/Cubi4trCzxZpya3+Klpicn5uWkZGLgoB6fYmKcWJhdn17gYF/fHp7e399goyVmpqYlp6t
qqakp6yut9e5oaGlqq+qqKmloaSdnZycioaGe3h0c25qb3F0fHl4d3R4eHN0e3t0cW1rbV5QUFNY
W15hZWdkZmRiXllebr+ecW52fYSGhImCg4B9dmtNREVgZ3SBmLC4srOzt7ezs7e2ucDHzcrCw8XF
w8PBu7e4s6SWf3NweYmPkZaWmJiXnpiWmpeWlJ6eo6WjpaqppKOhnpSVf0NAZnmChomNjpSPi4mL
iYaGhYB8cVNOTk9QUkxJQS4UDSU+TlRXW1lcVExHRkdGTGl0f3h4fH2Cg319goOAfXpzcHFzdIWA
enZraWloanJxcnZ6gX99fX16dGtwbmuAf2lgWWBZV1hXWFlXWVhif3ZrbXeAiIyMk5qNjJWRj4+P
jYWjsIR5eIOIlI+NjZSRj4+Pj3hrbXCFa1hEMi81NSwsSUxOVGJhW19gZGJlZ2dnZmRkZ2diYmJf
X2BdXFldc4OWpqiqs7G1tbm8uLazsKyoo52Uo4BvanN8f4GEhomLjYqLiZZzam9oYF5eWVJMR0ZF
RENHS09UW11hW1leXl5iX1lQTU5QTFBMR0dEPT1CQ0dKTlBQV1xdYF9XT0pJRUpTWVZdX2JveXqE
iouRj5iWnJ2hpJ+fm5KLioN9e3FoZ2VudnZ2dHh/gIaFgnt3aGBZWVtYX05HQUVNWWF5ZlJSUk5V
UlVWT1ZmZ3B3enx9goR3b2ZXRzc0OD5FR0pOVVZZYVhUTlBTTk9UV2JyeIWNio6On6+zs7GxqKSh
qrCxt7e7w87MxMTJy8jKx8HAt6yln5SMjKCGfYmDdm9pcXx9gIaMkqe5mIyLi4iGhIaPlpegp625
wMS+vMPBurOztrKqqrO6sq2vqqWqqqGWi4SDhYuMiomLnYl5dHR0a1xTU0xMR0M+OzU1NTtGWWJu
dnyCjJaWk5OOiYiOjY2SlaCln6Clpq+yra2uxOKzlYqGg318cmtiV01JR05PVFJQSktJUmtzfHRv
a2dgWU9KYHaFjZOSpbKxrqmsr62trbCyr7GlmqeloKGooZyYkomGdmRPODIvMC4rLCooMjg7QUdH
T1ddYmRpamtyc3J5j5aPj4+Sj4yIiZZ9j7CfmJ+oqqqqs7Kutbe3uLW3t7KwsK6no6CPjoaAirO7
uLW3uLe6t7a1srW3t7u1t7K1r7KvqZqSlIWEjYyOl5WPi5J3ZnRvenZ3eoKIj5Wuo6yytreztrq3
s7e2tri3t7m3tr++tbi6srCsrqqfmpijqaeno6Gpp6epqrKwrbO8t7azuritoaGgqayqp6WmpKae
np2fnZuMfHl9gYSAg317d2heWVlWRTUxLCUiL0RXaXRxc3N7e3t/hYWGiY+ztaqur66ys66hk3pl
W15ma29wbnJza2pfYF5ZWFZcWFlrYFxeYml8fXZ/ho+OkZSVmJWOfGtZQjU3ODg5QEdNYm9SREdN
UFBSV1JVVlxha3h9fXx8eXlzbmtgTENCR05TVVxkZW1vdHh6fHp5c3BoXFJMQDw1ND5JTVVqdH2I
hH17dG9kW1dZT0dBPT5HSUtKSkY6MTg8JyIvN0NPVltYWFtcXFlUUEpDOD0+QkdlpY1ZWV1mcHJx
d3h3fHtuYF1hYmVpZmhoc3d3fICBe3FoXmJQPDg8PURGTU5OT1BQR0E5Lio7U2Bta25tdI2Pk5qY
lJaVjoqFhISAe3RnWFx0ipGdt8nMycXFxc3Lx8fIyMXFwsXJx8XFxcjFw8fO0s7KwcLAtrOzs6+w
uby6uLWysqqot7y8tbK2s6+pnpOIjZihqrKtr7C5vMG8wr+8xMXAvMXHxcvCvMDEyMS8uLinoJiN
hoaEhoyGfXxuWEc+NTQ7QEVFUoFVQEJHSk1SUFZbYmiDi42Rj5Kbj4+coaCjqqqxuq+qsbiyrrK3
ubq8t7WzpZF3XWaGm5+go56eo6Gem5ydnqSYj5GIgYGKkZGPj5KUlZiYmJWVlJWTjIZ2X1BHTV5n
dHiYoYWIj5OSjIGAd2deWFhUXGpvd3yEiIaIlJaLhoGEmJWKhoiEhH17enZrYlNKPTU0MiwvMzJA
S01PU1dZWV9mZmZrZF5ZWVdYWGh8g4iPioqMj5GPl5iVk46Pj4+PkYuPiIqdg25TRUdQU1BOT1BN
TkpER0JEQ0FBREJCRUdERkdHQ0dLPSwaFxUPDgwKCBAiLElrcm1pcXFya2ZoZmViVExUYYqAgIaM
j4x6dHt/gX1/gn19gn1/gXt0cm9oTURKTExUVFNXW1tfXmBhZGppaGhpampwdoBnXVZJTGJqaGVk
aWluc3l7hZyus77JyLm7trWqrqegpKWhn5iUjoV8eXFraX94aW9xdnp2dnl4dHN2j4Z6bmhnZF5b
T0c3KT5dbXOBhIaKhoaFgoB/fXZ0cXBta2lram5nXlhfZGtudHR0dHdzb3CGYVhYWWF0ho6Snaey
s7Gwtbq8wMHKyNLWzcnK0NLLw7eflZups7Kbj4qLj5GOjYaGhIJfYWJlYWhlZm1zf4CGiImKio2S
j5Sal5SUlZeekouMjI2PlJGUm5aam5iYmJiTi4aCfWtUWFRWUlBQUE9OVFZbYXaLc2hkXFlYVEtJ
SlBSUlRWVVVcX2pwdHl/f3hvc3R0c3J0cnRzcnN0cWtxbXBua2pra1Y4KiIoOllykaGsraqtxbmu
rLm8saevsbCymGt3hpGXl5edmJiSk46JgYGIgnhwamVicnmJhXl0en10eoGKl5iXlJKXpaWopaCh
qK6wraipqqelqbOpnaCko56YkoyJjH1xcW1rb3F5enh6fXx4dnR3end6dHh0b29rZFlTVV1fXF5g
ZmJeW1hYWF5rgXRzdHl4eoGEhoZ7gn2CeGVOWWdpdoSYsbeytba2tbavrrC2vMTIycrFw7m8wbm3
ua6qo41vbnt4hIyPk5uYmJ6dnJiXmJeYnJ6gqKepqqignJycmIx3SkRecX2apoiXm4qAhIWJjoiE
fHNqVUlKTE5KSUdBMxoNJT1OUlBUWFdTTkxNTE1SYmRrdn16gICAend5dnJ0eXNrb3J0eXx9fHp9
cWtkanh9enx9e317dHZ5k3hrcqeTcmtkZnteVFVbVlldYHSWf3F4fIKMjI6RlZaRj5KUjHt0c3R0
dHuAgYOIjY2Ok4+OkY+TfHJqcHJmYEI7NTUzKTNMTE5PWFtcXmFeYmRlYmZlaGdmZmJnaGVgX19d
aHCDk6OpqKizt7a6u7azt7azs8yuk4V3dHZ2fXt9goWFhImIgoWId3RxgHtrZF9WTUQ+OTg7R08+
RU1PU1JSTlBQU09UU09MTU1PUkpGR0M+QUJDRktQUFJYXV1dYl1XUFJKR0tSUlNUXnFxd3t6g4aO
lZean6Ghn5iRjIaCf3puXFlVVGJvbXJ0eoGIhIKGe312ZFlZV1dQQT1BPj5DSVRQT1BUWVZWWFlV
VV1gZ25zd3mJu4FlWU8yLDRAVUpHS09SV1lVU1BSVU5LS09VYnuFiYyOj5ujrrO+s7O1sLCqrbrA
vrvAwcLDxc7OzcXFwLy6sqeqoYuGhoaGgn13dnB2dHuCfY6Wl5ialZWPloaEhoaLl5KVnqmxu7y4
s7Czt7ayrKqqpKmsrqqqpqagmJR9eX+DgoGIhHuEenR4cnBpU0pGR0o+PTo4MTAwMz1NW2Zwf4ma
n5iUmJyVkZKUlp2anZ+foaGhoaWmoai1sZ6Xi399gX10a2VYTEtKS1BQTk5QT1BcbXN3enl4aV1N
QENzeXmGi5Wssq+qrKyssbGxs6y83qqUoayeoKGfnp2Ri4R0X0c+ODEvLC4+LCczNDVARkdTWGBh
YmJlanBxdHyFjJKSjoqLiIaEgnaDsrOVmKOpqa3As6yxs7azs6+xu7WurKajnJuPhn+Lr7yzs7Gz
u7u5urOxtrO3ubm1s7Gzr6qkmJGGgYKDiIqPkZGNiHh3jHhocXR8gYWIj52oubaxt7W4trO2uri8
v7awtba5wMK8ubO4t6qnqqiemJyho6ajpKSqqq+wraiwsbWwt7m7trKmm5ugqKioqaako6GloaCd
mpeMgoN9f4aJg314d3ZrXFRLQDIuJSIzT2RrbXZ/j5R7c4WIhIaFjqanqK2vrqyqpJ2UiXJcW2Rv
bnFzcXFqZ2JfXllYV1lTV1lZXV1ka214fIGChoaMkZSXmJGAdGRLOjU1OUFOcltNQD1ASUtXb1ZM
TVdXVllkeHx7fX99enZzdmZgYWtQTFZhYmRqb3Bzd3p/enNwaFxQRz0yMS43QEtQVWJrcXd0b25y
ZltbXGJQSj08PUtJRz5CSj44QEAxOEtUWFlZW11fYVtZWVlTSUI8Ozs+PlBoaVdgYmptbmtrb25r
YmJeW2BkZWdmYmRocHdzdHd5c2hfUDIoKioxQEdLUFNQT1NTRTovMDtOXWdubWp0i5Gbj5OTmJON
hoSEfHx2b2lcWWZ0jJ25xczNxcXJy87OxcXIyMfIxcK/v8LCxcTIy8fMyMXEv7y5s7a5u768vry8
u7Ozta+mp7K4urqtnpqhi4GMlaCqs7W4vMPJu7bCzL+5v8PFwsG/wsXEwMTHw7y5r56XmJKNj4mF
hIN9fGtUQzgvLDU4PEFCRUZDR0tPUlVXW2FpfY2SkZSXmJ2akpulqKenp6/Ctq+1s6yvrLO6t7a7
t6qdiGtSaYuXmJ+an6Chnpuls5yYmJaPiXl2gYuPio2Tj5SXk5eWkpGNi4Z8dFtNSkZGV2d0gZiY
g4mOkY6Mhn95amJZVVxfaW15f4mNjo+cnZGNioqYj4B/i4l9fXlza2JbRz44NUA1LCwwNEJOTlNU
UlhcYWJlZ2eCdFlTU1NQWXSCjo+PlJaYm5ydmJaYnZqWlZaWk4+IhoWAeF1NRk1SVFNPT1BOR0lH
QEFSRj1BQ0NHRD4+R0NBQ0E9MR8YERERCwwNFB8pQ2JtcnNxa25vb2ZoYVtQR01UZXmIjJKPj4yO
k5KUjIaCgYKCeXl/e3JvaF9KQ01OTVJUUFZZWVdYVlVXW1hZWFBQTlRdYFtYXE1OYWlkZmViZGVp
bXF3gZaptb68tbOxsbCmqq6opqGgnJiUiXdra2Rfbm9raW9ucnR4cW90dHN0dntxa2hwZl5YRSsh
MEdea3SEiIGBg4F5eHZ0cG1ra2toam9ra21gWVheYmtzcWtwc21ra3ZmW1lgZXKGkpKfp7K6uLm/
vMG+w8jMzM3Mx8nDycnHtp6FgY+nqZuRj5GXmJeUj4uIi11eYV5iZWpxbnB/hIWCgn+Bho2RjIyT
lZWPj4+PiIOBg4aPkZiYl5WXlpWYmpaOj4uBeHd7eGppdGhlbnJvbW50cnNxcGhhW1dSUllJTU9W
VlRXYGJla3uDf3p3dHNycnRzbnN0c3RwcG9xbWtxa2pqa2lwUDQsIyEjNHCXpaqxqqqzr6mwv7q6
s7Owp5t9Ylt3jpiemJiYmpaPi4SGg317fYpqWVVqdHl7dnRzdnRzhKSelJSXlpyhoKOlp6aqqrGx
rqymoKGmpqeln56fnZiWlYZ9eHRzcGpucnR9goOBg3h3eHl3dHZ4dHFwcGtnW1VVW4VwXFteXF1b
WFlQUFllcHN2eXl4fX2DhH99enx6eIZlYWt2f564t7Kzt7KzsbO/xba2xMXHy8K7vMK/u7Gwp6Oa
f3d7enyclI+RlZ2gmJ2YmJWPlZeYnqyopaapqKGfnqCbk31XQltoeoWIhoOGhoaMhYSDgoJ6cWpQ
RkZLSkZDRkU3GQgVL0NHS01PUFlTRkdJSlJWZ2t0d3l2dnl2dHRwa3FraW1rb3d7goN8dnNrbW1q
bXd5eXd0dnZ0dHNxc3d0c3Jwc3FuYlNQUFJTW2hreHR0enqAhYaRj5STkpKTjo2KdnJvdHh9fYGB
goiMlZyLhImJiohwaWhycmteRTQyMDEpKUBLTVZXVlhdYmRnZmtqZWZpa2JlYl9fXF5iYWp3gI+c
qKmorbW8u7i2uLe2urezsqeem42Df4CGuaR7goiLhYGDhXl4dHR4dnNyZ1hQQjg3LzM+PTg+RklN
UE5NUlVVW2JlVU1FRkdJS0ZKRUFDQUNLTE5PUllgYmt7a1ZQT0tEPkBHSlNcbXFubnh8f4aPlJWX
lpqhlYiGgnpyaWJZSkdJW2twcHR7g4SAiIZ/d3dvYVlVV1VCQEJFREVHTlBQUlleYF5eWFlXVFRZ
YmdlZ210a19YRywmKjNXW0RHS1VQUExKTE5NR0dFRU5ed4KLjpuwsK2uxcW4sbOxqq+zs7e5vr7D
ycTHxcrHx8O+trGzqqmgj42PjImFgH15c293dH2MlpqXmJyenJeVmouFi42NkZecmqOqsbOysrCz
sayqoZ2YpaWlqaSjn5qUfXFwcnd7fX13cXRtZ2phVVRHQ0FCSj05OkA0MTA1PExca3yEjpiamJya
mJWYlpaUmJicnZ6bnpuao62fnZiYmI6Bf3t9e3ZubmJOR0tPUlJVUk5QW2h0hYaAenhtZlhFR259
g4+fn6mztaqpsbGusbW7s7emmKGhpZ2coZ6cmpSPhG1XRkJZPC8rLC83S0ErLjxLTlBUWVxhaGlo
cGt0cnmOkYiIiYKCfXdwaWiNoJuXoKamqrGwqKqqr6+ysrazrq2qqaGVk4uBeHqYvsG7vLy8t7Kz
srezsLG1sK2trq6spaWYjIR/fH2Eho2XnIl9eH12a21uc3p9goaSnKS2urGvs7i5s7exuLOxrKyv
ury5v766t7CxsKyvqaGhpaWjoaSho6enqa6srK6xs66xtba8vqmbmJ+hoaGkpKempaiqpaanoZyR
hH9/iKqTfXt3eGtYWFJFNCslKkpYaHR5fISYknh4hIJ/g5GkpKWpqaqtraymoJKGgnRiZGl0dHZx
bm5pYl9XVllUUExQZGlbWWBoa3R8gYWKjpGUk5iYlIh2aFZHQEBEUmFwZFdQQD5CS1dwV01LUFRZ
YGJvd3x/fXZ0cW5gUGRrUk1QV1thanJ3dHl4fX16eG1eTUM1JhwcLDxDSU5TYmVdX2Jla3lqX2Je
U0tBPkFDQD0+Pj5HQD04OUFPYmBiZGdkYmRiYmBgXVlNQzs3Ojw6Pj1UaGJia2tram5xb2phYmFf
ZWZgX2RiZGRlZ3B0eXhvZlZALCIgJSk+SUlPVVZTUE1GPjpBT1RbYGdpZmt9j5aRj4+OioiKhYV9
eXlzZllTYnKJobrF19rJx8jIxcXMzMrHx8rBvMDAvLzDxcXXzb/Fy8XCu7e+vLzAv8HAubaytrWy
0LeXmKOkoaGWj5OCeoWUoKWss8vIvLy7ubq+u7/CwrzCwr+/wL68wru6vLGln5iWlJWNhoKAhH94
blA9PjUzMjI5OTk+QERKSk1QU1deZXSRlZWXm5ycm6GdoKGmqqqutraysK+vs7Oxtbi4tbe2rKOK
X0xnhZKYoJ6doZ6YnqWdnZiYmI+FcWtwe4WGiYiOkY+Njo2NiIiDf3RiWVJJQkBHZnmAiZaTk5aT
j42DgYJ3YltZYGtwcnmChoySl5eUj46Li4ichnp9f3xycW5oVUdBPDUwMSssLDA9UlJNUlRVWFll
Z2dnaHtvYltQUE9Vcn+Pm5qWl5ihoZ2YnqOhoJ6bnJyPi4mDfX1xV1BQUFJUU1JTUklJTUk+NUE7
OTw8PkdEREJEREJAPjovIyAZFRYUFBgaICxAUF1rdHJua2ptZlVBREs6TltkdIOPkZOcoaShoZ2U
kpGIg4F7fHx8dnFnYlZJSkxMUExTVFhUUltdUFBPTEpANzU5NTk+RVNlVVRfZF1eX15kYV5kaG1u
fI+ktbm3uLGvqqqtsqqopaGYlZKIb2ppZGRnZmpwbnFwcnJ3d3R0cnR3dHRyb3BrZFZFIxUnOEpf
aXJ9fX18eHRvamZkYV1cZGdoamlrallTU1NhfXlmZGVgYWRiX15ZXGRla4ORmKGqvMOzt7y+vr7D
yMvKysrOzcrMzcOecVhcdo+TlJiUlpWTmJKPj4qJWVhZXF1hZHRzbXSAgHx8hpGUk5SPlZSSlJOM
iY2DiIOBho2Pk5KMkZKTlpGSj4yKiImNlJyaj4yLeHh4eH17en13dHB3aV5eWVZSUFJTVlNVW2Jv
ZW97hH13fHl0d3aBg4aIeXNxb3F0cnFva25tZmZrZF4+KyMaICZGdpestaqlraqmqrjCvrizta2g
hnFZZZKblpublpaXk4+PjYGAenNzcWdbTF9tcnd2d3Fyb3yXnZiSlZaUn6ShnqGmp6itsbOyqJ2a
mJufoJyam5iXmJKJfXZxb3p6cG5zeX2BfXt9fHx5e3Z0dH19dHBwa2RiWVhdZ2BZXVlYV1RWVFJV
VFlmbXB2dHp9hH19fXt8e3x2b29ydHuIuMyzr7Ozsbm8ubi1qqexws3Mwbu/u7OzrqijoY2GkY+P
l5KLjpKUmJqpqJeUl5WVlZ7A262Wm6ipo5+fmpeNf2lPVXRzcnh/g4SJjIaGiIWFgXhuZ1BHREVH
QkBBPj0lDAwjOTpDREdLWU5HSU1TUFhkbXB0c3JzdHRxcGpoZmFqbnJxc3yCgH18fXRra2lvdHFy
d3RwcXRxcXF0dnJ0c3R0eW9cT09XU1tdZmp3dnZ7fYCGhYiOkZORj5WRlYRwaG5wc3J0d3uFjYaM
hoWJhouFdGVkZ25oal5QSjczMDAwPklPVVdfXVldYmlnaGtpZmVpaGdlYmJcXmBeZHqLl56nqq7O
xLW1tbW1s7u4r6yzsJqVj6GOioyVjoWBfYCWs4R2d3t8dnhzdG5pYFVJPjgzMCwsNT1DUFVXV1NZ
Xl9kaGdlV09PUklPUEtLS0tMSkxVVlxfZGhxcndtYl5WUEtCQEBDR1VocHJubW5yfYaNlo+PkZSN
hH90dHFtXlBJTVZfa25uc3Z4gYKGhYZ7dHNmWV